--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:28:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsM/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -503.60          -507.23
2       -503.59          -506.93
--------------------------------------
TOTAL     -503.59          -507.09
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892905    0.089435    0.346565    1.484922    0.862531   1282.86   1384.85    1.000
r(A<->C){all}   0.169026    0.020012    0.000038    0.459969    0.134334    254.08    311.26    1.000
r(A<->G){all}   0.173474    0.021574    0.000138    0.463583    0.132934    196.15    269.63    1.000
r(A<->T){all}   0.169511    0.021248    0.000013    0.472800    0.134107    243.88    249.17    1.000
r(C<->G){all}   0.151957    0.017309    0.000037    0.420191    0.116085    180.47    253.37    1.002
r(C<->T){all}   0.171365    0.021221    0.000010    0.473474    0.133443    129.07    161.76    1.000
r(G<->T){all}   0.164667    0.017619    0.000165    0.424536    0.135562    179.88    246.65    1.000
pi(A){all}      0.236291    0.000478    0.194240    0.278451    0.236079   1154.16   1163.35    1.000
pi(C){all}      0.308547    0.000548    0.264178    0.355273    0.308723   1230.21   1240.54    1.000
pi(G){all}      0.306112    0.000557    0.261431    0.353169    0.305773   1249.36   1335.68    1.000
pi(T){all}      0.149051    0.000328    0.115026    0.184898    0.148208    836.25   1080.83    1.000
alpha{1,2}      0.405734    0.221168    0.000127    1.341922    0.236388   1188.10   1195.50    1.000
alpha{3}        0.456308    0.250092    0.000340    1.482230    0.292638   1075.02   1113.78    1.000
pinvar{all}     0.995526    0.000028    0.985681    0.999995    0.997226   1197.03   1240.75    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-479.415449
Model 2: PositiveSelection	-479.415469
Model 0: one-ratio	-479.415443
Model 7: beta	-479.415494
Model 8: beta&w>1	-479.415406


Model 0 vs 1	1.200000008338975E-5

Model 2 vs 1	3.999999989900971E-5

Model 8 vs 7	1.7600000001039007E-4
>C1
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C2
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C3
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C4
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C5
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C6
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124 

C1              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C2              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C3              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C4              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C5              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C6              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
                **************************************************

C1              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C2              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C3              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C4              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C5              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C6              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
                **************************************************

C1              QRTKTNARTRKGPKRTIAGKKKAR
C2              QRTKTNARTRKGPKRTIAGKKKAR
C3              QRTKTNARTRKGPKRTIAGKKKAR
C4              QRTKTNARTRKGPKRTIAGKKKAR
C5              QRTKTNARTRKGPKRTIAGKKKAR
C6              QRTKTNARTRKGPKRTIAGKKKAR
                ************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  124 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  124 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3720]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3720]--->[3720]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.653 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C2              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C3              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C4              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C5              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C6              MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
                **************************************************

C1              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C2              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C3              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C4              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C5              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C6              DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
                **************************************************

C1              QRTKTNARTRKGPKRTIAGKKKAR
C2              QRTKTNARTRKGPKRTIAGKKKAR
C3              QRTKTNARTRKGPKRTIAGKKKAR
C4              QRTKTNARTRKGPKRTIAGKKKAR
C5              QRTKTNARTRKGPKRTIAGKKKAR
C6              QRTKTNARTRKGPKRTIAGKKKAR
                ************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C2              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C3              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C4              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C5              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C6              ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
                **************************************************

C1              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C2              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C3              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C4              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C5              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C6              CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
                **************************************************

C1              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C2              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C3              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C4              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C5              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C6              TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
                **************************************************

C1              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C2              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C3              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C4              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C5              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C6              GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
                **************************************************

C1              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C2              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C3              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C4              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C5              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C6              AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
                **************************************************

C1              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C2              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C3              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C4              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C5              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C6              TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
                **************************************************

C1              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C2              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C3              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C4              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C5              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C6              CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
                **************************************************

C1              TGCAGGCAAGAAGAAGGCCAGG
C2              TGCAGGCAAGAAGAAGGCCAGG
C3              TGCAGGCAAGAAGAAGGCCAGG
C4              TGCAGGCAAGAAGAAGGCCAGG
C5              TGCAGGCAAGAAGAAGGCCAGG
C6              TGCAGGCAAGAAGAAGGCCAGG
                **********************



>C1
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C2
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C3
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C4
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C5
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C6
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C1
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C2
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C3
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C4
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C5
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C6
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 372 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579793204
      Setting output file names to "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 267566631
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0794959148
      Seed = 797280871
      Swapseed = 1579793204
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -832.553837 -- -24.965149
         Chain 2 -- -832.553837 -- -24.965149
         Chain 3 -- -832.553837 -- -24.965149
         Chain 4 -- -832.553710 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -832.553789 -- -24.965149
         Chain 2 -- -832.553837 -- -24.965149
         Chain 3 -- -832.553710 -- -24.965149
         Chain 4 -- -832.553837 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-832.554] (-832.554) (-832.554) (-832.554) * [-832.554] (-832.554) (-832.554) (-832.554) 
        500 -- (-522.156) [-517.859] (-516.682) (-517.005) * (-513.702) [-513.849] (-512.620) (-516.864) -- 0:00:00
       1000 -- [-519.069] (-511.353) (-518.852) (-516.221) * (-520.431) (-511.515) (-511.938) [-509.112] -- 0:00:00
       1500 -- (-517.807) (-511.118) (-518.715) [-508.302] * [-509.322] (-519.544) (-512.662) (-513.678) -- 0:00:00
       2000 -- (-511.487) [-510.905] (-516.306) (-518.150) * [-518.171] (-514.240) (-515.350) (-510.645) -- 0:00:00
       2500 -- (-517.028) [-509.840] (-517.785) (-509.885) * (-514.859) [-515.033] (-516.155) (-515.574) -- 0:00:00
       3000 -- (-513.993) [-514.282] (-519.015) (-517.860) * [-513.939] (-516.332) (-516.042) (-514.831) -- 0:00:00
       3500 -- (-514.790) (-517.505) [-514.294] (-511.059) * (-509.428) [-509.026] (-514.798) (-514.172) -- 0:00:00
       4000 -- (-511.530) [-509.469] (-520.439) (-512.523) * (-507.042) (-514.969) [-512.365] (-516.375) -- 0:00:00
       4500 -- [-519.815] (-524.896) (-517.359) (-525.056) * (-510.344) [-514.209] (-508.732) (-518.568) -- 0:00:00
       5000 -- (-509.158) (-511.581) [-517.050] (-507.282) * (-512.073) (-515.347) [-511.792] (-513.408) -- 0:00:00

      Average standard deviation of split frequencies: 0.074826

       5500 -- (-515.506) (-511.614) [-510.150] (-502.900) * [-511.313] (-507.155) (-525.358) (-510.756) -- 0:00:00
       6000 -- (-526.818) [-515.255] (-518.389) (-504.374) * [-512.890] (-520.740) (-520.534) (-510.439) -- 0:00:00
       6500 -- (-527.390) (-516.012) (-517.709) [-503.246] * [-509.238] (-513.847) (-517.949) (-509.023) -- 0:00:00
       7000 -- (-517.998) (-517.504) (-516.522) [-504.612] * (-506.674) (-510.811) (-525.912) [-510.280] -- 0:00:00
       7500 -- [-514.611] (-512.568) (-521.943) (-505.808) * (-524.331) (-513.231) (-520.381) [-512.394] -- 0:00:00
       8000 -- (-517.101) (-519.002) [-516.694] (-505.549) * (-523.939) (-510.679) (-514.685) [-507.520] -- 0:00:00
       8500 -- (-510.905) (-518.332) [-505.337] (-504.041) * [-511.669] (-509.021) (-527.631) (-513.414) -- 0:00:00
       9000 -- (-517.746) [-515.433] (-503.311) (-503.975) * [-513.382] (-516.259) (-504.994) (-512.345) -- 0:00:00
       9500 -- (-516.908) (-535.495) [-502.457] (-502.895) * (-515.806) (-508.974) (-509.656) [-512.399] -- 0:00:00
      10000 -- (-517.172) [-507.029] (-504.108) (-505.397) * (-517.689) (-516.575) [-508.041] (-511.423) -- 0:00:00

      Average standard deviation of split frequencies: 0.061381

      10500 -- (-514.541) [-505.296] (-505.878) (-503.456) * (-514.968) [-515.454] (-505.736) (-517.811) -- 0:00:00
      11000 -- (-512.403) (-504.273) [-503.629] (-502.961) * [-509.310] (-521.977) (-503.910) (-508.736) -- 0:00:00
      11500 -- (-514.637) [-502.489] (-504.771) (-502.495) * [-512.114] (-512.480) (-506.413) (-507.316) -- 0:00:00
      12000 -- (-514.444) [-503.348] (-504.238) (-505.564) * [-508.396] (-517.765) (-506.357) (-512.238) -- 0:00:00
      12500 -- (-519.443) [-505.028] (-505.367) (-503.298) * [-511.859] (-521.709) (-504.057) (-508.123) -- 0:00:00
      13000 -- (-515.322) [-503.142] (-502.442) (-504.705) * (-514.331) [-511.605] (-506.028) (-521.168) -- 0:00:00
      13500 -- (-510.280) [-503.464] (-504.527) (-502.715) * (-528.521) [-510.753] (-503.381) (-513.463) -- 0:00:00
      14000 -- (-520.923) [-502.953] (-502.815) (-507.922) * (-520.822) [-515.598] (-509.383) (-513.560) -- 0:00:00
      14500 -- (-512.041) (-502.690) [-502.889] (-504.547) * (-510.893) (-520.803) [-504.713] (-515.715) -- 0:01:07
      15000 -- (-515.485) (-503.715) [-503.044] (-505.530) * (-505.644) (-518.046) (-502.588) [-514.112] -- 0:01:05

      Average standard deviation of split frequencies: 0.061872

      15500 -- (-511.634) (-508.463) (-503.993) [-503.309] * [-503.988] (-511.345) (-503.812) (-517.801) -- 0:01:03
      16000 -- (-511.221) (-503.373) [-504.122] (-507.741) * [-503.004] (-521.217) (-505.760) (-521.397) -- 0:01:01
      16500 -- (-513.316) (-503.695) (-503.622) [-503.374] * (-503.812) [-509.916] (-504.331) (-520.918) -- 0:00:59
      17000 -- (-518.000) (-504.105) (-506.033) [-503.494] * (-504.088) (-515.749) (-504.116) [-509.308] -- 0:00:57
      17500 -- (-517.679) [-502.398] (-504.870) (-508.487) * [-505.851] (-513.334) (-508.512) (-507.708) -- 0:00:56
      18000 -- [-513.150] (-503.554) (-504.540) (-508.463) * [-504.719] (-513.437) (-504.336) (-508.806) -- 0:00:54
      18500 -- (-519.307) [-506.040] (-504.513) (-503.764) * (-504.379) (-515.748) [-506.450] (-506.507) -- 0:00:53
      19000 -- (-514.686) (-505.382) (-506.228) [-504.049] * [-503.761] (-515.288) (-504.938) (-505.167) -- 0:00:51
      19500 -- (-511.123) (-504.500) (-505.896) [-504.913] * (-509.386) [-517.755] (-503.221) (-504.594) -- 0:00:50
      20000 -- (-515.375) (-502.971) [-504.314] (-503.238) * (-504.337) [-512.539] (-503.564) (-506.831) -- 0:00:49

      Average standard deviation of split frequencies: 0.052329

      20500 -- [-510.512] (-504.726) (-503.044) (-503.135) * (-505.396) (-511.536) (-504.673) [-503.435] -- 0:00:47
      21000 -- (-526.238) [-505.120] (-503.352) (-503.872) * (-504.315) [-507.982] (-503.468) (-504.546) -- 0:00:46
      21500 -- (-513.443) [-503.912] (-504.386) (-505.241) * [-508.659] (-512.684) (-505.018) (-506.741) -- 0:00:45
      22000 -- (-517.345) (-505.562) [-504.229] (-503.430) * (-507.293) [-513.509] (-502.562) (-506.710) -- 0:00:44
      22500 -- (-521.875) (-504.441) [-504.526] (-504.618) * [-505.810] (-512.394) (-503.647) (-505.180) -- 0:00:43
      23000 -- (-522.167) [-503.451] (-503.803) (-505.276) * (-502.326) (-512.974) [-506.963] (-503.512) -- 0:00:42
      23500 -- [-503.560] (-505.322) (-502.222) (-503.358) * (-502.628) (-514.743) (-503.949) [-502.404] -- 0:00:41
      24000 -- (-503.596) (-503.927) [-502.031] (-502.193) * (-503.178) (-512.672) (-506.445) [-502.934] -- 0:00:40
      24500 -- [-502.451] (-502.340) (-503.788) (-502.346) * (-502.477) [-513.343] (-505.501) (-504.625) -- 0:00:39
      25000 -- [-505.613] (-502.204) (-506.625) (-504.336) * (-502.257) (-513.071) (-505.439) [-503.962] -- 0:00:39

      Average standard deviation of split frequencies: 0.050076

      25500 -- (-505.076) [-502.298] (-505.517) (-506.093) * (-504.413) (-511.033) (-504.636) [-503.835] -- 0:00:38
      26000 -- (-503.790) [-502.740] (-504.493) (-504.192) * (-505.151) (-514.537) [-503.509] (-503.788) -- 0:00:37
      26500 -- (-505.808) (-503.920) [-505.666] (-503.606) * [-503.613] (-517.516) (-504.612) (-503.743) -- 0:00:36
      27000 -- (-502.946) [-505.721] (-503.358) (-503.414) * (-503.169) [-516.366] (-506.973) (-508.093) -- 0:00:36
      27500 -- (-503.603) (-505.410) [-505.328] (-505.034) * (-506.977) [-514.027] (-504.884) (-503.340) -- 0:00:35
      28000 -- [-505.192] (-503.768) (-507.649) (-504.759) * (-506.487) (-518.508) (-504.351) [-502.522] -- 0:00:34
      28500 -- (-503.752) [-505.523] (-504.342) (-503.593) * (-503.422) (-515.245) [-504.701] (-502.837) -- 0:00:34
      29000 -- [-502.178] (-507.104) (-504.415) (-508.606) * [-502.873] (-515.174) (-505.723) (-504.748) -- 0:00:33
      29500 -- (-504.899) (-504.020) (-502.543) [-506.331] * (-502.738) [-516.808] (-507.809) (-507.418) -- 0:00:32
      30000 -- (-506.050) [-506.227] (-502.359) (-503.045) * [-502.745] (-513.618) (-503.781) (-504.116) -- 0:00:32

      Average standard deviation of split frequencies: 0.038430

      30500 -- [-503.929] (-504.991) (-502.951) (-504.579) * [-502.853] (-513.026) (-503.604) (-506.632) -- 0:00:31
      31000 -- (-504.837) [-507.042] (-502.386) (-505.507) * [-502.981] (-521.117) (-503.541) (-504.566) -- 0:01:02
      31500 -- (-504.521) [-507.866] (-503.696) (-503.656) * (-502.637) (-517.794) (-503.189) [-503.993] -- 0:01:01
      32000 -- (-503.715) [-504.460] (-503.467) (-505.270) * (-503.399) (-508.806) [-504.537] (-505.159) -- 0:01:00
      32500 -- [-505.516] (-505.045) (-503.943) (-505.598) * (-504.291) [-510.679] (-503.964) (-502.520) -- 0:00:59
      33000 -- (-506.364) (-502.685) [-504.936] (-505.035) * (-507.572) [-506.279] (-502.933) (-503.870) -- 0:00:58
      33500 -- (-505.885) [-502.132] (-502.948) (-504.434) * [-511.249] (-510.670) (-502.227) (-503.850) -- 0:00:57
      34000 -- (-503.545) [-502.331] (-501.990) (-506.439) * (-506.402) [-508.516] (-503.265) (-508.242) -- 0:00:56
      34500 -- (-505.603) (-505.106) [-502.825] (-503.426) * (-504.551) [-507.084] (-503.393) (-502.442) -- 0:00:55
      35000 -- [-505.755] (-507.195) (-507.680) (-501.977) * (-503.943) (-511.374) (-505.805) [-503.124] -- 0:00:55

      Average standard deviation of split frequencies: 0.040593

      35500 -- (-504.250) [-503.478] (-502.503) (-502.713) * (-504.475) (-519.116) (-505.091) [-503.138] -- 0:00:54
      36000 -- [-504.180] (-503.357) (-504.246) (-503.029) * (-502.085) [-508.573] (-505.250) (-503.810) -- 0:00:53
      36500 -- (-504.447) (-502.946) [-505.501] (-505.500) * (-503.622) (-512.986) [-502.903] (-504.591) -- 0:00:52
      37000 -- (-504.209) [-502.980] (-509.049) (-504.158) * (-506.432) (-514.404) [-504.863] (-504.045) -- 0:00:52
      37500 -- (-504.719) (-503.872) [-502.721] (-503.709) * (-504.483) [-513.677] (-506.504) (-504.424) -- 0:00:51
      38000 -- (-504.157) [-502.989] (-503.013) (-505.355) * (-505.707) (-511.602) (-503.912) [-503.338] -- 0:00:50
      38500 -- [-505.058] (-506.489) (-503.267) (-507.537) * [-504.283] (-509.186) (-506.224) (-505.021) -- 0:00:49
      39000 -- (-504.982) [-504.698] (-506.162) (-504.090) * (-504.736) [-508.646] (-506.354) (-504.509) -- 0:00:49
      39500 -- (-504.462) [-504.530] (-502.955) (-506.263) * (-504.482) (-509.179) (-505.890) [-505.384] -- 0:00:48
      40000 -- (-505.022) [-505.283] (-506.892) (-506.766) * (-505.912) (-515.615) (-504.055) [-505.944] -- 0:00:48

      Average standard deviation of split frequencies: 0.039657

      40500 -- (-505.697) (-505.963) (-503.631) [-507.280] * (-504.473) (-524.978) [-504.511] (-507.763) -- 0:00:47
      41000 -- (-505.796) (-506.285) (-508.849) [-506.432] * (-504.178) (-511.318) (-505.874) [-503.968] -- 0:00:46
      41500 -- (-507.885) (-504.761) (-505.176) [-503.474] * (-503.739) [-509.696] (-504.345) (-502.975) -- 0:00:46
      42000 -- [-502.926] (-503.457) (-503.480) (-511.561) * (-501.900) (-524.908) (-503.990) [-503.979] -- 0:00:45
      42500 -- [-504.535] (-508.117) (-502.666) (-504.319) * [-502.538] (-522.577) (-504.991) (-504.021) -- 0:00:45
      43000 -- (-505.974) [-510.178] (-504.605) (-504.050) * (-504.661) [-520.759] (-506.289) (-504.902) -- 0:00:44
      43500 -- [-504.523] (-505.690) (-503.736) (-503.708) * (-503.350) (-523.980) (-502.744) [-502.872] -- 0:00:43
      44000 -- (-503.730) [-502.330] (-504.658) (-504.456) * (-502.144) [-513.562] (-503.962) (-502.127) -- 0:00:43
      44500 -- [-506.475] (-502.692) (-506.078) (-504.624) * [-504.873] (-513.728) (-502.639) (-505.359) -- 0:00:42
      45000 -- (-507.199) (-504.940) (-503.723) [-503.649] * (-504.755) (-516.365) (-503.916) [-502.645] -- 0:00:42

      Average standard deviation of split frequencies: 0.037576

      45500 -- (-507.121) [-502.862] (-503.357) (-503.080) * (-505.338) [-509.795] (-502.895) (-504.086) -- 0:00:41
      46000 -- (-504.543) (-507.546) (-504.789) [-505.130] * (-505.602) (-525.040) (-504.930) [-502.108] -- 0:00:41
      46500 -- (-506.017) [-502.381] (-503.050) (-503.500) * (-506.086) (-513.154) (-505.155) [-502.966] -- 0:00:41
      47000 -- (-504.318) [-502.812] (-506.888) (-502.216) * (-513.900) (-508.589) (-507.111) [-502.359] -- 0:00:40
      47500 -- (-504.562) [-504.838] (-506.544) (-505.226) * [-505.397] (-512.070) (-503.811) (-504.298) -- 0:00:40
      48000 -- (-503.203) [-505.657] (-507.511) (-503.782) * (-509.928) (-513.833) (-506.001) [-503.725] -- 0:00:59
      48500 -- (-503.246) [-503.662] (-504.437) (-502.434) * [-505.422] (-512.501) (-507.198) (-507.375) -- 0:00:58
      49000 -- (-504.949) (-502.511) (-508.240) [-503.583] * (-505.305) [-514.146] (-507.281) (-505.536) -- 0:00:58
      49500 -- (-508.668) (-503.509) (-506.600) [-503.332] * (-504.414) [-513.136] (-505.217) (-505.621) -- 0:00:57
      50000 -- (-510.933) (-502.494) [-506.936] (-507.932) * (-503.605) (-512.667) (-504.169) [-503.159] -- 0:00:57

      Average standard deviation of split frequencies: 0.034768

      50500 -- (-502.946) (-502.865) [-508.718] (-504.956) * (-504.770) (-516.427) [-503.647] (-503.796) -- 0:00:56
      51000 -- (-503.028) (-504.863) (-504.680) [-504.754] * [-503.099] (-516.003) (-503.999) (-505.053) -- 0:00:55
      51500 -- (-502.767) (-504.637) (-502.955) [-502.737] * (-503.343) [-509.284] (-503.633) (-503.776) -- 0:00:55
      52000 -- (-505.943) (-507.823) (-503.236) [-502.451] * (-504.828) (-516.902) [-503.463] (-504.577) -- 0:00:54
      52500 -- (-502.977) (-504.199) [-505.629] (-504.077) * [-504.695] (-523.457) (-504.095) (-502.987) -- 0:00:54
      53000 -- [-504.222] (-503.049) (-509.120) (-504.207) * [-505.265] (-508.127) (-505.032) (-502.628) -- 0:00:53
      53500 -- (-505.149) (-509.428) [-505.865] (-502.257) * (-503.280) (-520.475) (-507.346) [-502.297] -- 0:00:53
      54000 -- [-502.096] (-507.461) (-506.437) (-504.403) * (-502.925) (-515.559) [-505.727] (-503.036) -- 0:00:52
      54500 -- (-502.341) (-504.765) (-507.771) [-506.129] * (-504.633) (-512.986) (-504.741) [-507.338] -- 0:00:52
      55000 -- (-502.258) [-504.668] (-506.408) (-507.632) * (-507.243) [-508.902] (-504.387) (-503.865) -- 0:00:51

      Average standard deviation of split frequencies: 0.033229

      55500 -- (-513.189) (-503.559) [-503.832] (-502.086) * (-505.846) (-515.951) (-502.788) [-504.204] -- 0:00:51
      56000 -- (-505.056) (-504.442) (-506.431) [-503.439] * (-502.888) (-510.420) [-505.603] (-506.300) -- 0:00:50
      56500 -- (-502.191) (-504.034) [-507.198] (-503.275) * (-503.546) [-509.385] (-502.506) (-503.768) -- 0:00:50
      57000 -- (-503.226) [-505.763] (-504.183) (-506.397) * (-502.711) (-508.030) [-503.096] (-502.819) -- 0:00:49
      57500 -- (-511.771) [-505.668] (-503.472) (-503.369) * [-506.134] (-510.718) (-502.158) (-509.304) -- 0:00:49
      58000 -- (-504.368) [-504.145] (-504.745) (-505.457) * (-504.007) (-514.394) [-503.157] (-508.160) -- 0:00:48
      58500 -- (-504.988) (-504.773) [-505.630] (-505.528) * (-503.861) [-512.433] (-504.092) (-505.587) -- 0:00:48
      59000 -- (-504.163) (-509.991) [-506.040] (-505.588) * (-502.979) (-508.088) [-506.170] (-506.508) -- 0:00:47
      59500 -- [-503.205] (-506.447) (-504.065) (-507.644) * [-504.194] (-516.371) (-504.843) (-505.742) -- 0:00:47
      60000 -- (-505.919) (-506.133) (-505.390) [-508.293] * [-503.423] (-515.893) (-508.875) (-505.353) -- 0:00:47

      Average standard deviation of split frequencies: 0.033824

      60500 -- (-504.278) (-505.680) (-508.694) [-503.653] * (-503.770) (-516.761) [-504.039] (-504.960) -- 0:00:46
      61000 -- (-505.000) (-504.288) [-503.634] (-503.577) * (-505.120) (-522.163) (-506.094) [-504.687] -- 0:00:46
      61500 -- (-505.978) [-503.740] (-506.642) (-502.596) * (-505.509) (-528.312) (-505.175) [-502.717] -- 0:00:45
      62000 -- (-507.567) (-502.324) [-503.859] (-503.871) * (-507.280) [-503.422] (-503.724) (-505.208) -- 0:00:45
      62500 -- (-505.174) (-505.498) (-505.444) [-502.695] * (-504.143) [-504.774] (-511.641) (-505.511) -- 0:00:45
      63000 -- (-506.603) (-505.828) (-503.051) [-502.195] * (-502.926) (-505.502) (-510.621) [-503.398] -- 0:00:44
      63500 -- [-510.611] (-505.968) (-504.951) (-502.375) * (-504.537) (-505.825) [-507.405] (-505.905) -- 0:00:44
      64000 -- [-503.906] (-504.644) (-502.613) (-506.421) * (-504.531) (-502.501) (-503.121) [-504.383] -- 0:00:43
      64500 -- (-502.654) (-504.696) [-502.446] (-507.178) * [-503.812] (-504.438) (-503.478) (-503.744) -- 0:00:58
      65000 -- (-505.358) (-502.442) [-504.529] (-505.838) * (-504.242) [-503.017] (-504.453) (-503.344) -- 0:00:57

      Average standard deviation of split frequencies: 0.032311

      65500 -- (-505.036) [-502.471] (-510.993) (-504.951) * (-505.629) [-502.726] (-502.945) (-504.222) -- 0:00:57
      66000 -- [-505.542] (-502.677) (-508.060) (-504.759) * (-505.613) (-505.891) [-504.436] (-503.894) -- 0:00:56
      66500 -- [-505.817] (-503.221) (-514.614) (-508.537) * [-503.930] (-504.350) (-504.637) (-503.677) -- 0:00:56
      67000 -- (-503.918) (-502.877) (-507.478) [-506.465] * (-502.028) [-502.947] (-505.182) (-504.471) -- 0:00:55
      67500 -- (-505.687) [-503.334] (-502.893) (-502.729) * [-504.519] (-509.314) (-504.110) (-509.494) -- 0:00:55
      68000 -- (-508.317) (-503.755) [-505.096] (-504.115) * (-504.594) [-502.509] (-506.055) (-507.801) -- 0:00:54
      68500 -- (-507.382) (-502.211) (-504.496) [-502.822] * (-505.698) [-506.105] (-502.083) (-505.269) -- 0:00:54
      69000 -- [-502.926] (-509.593) (-514.069) (-503.314) * (-503.658) (-505.973) [-507.199] (-504.319) -- 0:00:53
      69500 -- (-505.748) [-502.330] (-508.165) (-505.499) * (-504.924) (-505.355) (-502.796) [-502.947] -- 0:00:53
      70000 -- (-509.758) [-502.433] (-503.587) (-507.912) * (-507.395) (-507.091) (-503.246) [-502.513] -- 0:00:53

      Average standard deviation of split frequencies: 0.028017

      70500 -- (-505.476) (-504.283) (-503.587) [-504.785] * (-506.093) (-506.042) [-502.729] (-503.471) -- 0:00:52
      71000 -- (-505.023) (-504.995) [-505.960] (-505.611) * (-502.556) [-505.366] (-507.192) (-505.062) -- 0:00:52
      71500 -- (-503.345) (-505.937) [-506.473] (-507.247) * (-503.681) (-507.870) (-506.911) [-507.816] -- 0:00:51
      72000 -- (-502.926) (-506.126) [-509.203] (-502.203) * (-505.919) (-502.749) [-504.099] (-502.314) -- 0:00:51
      72500 -- (-509.601) [-502.046] (-503.353) (-505.007) * [-502.498] (-503.256) (-503.271) (-503.918) -- 0:00:51
      73000 -- [-508.122] (-504.480) (-503.504) (-503.097) * (-504.571) [-505.198] (-506.074) (-503.115) -- 0:00:50
      73500 -- [-502.893] (-503.157) (-508.937) (-502.075) * (-505.457) [-504.459] (-503.302) (-502.970) -- 0:00:50
      74000 -- (-504.701) (-506.699) (-504.935) [-502.445] * (-502.951) [-504.083] (-502.483) (-503.561) -- 0:00:50
      74500 -- (-503.160) [-508.017] (-503.850) (-502.497) * (-503.359) [-505.811] (-503.386) (-503.554) -- 0:00:49
      75000 -- (-509.347) [-505.745] (-505.947) (-504.706) * (-506.512) (-504.900) (-505.665) [-504.527] -- 0:00:49

      Average standard deviation of split frequencies: 0.022020

      75500 -- (-511.821) [-502.866] (-503.973) (-504.977) * [-503.705] (-502.656) (-505.226) (-505.398) -- 0:00:48
      76000 -- (-504.969) [-503.359] (-506.665) (-507.572) * (-505.993) (-505.697) (-503.780) [-504.061] -- 0:00:48
      76500 -- (-505.373) [-503.286] (-505.312) (-508.897) * [-504.541] (-505.772) (-503.237) (-506.325) -- 0:00:48
      77000 -- (-505.230) [-503.578] (-504.403) (-509.860) * (-506.047) [-506.132] (-504.934) (-505.068) -- 0:00:47
      77500 -- (-505.051) [-503.491] (-503.930) (-504.717) * [-504.636] (-507.544) (-503.087) (-505.788) -- 0:00:47
      78000 -- (-505.459) (-504.656) [-504.387] (-503.239) * (-504.957) (-502.576) [-506.508] (-505.034) -- 0:00:47
      78500 -- (-504.399) (-505.378) (-503.656) [-504.898] * (-503.198) (-503.097) [-504.222] (-510.231) -- 0:00:46
      79000 -- (-505.199) (-510.837) [-505.100] (-503.725) * (-503.075) (-506.530) [-504.959] (-504.345) -- 0:00:46
      79500 -- (-503.406) [-502.607] (-506.690) (-504.330) * (-503.628) (-506.253) (-502.651) [-502.798] -- 0:00:46
      80000 -- [-504.064] (-507.047) (-505.156) (-506.037) * (-505.004) (-503.160) (-504.560) [-503.836] -- 0:00:46

      Average standard deviation of split frequencies: 0.022791

      80500 -- (-502.647) [-503.851] (-506.189) (-505.867) * (-505.115) (-505.429) (-504.644) [-507.637] -- 0:00:45
      81000 -- (-506.209) [-504.484] (-507.228) (-502.265) * [-506.759] (-505.123) (-504.976) (-504.192) -- 0:00:56
      81500 -- (-506.436) (-502.588) (-506.079) [-506.186] * (-502.460) (-508.450) [-506.906] (-504.570) -- 0:00:56
      82000 -- (-504.139) [-502.184] (-503.959) (-505.695) * (-503.542) [-503.987] (-505.479) (-504.455) -- 0:00:55
      82500 -- (-506.128) [-502.092] (-504.379) (-504.673) * [-504.349] (-506.164) (-506.756) (-505.238) -- 0:00:55
      83000 -- (-508.148) (-509.299) (-502.836) [-503.475] * [-506.940] (-512.902) (-506.193) (-507.204) -- 0:00:55
      83500 -- (-505.296) [-504.333] (-503.652) (-506.411) * (-505.696) [-504.978] (-506.766) (-504.030) -- 0:00:54
      84000 -- (-504.258) (-505.306) (-505.058) [-504.156] * (-502.489) (-507.120) [-506.728] (-502.642) -- 0:00:54
      84500 -- (-503.861) (-503.740) [-505.243] (-502.780) * (-503.231) [-503.639] (-506.699) (-502.107) -- 0:00:54
      85000 -- (-503.901) (-503.235) [-505.136] (-503.148) * (-503.784) (-505.102) [-506.299] (-502.023) -- 0:00:53

      Average standard deviation of split frequencies: 0.019459

      85500 -- (-503.437) (-504.863) [-502.878] (-503.811) * (-503.491) (-505.956) [-504.863] (-502.046) -- 0:00:53
      86000 -- (-507.059) [-504.135] (-503.221) (-503.516) * (-504.784) (-503.873) [-506.019] (-503.239) -- 0:00:53
      86500 -- (-507.598) [-502.426] (-502.790) (-503.993) * (-506.006) [-504.164] (-502.358) (-503.690) -- 0:00:52
      87000 -- (-503.464) [-502.910] (-504.521) (-504.888) * [-502.638] (-503.887) (-503.340) (-505.541) -- 0:00:52
      87500 -- (-504.866) (-504.509) (-503.340) [-502.777] * [-504.841] (-504.432) (-509.386) (-503.702) -- 0:00:52
      88000 -- (-505.811) (-507.162) (-504.429) [-503.530] * [-504.561] (-503.692) (-503.765) (-502.291) -- 0:00:51
      88500 -- (-508.585) (-504.119) (-503.792) [-503.484] * (-506.518) (-502.595) [-503.554] (-502.420) -- 0:00:51
      89000 -- (-504.324) [-504.496] (-502.893) (-506.002) * (-507.470) (-504.287) (-505.492) [-505.778] -- 0:00:51
      89500 -- (-508.925) [-503.926] (-506.815) (-502.779) * (-503.072) (-507.546) [-502.543] (-503.471) -- 0:00:50
      90000 -- (-508.420) (-504.893) (-506.012) [-503.930] * (-506.489) (-503.361) [-504.776] (-504.546) -- 0:00:50

      Average standard deviation of split frequencies: 0.018775

      90500 -- (-506.993) (-505.746) (-503.213) [-504.601] * (-505.254) (-504.832) (-506.648) [-503.000] -- 0:00:50
      91000 -- (-502.669) (-506.311) (-503.258) [-504.260] * (-504.311) (-505.383) [-502.819] (-504.732) -- 0:00:49
      91500 -- (-502.962) (-509.448) (-502.833) [-505.427] * (-504.905) (-502.957) [-503.425] (-503.567) -- 0:00:49
      92000 -- (-502.727) (-508.745) (-505.957) [-502.340] * (-507.021) [-503.663] (-506.163) (-508.221) -- 0:00:49
      92500 -- (-504.954) (-507.339) (-506.424) [-504.198] * (-505.086) (-507.339) (-506.068) [-505.149] -- 0:00:49
      93000 -- (-505.689) [-502.696] (-505.284) (-502.663) * (-505.307) (-502.405) (-506.002) [-504.178] -- 0:00:48
      93500 -- (-504.494) (-503.929) (-508.622) [-503.843] * (-504.273) (-504.077) (-503.589) [-505.416] -- 0:00:48
      94000 -- [-505.305] (-505.987) (-505.080) (-503.754) * (-505.170) (-505.084) (-506.127) [-503.563] -- 0:00:48
      94500 -- [-505.625] (-505.623) (-505.510) (-504.212) * (-505.393) (-504.193) (-506.261) [-505.130] -- 0:00:47
      95000 -- (-503.689) (-507.034) (-504.358) [-506.171] * [-503.911] (-507.206) (-504.455) (-505.896) -- 0:00:47

      Average standard deviation of split frequencies: 0.019396

      95500 -- (-504.360) (-508.371) [-503.673] (-510.633) * (-503.451) [-503.662] (-503.723) (-507.626) -- 0:00:47
      96000 -- (-505.446) [-503.997] (-505.650) (-509.510) * (-503.208) (-507.984) (-502.811) [-503.572] -- 0:00:47
      96500 -- (-506.407) (-505.465) [-505.848] (-503.689) * (-504.611) (-503.076) (-504.052) [-503.424] -- 0:00:46
      97000 -- (-504.793) [-504.156] (-503.335) (-510.657) * (-509.499) [-502.878] (-504.459) (-503.638) -- 0:00:46
      97500 -- [-507.880] (-502.825) (-506.578) (-512.315) * (-505.329) (-505.871) (-504.244) [-504.579] -- 0:00:55
      98000 -- (-505.292) (-503.784) (-505.901) [-505.614] * [-504.243] (-507.052) (-505.426) (-505.902) -- 0:00:55
      98500 -- (-505.794) (-503.190) [-503.092] (-505.856) * (-504.662) (-506.562) (-505.523) [-504.908] -- 0:00:54
      99000 -- (-503.934) [-503.193] (-506.139) (-502.664) * (-504.815) (-505.377) (-507.155) [-505.616] -- 0:00:54
      99500 -- (-503.416) (-503.820) (-504.282) [-502.796] * (-505.186) (-505.280) [-506.555] (-503.457) -- 0:00:54
      100000 -- (-504.570) [-502.968] (-503.101) (-503.357) * [-504.721] (-505.692) (-504.755) (-508.761) -- 0:00:54

      Average standard deviation of split frequencies: 0.018263

      100500 -- (-505.596) [-508.185] (-503.502) (-505.676) * (-508.027) [-504.996] (-506.519) (-505.328) -- 0:00:53
      101000 -- [-505.486] (-508.572) (-503.942) (-502.339) * (-503.480) (-503.880) (-503.932) [-504.492] -- 0:00:53
      101500 -- [-501.975] (-502.774) (-503.821) (-502.942) * (-503.722) (-505.508) (-508.296) [-503.687] -- 0:00:53
      102000 -- (-502.230) (-503.230) [-504.577] (-503.477) * (-503.112) (-504.374) (-509.176) [-502.675] -- 0:00:52
      102500 -- (-502.923) (-504.936) (-503.675) [-505.779] * [-502.676] (-506.344) (-507.594) (-502.526) -- 0:00:52
      103000 -- [-502.917] (-506.478) (-507.079) (-506.197) * (-502.277) (-506.530) [-503.146] (-505.037) -- 0:00:52
      103500 -- (-507.066) [-503.786] (-506.208) (-503.658) * [-502.421] (-505.315) (-504.102) (-502.895) -- 0:00:51
      104000 -- [-503.936] (-503.798) (-502.612) (-502.991) * (-503.620) [-503.629] (-503.790) (-502.346) -- 0:00:51
      104500 -- (-509.737) (-503.724) [-502.685] (-502.768) * (-505.084) (-509.707) (-503.930) [-502.664] -- 0:00:51
      105000 -- (-502.557) (-503.155) [-504.061] (-505.110) * (-508.598) (-507.450) [-502.478] (-502.724) -- 0:00:51

      Average standard deviation of split frequencies: 0.017566

      105500 -- (-502.166) (-502.878) (-506.087) [-502.086] * (-514.537) [-507.076] (-505.300) (-503.559) -- 0:00:50
      106000 -- (-502.676) (-503.400) [-502.869] (-503.652) * (-507.305) [-514.034] (-505.034) (-502.157) -- 0:00:50
      106500 -- (-505.472) [-502.917] (-502.976) (-504.353) * (-503.314) (-505.395) (-504.328) [-507.149] -- 0:00:50
      107000 -- (-507.144) (-504.409) (-505.838) [-510.066] * [-508.243] (-505.446) (-503.721) (-503.259) -- 0:00:50
      107500 -- (-504.394) (-504.687) [-507.016] (-510.183) * (-503.846) [-505.440] (-505.983) (-506.586) -- 0:00:49
      108000 -- [-503.746] (-504.589) (-504.531) (-508.824) * (-504.085) [-506.017] (-507.173) (-508.300) -- 0:00:49
      108500 -- (-505.034) (-503.124) (-506.225) [-505.959] * [-504.407] (-507.074) (-503.009) (-504.153) -- 0:00:49
      109000 -- [-503.555] (-503.903) (-505.663) (-504.384) * (-505.407) [-502.770] (-503.680) (-503.446) -- 0:00:49
      109500 -- (-502.971) (-502.632) (-503.226) [-503.307] * (-504.148) [-503.056] (-502.934) (-502.426) -- 0:00:48
      110000 -- (-503.986) (-504.085) (-506.678) [-502.692] * (-505.800) (-503.277) [-504.649] (-503.148) -- 0:00:48

      Average standard deviation of split frequencies: 0.019473

      110500 -- (-504.119) [-504.471] (-503.713) (-504.925) * (-505.957) (-504.140) [-506.005] (-503.346) -- 0:00:48
      111000 -- (-505.973) (-502.893) (-505.590) [-503.704] * (-508.487) (-504.259) (-503.932) [-505.462] -- 0:00:48
      111500 -- [-505.055] (-503.336) (-503.348) (-512.324) * [-503.268] (-508.506) (-504.412) (-507.612) -- 0:00:47
      112000 -- [-505.620] (-503.411) (-502.144) (-504.204) * (-503.475) (-504.170) (-503.235) [-502.744] -- 0:00:47
      112500 -- (-505.766) (-503.212) [-502.691] (-503.632) * (-505.265) (-502.247) (-503.100) [-503.435] -- 0:00:47
      113000 -- (-503.511) (-504.198) [-504.367] (-505.862) * [-509.311] (-502.311) (-505.980) (-502.465) -- 0:00:47
      113500 -- (-505.513) [-504.378] (-502.246) (-507.307) * (-513.762) (-504.192) [-502.269] (-507.000) -- 0:00:46
      114000 -- (-507.174) (-507.813) (-502.229) [-502.782] * (-505.112) [-502.428] (-503.400) (-508.333) -- 0:00:46
      114500 -- (-504.168) (-506.277) (-503.745) [-502.831] * (-505.204) (-503.111) (-506.569) [-506.234] -- 0:00:54
      115000 -- (-503.553) (-505.396) [-506.987] (-503.406) * [-503.354] (-504.106) (-502.764) (-506.829) -- 0:00:53

      Average standard deviation of split frequencies: 0.016683

      115500 -- (-504.705) [-505.429] (-504.275) (-505.261) * [-503.094] (-503.120) (-503.718) (-505.051) -- 0:00:53
      116000 -- (-505.135) (-505.813) (-503.404) [-504.135] * (-506.549) [-502.773] (-504.053) (-503.940) -- 0:00:53
      116500 -- (-505.116) (-507.575) [-502.655] (-504.802) * [-504.898] (-504.361) (-503.755) (-503.600) -- 0:00:53
      117000 -- (-504.523) (-504.366) [-506.192] (-504.693) * (-505.377) (-504.050) [-506.087] (-502.615) -- 0:00:52
      117500 -- [-502.999] (-505.459) (-504.299) (-503.812) * (-503.396) [-505.317] (-505.211) (-504.061) -- 0:00:52
      118000 -- (-503.603) [-504.283] (-507.051) (-502.794) * (-503.599) (-512.024) (-504.879) [-503.981] -- 0:00:52
      118500 -- [-503.738] (-508.934) (-504.571) (-503.010) * (-502.216) (-504.697) (-506.334) [-504.511] -- 0:00:52
      119000 -- (-503.175) (-505.234) [-507.064] (-502.376) * (-504.454) (-507.414) (-506.818) [-503.033] -- 0:00:51
      119500 -- (-508.635) (-502.234) (-502.953) [-503.319] * (-503.016) [-507.452] (-503.011) (-503.570) -- 0:00:51
      120000 -- [-503.644] (-505.070) (-503.479) (-504.728) * [-504.127] (-507.556) (-503.957) (-504.077) -- 0:00:51

      Average standard deviation of split frequencies: 0.015010

      120500 -- (-504.784) (-503.512) [-504.790] (-505.035) * (-502.467) (-508.702) (-504.918) [-503.819] -- 0:00:51
      121000 -- [-503.242] (-504.567) (-504.600) (-505.656) * [-502.066] (-509.442) (-507.191) (-503.238) -- 0:00:50
      121500 -- (-502.477) [-504.468] (-502.268) (-505.945) * (-503.339) (-505.211) [-504.888] (-504.946) -- 0:00:50
      122000 -- (-504.658) [-504.381] (-503.856) (-503.251) * (-504.278) (-505.139) (-502.666) [-502.496] -- 0:00:50
      122500 -- [-504.119] (-503.633) (-504.732) (-502.796) * [-505.176] (-503.357) (-503.212) (-503.382) -- 0:00:50
      123000 -- (-504.187) (-507.789) (-504.925) [-502.826] * (-506.313) [-506.865] (-503.505) (-504.475) -- 0:00:49
      123500 -- [-507.375] (-505.290) (-502.742) (-504.446) * (-507.996) (-504.360) [-502.644] (-503.630) -- 0:00:49
      124000 -- (-504.608) (-503.206) (-506.409) [-510.461] * (-505.233) (-504.413) [-503.962] (-504.406) -- 0:00:49
      124500 -- [-503.681] (-503.553) (-506.543) (-509.828) * (-503.022) (-504.822) [-503.094] (-504.168) -- 0:00:49
      125000 -- (-504.109) [-503.542] (-507.243) (-502.733) * (-505.825) (-503.638) [-502.659] (-505.207) -- 0:00:49

      Average standard deviation of split frequencies: 0.014965

      125500 -- (-507.273) (-504.300) [-502.432] (-502.481) * [-504.372] (-504.354) (-505.553) (-504.077) -- 0:00:48
      126000 -- (-504.309) (-504.711) [-504.071] (-503.523) * (-505.686) (-504.506) [-504.469] (-503.061) -- 0:00:48
      126500 -- [-504.415] (-504.964) (-506.066) (-502.516) * (-502.983) [-503.799] (-504.520) (-502.659) -- 0:00:48
      127000 -- [-502.097] (-502.317) (-509.527) (-505.243) * [-506.482] (-503.745) (-502.557) (-504.439) -- 0:00:48
      127500 -- (-504.128) (-504.362) (-502.264) [-506.374] * [-503.554] (-505.944) (-503.024) (-506.694) -- 0:00:47
      128000 -- [-504.238] (-508.822) (-503.456) (-503.166) * (-503.755) (-505.008) [-505.369] (-503.116) -- 0:00:47
      128500 -- (-502.741) (-502.348) [-502.372] (-506.963) * [-503.381] (-503.225) (-505.576) (-502.318) -- 0:00:47
      129000 -- (-503.206) (-505.075) [-503.903] (-504.665) * (-505.860) (-503.423) (-503.223) [-505.461] -- 0:00:47
      129500 -- (-504.509) (-503.377) [-504.049] (-504.326) * (-506.134) (-510.573) [-505.061] (-506.226) -- 0:00:47
      130000 -- (-502.366) [-507.435] (-503.563) (-505.936) * [-505.364] (-505.982) (-503.170) (-510.483) -- 0:00:46

      Average standard deviation of split frequencies: 0.014811

      130500 -- (-503.563) (-506.157) (-503.232) [-504.609] * (-504.786) (-504.596) (-506.374) [-508.631] -- 0:00:46
      131000 -- (-504.332) (-503.123) [-503.010] (-507.087) * (-503.974) (-505.803) (-507.956) [-504.855] -- 0:00:53
      131500 -- (-507.265) (-506.295) [-503.803] (-506.228) * (-508.121) (-505.399) (-505.608) [-502.182] -- 0:00:52
      132000 -- (-502.396) (-502.701) [-503.973] (-505.443) * [-506.168] (-504.398) (-505.781) (-505.667) -- 0:00:52
      132500 -- (-502.856) (-504.765) [-502.686] (-505.125) * (-503.929) (-504.405) (-504.404) [-506.173] -- 0:00:52
      133000 -- [-503.041] (-505.219) (-502.608) (-505.621) * (-504.898) (-505.341) [-505.453] (-503.204) -- 0:00:52
      133500 -- [-503.332] (-510.480) (-504.934) (-507.989) * (-506.748) [-504.342] (-505.722) (-505.281) -- 0:00:51
      134000 -- (-504.276) (-506.355) [-503.431] (-503.678) * (-506.152) (-502.990) [-503.876] (-503.844) -- 0:00:51
      134500 -- (-506.445) (-507.189) [-505.097] (-504.224) * (-505.184) [-506.768] (-505.188) (-504.357) -- 0:00:51
      135000 -- (-502.894) [-503.500] (-503.629) (-503.192) * (-504.105) (-506.572) [-505.424] (-506.168) -- 0:00:51

      Average standard deviation of split frequencies: 0.014047

      135500 -- (-504.116) (-505.597) [-505.520] (-503.842) * (-505.680) [-507.927] (-502.961) (-502.324) -- 0:00:51
      136000 -- [-502.749] (-506.135) (-506.108) (-503.331) * [-509.494] (-503.372) (-503.510) (-507.747) -- 0:00:50
      136500 -- (-506.931) [-504.969] (-504.324) (-504.614) * (-504.395) [-503.090] (-503.192) (-506.318) -- 0:00:50
      137000 -- (-504.019) [-503.744] (-506.852) (-504.534) * [-505.105] (-503.043) (-504.206) (-504.151) -- 0:00:50
      137500 -- [-504.270] (-504.394) (-504.639) (-504.161) * [-506.750] (-502.194) (-503.596) (-504.376) -- 0:00:50
      138000 -- (-502.847) (-505.090) (-508.575) [-505.342] * (-504.342) (-503.558) [-503.295] (-503.662) -- 0:00:49
      138500 -- [-503.593] (-506.852) (-505.257) (-504.564) * [-504.777] (-504.513) (-502.829) (-504.131) -- 0:00:49
      139000 -- (-503.218) (-509.493) [-506.338] (-503.657) * [-504.553] (-504.142) (-507.175) (-506.111) -- 0:00:49
      139500 -- (-505.004) [-506.461] (-507.754) (-504.899) * (-506.513) [-505.599] (-505.547) (-504.814) -- 0:00:49
      140000 -- [-505.286] (-504.727) (-506.053) (-504.436) * (-502.668) (-503.997) (-504.943) [-506.119] -- 0:00:49

      Average standard deviation of split frequencies: 0.013777

      140500 -- (-506.986) (-504.049) (-504.459) [-509.222] * (-506.319) (-505.013) [-503.537] (-505.085) -- 0:00:48
      141000 -- (-504.235) [-503.713] (-502.369) (-509.504) * [-505.259] (-503.432) (-508.448) (-503.915) -- 0:00:48
      141500 -- (-503.163) [-503.387] (-505.042) (-504.779) * (-506.122) [-504.292] (-504.463) (-505.426) -- 0:00:48
      142000 -- [-503.310] (-504.253) (-503.092) (-504.444) * (-504.777) (-505.742) [-501.992] (-503.588) -- 0:00:48
      142500 -- (-504.694) (-503.930) (-506.235) [-502.939] * (-505.401) [-505.376] (-504.884) (-503.137) -- 0:00:48
      143000 -- (-503.951) (-503.840) (-506.570) [-502.640] * (-503.325) (-502.986) [-502.608] (-504.580) -- 0:00:47
      143500 -- (-504.928) (-504.195) (-510.478) [-504.565] * (-502.956) (-505.086) (-502.721) [-503.616] -- 0:00:47
      144000 -- (-505.307) (-506.151) (-506.523) [-504.950] * (-507.123) (-504.092) (-504.789) [-503.301] -- 0:00:47
      144500 -- (-508.855) [-505.469] (-506.988) (-502.792) * [-506.541] (-502.906) (-503.919) (-504.597) -- 0:00:47
      145000 -- (-503.419) (-503.016) [-504.476] (-508.844) * (-502.665) (-505.715) [-503.939] (-502.881) -- 0:00:47

      Average standard deviation of split frequencies: 0.014275

      145500 -- (-507.151) (-503.500) [-503.346] (-504.014) * (-505.606) [-502.798] (-505.627) (-503.205) -- 0:00:46
      146000 -- (-508.907) (-508.355) (-504.504) [-504.372] * (-505.196) [-504.584] (-503.290) (-502.715) -- 0:00:46
      146500 -- [-507.932] (-509.592) (-502.297) (-506.142) * (-509.958) [-503.803] (-505.538) (-505.701) -- 0:00:46
      147000 -- (-505.691) (-504.960) (-506.036) [-504.285] * (-509.520) (-506.744) (-504.384) [-504.342] -- 0:00:46
      147500 -- [-503.645] (-505.659) (-509.159) (-503.289) * (-506.414) (-505.351) (-505.362) [-503.426] -- 0:00:52
      148000 -- (-504.577) [-503.533] (-507.387) (-502.511) * (-502.742) (-505.500) (-504.180) [-503.925] -- 0:00:51
      148500 -- [-505.175] (-503.698) (-504.211) (-504.107) * (-503.598) (-505.597) (-503.914) [-503.875] -- 0:00:51
      149000 -- [-503.634] (-503.770) (-504.780) (-504.135) * (-505.908) (-506.011) [-503.246] (-502.374) -- 0:00:51
      149500 -- (-503.936) [-506.030] (-504.064) (-509.285) * (-503.891) [-503.617] (-506.968) (-504.955) -- 0:00:51
      150000 -- (-503.615) (-503.258) [-503.033] (-504.436) * (-506.693) [-504.847] (-510.432) (-502.919) -- 0:00:51

      Average standard deviation of split frequencies: 0.015479

      150500 -- (-503.468) (-504.924) [-504.810] (-502.468) * (-508.250) (-508.125) (-506.396) [-504.007] -- 0:00:50
      151000 -- [-502.611] (-502.808) (-504.952) (-506.504) * [-503.328] (-505.080) (-506.103) (-505.145) -- 0:00:50
      151500 -- (-503.380) (-506.321) [-503.005] (-505.779) * (-503.214) [-504.204] (-504.075) (-504.349) -- 0:00:50
      152000 -- [-505.907] (-504.126) (-504.446) (-502.763) * (-503.378) (-507.126) (-502.911) [-507.277] -- 0:00:50
      152500 -- (-504.877) (-507.619) [-504.840] (-504.656) * (-503.791) [-503.957] (-503.828) (-508.241) -- 0:00:50
      153000 -- [-505.000] (-507.550) (-508.247) (-502.082) * (-504.955) (-503.020) [-505.142] (-505.835) -- 0:00:49
      153500 -- [-503.454] (-504.596) (-504.719) (-506.068) * (-504.199) [-503.720] (-505.814) (-503.540) -- 0:00:49
      154000 -- [-506.561] (-503.082) (-506.288) (-503.805) * (-502.753) (-502.487) [-502.947] (-507.560) -- 0:00:49
      154500 -- (-504.236) (-504.179) (-506.307) [-508.361] * (-503.210) (-502.971) (-503.202) [-505.830] -- 0:00:49
      155000 -- (-505.005) [-505.831] (-507.027) (-503.051) * (-503.686) (-505.063) [-503.565] (-505.621) -- 0:00:49

      Average standard deviation of split frequencies: 0.015781

      155500 -- (-502.982) (-503.881) (-506.433) [-503.252] * (-504.066) (-503.798) (-502.909) [-510.916] -- 0:00:48
      156000 -- (-509.125) (-504.173) [-503.617] (-503.821) * (-505.309) [-505.556] (-506.025) (-507.807) -- 0:00:48
      156500 -- (-503.853) (-505.483) [-505.390] (-505.546) * (-507.424) (-504.650) (-506.172) [-504.341] -- 0:00:48
      157000 -- (-505.414) [-503.953] (-508.204) (-507.834) * [-507.777] (-502.733) (-506.271) (-506.460) -- 0:00:48
      157500 -- (-505.465) (-503.391) [-504.591] (-506.808) * (-506.858) [-502.922] (-503.399) (-507.827) -- 0:00:48
      158000 -- [-505.197] (-510.794) (-507.193) (-504.745) * (-506.793) [-502.804] (-503.399) (-503.777) -- 0:00:47
      158500 -- (-504.139) (-508.509) [-508.295] (-511.006) * (-503.977) [-502.797] (-502.698) (-504.378) -- 0:00:47
      159000 -- [-504.079] (-506.257) (-508.876) (-502.413) * (-503.749) (-504.730) (-507.881) [-504.316] -- 0:00:47
      159500 -- [-504.594] (-505.834) (-505.994) (-504.655) * [-506.381] (-506.378) (-506.030) (-504.432) -- 0:00:47
      160000 -- (-505.551) (-505.909) [-506.749] (-504.696) * (-504.461) [-506.536] (-503.206) (-503.008) -- 0:00:47

      Average standard deviation of split frequencies: 0.013529

      160500 -- [-505.473] (-503.721) (-504.279) (-503.027) * (-503.953) (-504.052) [-504.661] (-502.533) -- 0:00:47
      161000 -- [-506.851] (-505.028) (-503.880) (-502.701) * (-505.665) (-508.100) [-502.337] (-507.673) -- 0:00:46
      161500 -- (-508.291) (-504.191) [-504.933] (-503.545) * (-504.592) [-504.220] (-505.048) (-508.661) -- 0:00:46
      162000 -- (-503.969) (-506.504) [-503.502] (-504.511) * (-505.371) (-503.239) [-504.251] (-505.786) -- 0:00:46
      162500 -- (-506.624) [-504.139] (-503.970) (-504.900) * (-507.358) (-507.167) (-502.394) [-503.860] -- 0:00:46
      163000 -- [-504.893] (-503.212) (-506.830) (-504.092) * (-506.043) (-503.259) (-504.152) [-503.135] -- 0:00:46
      163500 -- [-503.473] (-503.814) (-504.679) (-503.518) * (-503.737) (-504.896) (-506.530) [-507.329] -- 0:00:46
      164000 -- (-503.589) (-504.393) [-504.004] (-502.612) * (-504.491) (-503.201) (-503.368) [-505.622] -- 0:00:50
      164500 -- [-506.666] (-505.074) (-508.685) (-503.841) * (-509.105) [-502.812] (-502.956) (-507.792) -- 0:00:50
      165000 -- [-504.913] (-507.396) (-504.260) (-507.551) * (-505.270) (-505.497) (-505.244) [-503.632] -- 0:00:50

      Average standard deviation of split frequencies: 0.014357

      165500 -- (-504.363) [-504.575] (-503.632) (-504.688) * [-505.715] (-505.956) (-506.825) (-507.292) -- 0:00:50
      166000 -- (-503.211) (-503.322) [-504.154] (-505.209) * (-502.405) (-505.434) [-504.724] (-509.324) -- 0:00:50
      166500 -- (-503.091) (-506.625) (-504.202) [-503.085] * [-502.616] (-505.279) (-503.629) (-506.129) -- 0:00:50
      167000 -- (-505.649) (-503.440) [-504.342] (-503.229) * (-505.785) [-507.529] (-505.486) (-503.390) -- 0:00:49
      167500 -- (-509.326) (-504.753) [-509.183] (-503.538) * (-502.559) (-506.633) [-502.287] (-502.625) -- 0:00:49
      168000 -- (-502.423) [-503.124] (-504.318) (-504.038) * (-503.234) (-509.268) (-503.532) [-503.155] -- 0:00:49
      168500 -- (-505.667) [-504.586] (-504.179) (-504.848) * (-504.175) (-505.503) [-501.996] (-502.823) -- 0:00:49
      169000 -- [-504.428] (-503.779) (-508.567) (-507.800) * (-503.649) [-504.006] (-504.240) (-506.062) -- 0:00:49
      169500 -- (-504.874) [-503.482] (-503.866) (-508.475) * [-504.527] (-505.387) (-502.878) (-503.971) -- 0:00:48
      170000 -- (-503.155) (-502.968) (-506.271) [-505.140] * (-502.892) [-504.772] (-506.596) (-502.677) -- 0:00:48

      Average standard deviation of split frequencies: 0.015192

      170500 -- (-502.642) [-503.239] (-506.972) (-508.017) * (-503.015) [-506.968] (-506.440) (-503.379) -- 0:00:48
      171000 -- (-505.004) (-502.649) (-504.715) [-505.247] * [-506.046] (-504.837) (-503.332) (-505.293) -- 0:00:48
      171500 -- [-504.119] (-506.454) (-503.957) (-506.945) * (-512.420) [-502.866] (-503.075) (-505.039) -- 0:00:48
      172000 -- [-503.107] (-506.815) (-505.055) (-502.880) * (-502.802) [-503.158] (-503.613) (-503.594) -- 0:00:48
      172500 -- [-507.582] (-505.442) (-504.033) (-503.683) * [-503.761] (-510.137) (-508.790) (-504.092) -- 0:00:47
      173000 -- [-505.180] (-503.212) (-502.127) (-505.299) * [-502.719] (-511.354) (-504.296) (-503.287) -- 0:00:47
      173500 -- (-503.697) [-503.909] (-503.859) (-505.016) * (-504.025) (-507.328) [-504.940] (-505.523) -- 0:00:47
      174000 -- (-504.286) (-505.175) (-503.727) [-504.769] * (-508.507) (-503.147) (-504.326) [-503.591] -- 0:00:47
      174500 -- (-507.321) (-503.813) (-503.288) [-507.373] * (-503.318) [-504.347] (-505.065) (-506.301) -- 0:00:47
      175000 -- [-506.375] (-505.046) (-503.518) (-505.918) * [-505.456] (-506.364) (-504.092) (-504.293) -- 0:00:47

      Average standard deviation of split frequencies: 0.013550

      175500 -- (-508.889) (-504.354) (-504.266) [-504.441] * (-503.330) [-503.270] (-503.400) (-502.824) -- 0:00:46
      176000 -- (-507.624) (-504.857) [-502.557] (-507.589) * (-503.800) (-502.739) [-503.689] (-506.334) -- 0:00:46
      176500 -- (-509.790) [-502.743] (-505.892) (-503.788) * [-504.928] (-503.167) (-503.524) (-505.767) -- 0:00:46
      177000 -- (-508.144) [-504.621] (-502.699) (-505.014) * (-505.901) (-505.562) (-504.884) [-502.319] -- 0:00:46
      177500 -- (-511.223) (-504.082) (-503.178) [-504.657] * (-505.938) (-505.932) [-504.006] (-502.810) -- 0:00:46
      178000 -- (-506.014) [-506.286] (-504.670) (-504.539) * (-502.889) (-503.387) [-502.154] (-503.041) -- 0:00:46
      178500 -- [-507.010] (-507.423) (-504.335) (-503.885) * (-502.741) (-503.080) [-503.527] (-502.695) -- 0:00:46
      179000 -- (-505.355) (-505.690) (-504.108) [-506.114] * (-503.490) (-503.583) (-505.168) [-502.639] -- 0:00:45
      179500 -- (-503.329) (-509.664) [-503.614] (-506.421) * (-503.584) (-504.823) [-505.217] (-502.560) -- 0:00:45
      180000 -- (-504.712) (-503.790) (-506.689) [-504.737] * (-504.176) [-503.032] (-502.832) (-503.807) -- 0:00:45

      Average standard deviation of split frequencies: 0.015166

      180500 -- (-507.943) [-505.384] (-502.543) (-505.217) * (-503.407) (-504.865) (-503.669) [-502.702] -- 0:00:45
      181000 -- [-503.663] (-505.912) (-503.083) (-503.544) * (-503.514) (-506.574) [-503.303] (-502.407) -- 0:00:49
      181500 -- (-502.930) [-505.754] (-504.085) (-503.236) * (-504.287) (-508.911) [-505.714] (-502.378) -- 0:00:49
      182000 -- (-504.365) (-504.694) (-504.121) [-505.327] * [-504.270] (-507.498) (-504.348) (-503.925) -- 0:00:49
      182500 -- (-503.804) (-505.310) [-506.085] (-505.392) * [-502.622] (-505.760) (-503.459) (-504.985) -- 0:00:49
      183000 -- (-503.529) (-503.557) (-505.129) [-503.582] * (-502.725) [-503.137] (-506.514) (-506.784) -- 0:00:49
      183500 -- (-504.043) (-504.603) (-506.377) [-508.224] * (-502.679) [-503.386] (-511.272) (-505.270) -- 0:00:48
      184000 -- (-513.120) (-506.394) [-506.278] (-505.664) * [-502.679] (-509.628) (-504.600) (-502.851) -- 0:00:48
      184500 -- (-507.113) [-505.500] (-504.852) (-501.867) * (-504.105) (-502.803) (-506.315) [-502.228] -- 0:00:48
      185000 -- (-506.061) [-503.400] (-504.935) (-501.949) * (-503.134) (-507.779) [-505.145] (-503.697) -- 0:00:48

      Average standard deviation of split frequencies: 0.015066

      185500 -- [-503.338] (-504.492) (-502.660) (-504.380) * [-503.689] (-506.618) (-504.182) (-505.578) -- 0:00:48
      186000 -- (-504.884) [-505.317] (-503.418) (-505.063) * [-505.950] (-507.870) (-505.521) (-503.244) -- 0:00:48
      186500 -- [-505.067] (-506.808) (-506.962) (-504.201) * (-508.730) (-506.044) (-503.635) [-503.591] -- 0:00:47
      187000 -- (-505.184) (-505.776) (-503.177) [-503.303] * (-504.187) [-504.321] (-505.987) (-503.998) -- 0:00:47
      187500 -- [-505.951] (-506.559) (-505.388) (-508.350) * (-503.265) (-502.034) (-506.967) [-503.701] -- 0:00:47
      188000 -- (-503.022) (-508.444) [-503.225] (-507.823) * [-503.421] (-502.141) (-506.982) (-504.016) -- 0:00:47
      188500 -- [-505.222] (-503.648) (-502.845) (-505.116) * (-503.920) (-504.957) (-510.498) [-504.696] -- 0:00:47
      189000 -- (-506.258) (-506.796) (-504.483) [-504.823] * (-505.152) [-505.435] (-507.161) (-504.239) -- 0:00:47
      189500 -- (-504.518) (-505.269) (-503.768) [-502.560] * (-509.849) [-504.726] (-503.264) (-502.919) -- 0:00:47
      190000 -- (-504.875) (-502.742) (-504.588) [-508.242] * (-508.760) [-502.553] (-504.857) (-504.420) -- 0:00:46

      Average standard deviation of split frequencies: 0.016434

      190500 -- [-506.790] (-504.392) (-507.577) (-504.864) * (-507.293) (-505.850) [-506.161] (-503.001) -- 0:00:46
      191000 -- (-507.744) (-506.000) (-503.159) [-503.647] * [-506.513] (-511.197) (-505.181) (-503.811) -- 0:00:46
      191500 -- (-509.558) (-503.093) [-504.138] (-506.498) * (-505.758) (-508.234) [-504.167] (-505.382) -- 0:00:46
      192000 -- [-506.154] (-503.174) (-502.920) (-504.960) * (-505.910) [-503.673] (-502.891) (-503.472) -- 0:00:46
      192500 -- (-504.686) (-505.094) [-502.705] (-502.967) * (-503.942) (-505.103) (-504.278) [-503.003] -- 0:00:46
      193000 -- (-504.642) [-504.774] (-503.943) (-503.974) * [-502.663] (-503.175) (-503.913) (-504.565) -- 0:00:45
      193500 -- (-504.177) (-504.775) (-507.859) [-502.898] * (-504.728) [-503.570] (-503.213) (-506.752) -- 0:00:45
      194000 -- [-502.960] (-506.202) (-508.302) (-502.156) * (-503.250) (-505.530) [-505.362] (-507.387) -- 0:00:45
      194500 -- (-504.412) [-503.683] (-506.652) (-502.690) * [-503.232] (-508.962) (-506.740) (-504.084) -- 0:00:45
      195000 -- [-507.094] (-503.530) (-505.470) (-502.275) * (-505.798) (-504.826) (-507.135) [-505.561] -- 0:00:45

      Average standard deviation of split frequencies: 0.016034

      195500 -- [-504.625] (-508.783) (-503.795) (-503.055) * [-505.164] (-502.867) (-503.887) (-505.451) -- 0:00:45
      196000 -- (-503.480) (-510.003) [-506.898] (-504.100) * (-504.740) (-502.026) [-506.212] (-505.974) -- 0:00:45
      196500 -- [-502.827] (-508.796) (-503.257) (-502.417) * (-504.519) [-503.158] (-508.864) (-502.919) -- 0:00:44
      197000 -- (-503.227) [-503.153] (-504.638) (-503.581) * (-502.689) (-505.153) (-506.159) [-503.585] -- 0:00:44
      197500 -- (-503.830) [-502.815] (-503.918) (-506.010) * [-504.078] (-503.420) (-504.148) (-506.521) -- 0:00:48
      198000 -- [-502.265] (-504.000) (-503.818) (-506.175) * (-505.658) [-503.310] (-505.090) (-502.858) -- 0:00:48
      198500 -- (-503.467) [-503.713] (-502.671) (-503.684) * [-504.326] (-504.343) (-506.773) (-503.782) -- 0:00:48
      199000 -- [-505.253] (-504.931) (-502.435) (-505.629) * (-503.690) (-504.956) [-504.625] (-502.731) -- 0:00:48
      199500 -- (-502.810) (-504.407) [-505.133] (-507.172) * (-505.031) [-504.771] (-509.099) (-507.271) -- 0:00:48
      200000 -- (-504.012) (-509.730) [-503.595] (-503.471) * (-506.293) (-504.178) (-506.148) [-503.971] -- 0:00:48

      Average standard deviation of split frequencies: 0.015710

      200500 -- (-508.362) (-505.055) (-502.421) [-502.958] * (-503.032) [-505.963] (-511.358) (-503.393) -- 0:00:47
      201000 -- [-506.290] (-503.730) (-507.254) (-504.540) * [-503.788] (-506.911) (-506.322) (-503.253) -- 0:00:47
      201500 -- (-504.169) [-502.561] (-506.165) (-502.808) * (-504.753) (-504.288) (-502.985) [-505.270] -- 0:00:47
      202000 -- (-502.989) [-507.021] (-505.887) (-505.945) * [-506.673] (-507.745) (-506.260) (-504.278) -- 0:00:47
      202500 -- [-503.696] (-505.560) (-504.581) (-506.158) * [-506.934] (-505.568) (-508.552) (-505.907) -- 0:00:47
      203000 -- (-507.331) (-504.280) [-506.646] (-503.740) * [-505.767] (-504.310) (-505.015) (-504.984) -- 0:00:47
      203500 -- [-505.286] (-504.951) (-503.585) (-503.375) * (-503.112) (-507.057) [-504.007] (-507.557) -- 0:00:46
      204000 -- (-502.275) [-506.829] (-502.730) (-503.668) * (-503.208) (-505.987) (-503.081) [-506.711] -- 0:00:46
      204500 -- (-503.613) (-505.921) (-507.069) [-502.261] * (-505.673) (-505.427) [-503.033] (-503.436) -- 0:00:46
      205000 -- (-502.437) [-504.314] (-503.698) (-506.260) * (-504.445) (-504.607) (-503.946) [-503.654] -- 0:00:46

      Average standard deviation of split frequencies: 0.013984

      205500 -- (-507.512) [-507.097] (-506.841) (-504.025) * (-504.083) (-507.660) [-505.473] (-503.998) -- 0:00:46
      206000 -- (-503.895) (-503.953) (-503.262) [-504.219] * (-504.370) (-505.276) [-504.156] (-503.000) -- 0:00:46
      206500 -- [-504.272] (-504.265) (-508.574) (-503.325) * (-503.708) (-503.637) [-505.829] (-502.865) -- 0:00:46
      207000 -- (-502.603) (-503.381) [-506.209] (-502.880) * (-505.900) (-504.790) (-503.925) [-504.221] -- 0:00:45
      207500 -- (-505.988) [-503.708] (-505.842) (-503.798) * (-504.328) [-503.913] (-504.886) (-503.867) -- 0:00:45
      208000 -- [-503.371] (-504.594) (-503.550) (-507.164) * [-503.104] (-503.434) (-506.374) (-502.342) -- 0:00:45
      208500 -- (-502.266) [-505.309] (-505.066) (-504.226) * (-504.177) [-505.130] (-508.901) (-507.013) -- 0:00:45
      209000 -- [-503.412] (-504.548) (-503.458) (-505.157) * (-502.734) (-503.899) (-502.474) [-502.267] -- 0:00:45
      209500 -- (-502.110) [-503.111] (-503.227) (-507.038) * (-503.763) (-503.332) [-502.380] (-505.051) -- 0:00:45
      210000 -- (-505.967) (-503.152) (-505.818) [-502.331] * (-504.196) (-508.521) (-502.135) [-503.161] -- 0:00:45

      Average standard deviation of split frequencies: 0.014084

      210500 -- (-504.044) (-503.038) [-504.492] (-504.880) * [-504.653] (-504.346) (-504.132) (-503.435) -- 0:00:45
      211000 -- (-507.713) (-503.433) [-504.617] (-507.380) * (-505.793) (-504.268) (-504.773) [-503.283] -- 0:00:44
      211500 -- (-505.029) [-505.339] (-505.104) (-503.436) * (-507.532) (-505.543) [-502.522] (-509.030) -- 0:00:48
      212000 -- [-504.754] (-504.292) (-506.665) (-505.408) * (-504.636) [-504.605] (-503.707) (-505.307) -- 0:00:48
      212500 -- (-504.968) (-504.352) [-505.217] (-509.091) * (-505.711) [-503.391] (-506.308) (-505.162) -- 0:00:48
      213000 -- [-506.230] (-507.131) (-506.927) (-506.358) * [-501.998] (-502.927) (-503.311) (-503.677) -- 0:00:48
      213500 -- [-504.238] (-502.848) (-503.808) (-503.730) * [-502.866] (-502.525) (-504.252) (-504.078) -- 0:00:47
      214000 -- (-502.658) [-503.103] (-503.980) (-502.770) * (-503.087) [-502.591] (-503.616) (-507.640) -- 0:00:47
      214500 -- (-504.060) [-503.083] (-504.990) (-503.573) * (-504.131) (-503.836) [-503.449] (-504.940) -- 0:00:47
      215000 -- (-504.473) (-502.257) (-504.546) [-503.570] * [-504.741] (-503.626) (-508.493) (-502.955) -- 0:00:47

      Average standard deviation of split frequencies: 0.013736

      215500 -- (-502.392) (-503.864) (-507.779) [-502.589] * [-504.830] (-505.444) (-505.180) (-502.340) -- 0:00:47
      216000 -- [-502.520] (-504.452) (-505.421) (-502.948) * (-503.962) (-508.317) [-503.653] (-503.974) -- 0:00:47
      216500 -- (-505.474) [-507.699] (-505.486) (-506.854) * [-505.288] (-503.878) (-502.501) (-505.127) -- 0:00:47
      217000 -- (-502.155) (-506.734) [-504.075] (-506.633) * (-504.434) [-504.182] (-503.316) (-504.368) -- 0:00:46
      217500 -- (-503.680) (-506.770) [-504.860] (-506.247) * (-503.147) [-505.907] (-505.356) (-507.551) -- 0:00:46
      218000 -- (-503.292) [-505.401] (-503.214) (-504.940) * (-503.746) [-512.656] (-506.283) (-502.307) -- 0:00:46
      218500 -- (-504.947) (-503.258) (-504.419) [-504.967] * (-507.250) (-504.397) [-503.196] (-502.909) -- 0:00:46
      219000 -- (-503.278) [-502.755] (-506.135) (-503.061) * (-512.764) [-505.035] (-504.724) (-502.951) -- 0:00:46
      219500 -- [-503.714] (-502.775) (-505.254) (-503.639) * (-503.986) (-505.224) (-502.386) [-503.841] -- 0:00:46
      220000 -- (-503.631) (-504.467) (-504.074) [-503.732] * (-505.063) (-503.543) [-502.599] (-508.853) -- 0:00:46

      Average standard deviation of split frequencies: 0.014669

      220500 -- (-505.558) (-503.494) [-502.783] (-504.963) * (-507.063) [-503.157] (-503.597) (-503.755) -- 0:00:45
      221000 -- [-504.236] (-506.284) (-504.721) (-506.403) * (-504.917) [-504.678] (-505.065) (-502.119) -- 0:00:45
      221500 -- (-504.491) [-503.813] (-503.921) (-503.442) * (-504.289) (-503.813) [-505.537] (-502.495) -- 0:00:45
      222000 -- (-505.712) [-502.563] (-503.035) (-505.561) * (-505.520) (-509.170) [-502.036] (-503.093) -- 0:00:45
      222500 -- (-502.601) (-504.300) (-502.760) [-505.842] * (-502.168) (-503.307) [-505.155] (-507.840) -- 0:00:45
      223000 -- (-503.604) (-504.990) [-502.361] (-502.859) * (-502.593) [-503.752] (-504.218) (-503.924) -- 0:00:45
      223500 -- (-502.700) (-503.654) (-510.040) [-503.773] * [-502.893] (-505.849) (-513.173) (-507.256) -- 0:00:45
      224000 -- (-503.096) [-504.056] (-504.134) (-502.362) * [-502.395] (-503.224) (-505.378) (-508.220) -- 0:00:45
      224500 -- (-506.971) [-506.358] (-504.516) (-505.512) * (-505.791) (-505.835) [-503.771] (-507.583) -- 0:00:44
      225000 -- (-507.690) [-504.394] (-509.584) (-504.669) * (-503.028) (-502.761) (-506.434) [-504.074] -- 0:00:44

      Average standard deviation of split frequencies: 0.013442

      225500 -- (-503.647) [-509.432] (-503.079) (-504.172) * (-506.189) [-502.971] (-505.857) (-507.027) -- 0:00:44
      226000 -- (-504.184) (-503.733) (-506.486) [-502.676] * (-503.104) (-503.993) (-505.079) [-502.472] -- 0:00:44
      226500 -- (-504.154) (-503.834) [-511.889] (-504.542) * (-503.063) (-504.881) (-503.846) [-502.914] -- 0:00:47
      227000 -- (-508.155) [-506.940] (-508.431) (-505.670) * [-503.965] (-506.889) (-503.817) (-505.725) -- 0:00:47
      227500 -- (-504.799) (-504.888) [-504.424] (-513.251) * [-504.496] (-506.442) (-503.695) (-502.904) -- 0:00:47
      228000 -- (-504.720) (-507.849) (-505.030) [-505.505] * (-503.884) [-509.323] (-502.392) (-504.190) -- 0:00:47
      228500 -- (-506.052) (-506.968) [-503.834] (-508.546) * (-503.755) [-505.550] (-503.653) (-503.218) -- 0:00:47
      229000 -- (-503.995) (-504.102) [-503.034] (-503.446) * (-511.094) (-504.304) (-502.549) [-502.706] -- 0:00:47
      229500 -- (-507.892) (-502.739) [-502.700] (-503.340) * (-508.870) (-502.592) [-502.926] (-507.007) -- 0:00:47
      230000 -- (-505.620) (-504.268) (-502.245) [-503.038] * (-503.883) (-504.231) [-502.912] (-503.577) -- 0:00:46

      Average standard deviation of split frequencies: 0.011694

      230500 -- [-504.262] (-507.760) (-502.560) (-502.394) * [-503.648] (-506.787) (-504.421) (-504.800) -- 0:00:46
      231000 -- [-503.498] (-505.726) (-503.094) (-504.122) * (-503.198) (-504.708) (-502.581) [-508.740] -- 0:00:46
      231500 -- [-503.254] (-508.770) (-502.894) (-504.642) * (-502.455) (-505.601) [-502.002] (-509.752) -- 0:00:46
      232000 -- (-504.769) [-507.890] (-506.343) (-503.674) * (-505.458) (-505.519) (-504.429) [-505.617] -- 0:00:46
      232500 -- (-505.228) (-503.812) [-503.081] (-505.572) * [-506.257] (-503.786) (-508.139) (-502.227) -- 0:00:46
      233000 -- (-503.053) (-506.214) (-507.485) [-504.116] * (-502.515) (-502.395) (-508.830) [-503.078] -- 0:00:46
      233500 -- [-506.003] (-503.770) (-504.928) (-505.454) * (-505.503) [-503.646] (-506.751) (-503.916) -- 0:00:45
      234000 -- (-503.332) (-503.066) [-503.283] (-504.711) * (-503.335) (-503.489) [-503.799] (-503.801) -- 0:00:45
      234500 -- [-503.158] (-503.847) (-502.832) (-503.325) * (-504.332) (-505.771) [-502.135] (-504.434) -- 0:00:45
      235000 -- (-502.867) (-502.948) [-503.093] (-508.049) * (-502.756) [-506.021] (-502.879) (-504.328) -- 0:00:45

      Average standard deviation of split frequencies: 0.012102

      235500 -- (-506.759) (-503.877) [-503.604] (-504.528) * [-503.451] (-505.619) (-503.455) (-504.421) -- 0:00:45
      236000 -- (-502.315) [-502.956] (-503.096) (-502.705) * (-502.880) (-506.328) (-505.287) [-505.200] -- 0:00:45
      236500 -- [-506.952] (-502.690) (-503.122) (-504.256) * (-503.719) [-505.735] (-502.968) (-503.089) -- 0:00:45
      237000 -- (-506.552) [-504.678] (-502.939) (-503.490) * [-504.583] (-504.155) (-503.998) (-502.731) -- 0:00:45
      237500 -- (-504.528) (-504.057) [-503.607] (-510.011) * [-503.320] (-503.941) (-508.211) (-503.629) -- 0:00:44
      238000 -- (-504.140) [-504.654] (-507.261) (-503.494) * (-503.839) (-503.472) [-506.512] (-505.147) -- 0:00:44
      238500 -- (-502.724) [-501.979] (-505.022) (-503.709) * (-504.438) (-503.186) [-504.715] (-504.454) -- 0:00:44
      239000 -- (-505.950) [-504.085] (-508.422) (-502.751) * [-505.794] (-504.847) (-504.194) (-510.716) -- 0:00:44
      239500 -- [-503.006] (-505.007) (-505.195) (-502.195) * (-504.359) (-508.062) (-503.971) [-507.536] -- 0:00:44
      240000 -- (-503.636) (-504.721) [-504.836] (-505.939) * (-503.437) (-505.081) (-502.737) [-502.238] -- 0:00:44

      Average standard deviation of split frequencies: 0.011535

      240500 -- (-502.818) (-504.115) [-506.907] (-509.486) * (-503.515) [-506.495] (-503.233) (-502.512) -- 0:00:44
      241000 -- (-505.872) [-502.492] (-505.713) (-504.089) * (-504.161) (-504.198) (-504.802) [-505.559] -- 0:00:44
      241500 -- (-504.839) (-505.710) (-510.893) [-505.526] * (-504.943) (-503.745) (-503.962) [-503.781] -- 0:00:43
      242000 -- (-504.069) (-504.969) [-505.022] (-506.913) * (-504.220) (-503.149) (-510.836) [-503.195] -- 0:00:43
      242500 -- (-508.529) [-502.498] (-503.723) (-504.900) * (-504.598) (-508.224) [-502.866] (-505.285) -- 0:00:43
      243000 -- (-508.053) [-506.520] (-503.150) (-505.751) * (-507.862) (-508.717) [-504.202] (-503.860) -- 0:00:43
      243500 -- [-503.464] (-506.084) (-507.652) (-505.190) * (-503.369) (-506.892) (-504.691) [-506.793] -- 0:00:46
      244000 -- [-503.880] (-502.509) (-504.977) (-503.342) * (-505.510) (-502.278) [-504.278] (-505.457) -- 0:00:46
      244500 -- (-504.374) (-503.237) [-502.477] (-502.752) * (-504.200) (-505.179) (-505.600) [-502.299] -- 0:00:46
      245000 -- (-505.630) [-502.471] (-505.056) (-502.311) * (-504.947) [-502.799] (-502.453) (-503.101) -- 0:00:46

      Average standard deviation of split frequencies: 0.011817

      245500 -- (-504.205) (-503.784) (-505.298) [-502.041] * [-502.547] (-510.196) (-502.716) (-508.229) -- 0:00:46
      246000 -- [-503.682] (-506.680) (-509.571) (-504.118) * [-505.781] (-503.129) (-504.840) (-505.399) -- 0:00:45
      246500 -- (-507.690) (-503.512) [-506.973] (-504.065) * (-509.529) (-502.630) [-503.644] (-505.734) -- 0:00:45
      247000 -- (-504.803) [-502.753] (-503.492) (-506.786) * (-506.676) (-504.185) (-503.678) [-505.782] -- 0:00:45
      247500 -- (-504.685) (-505.418) (-505.661) [-502.941] * (-504.452) (-505.098) [-508.010] (-503.889) -- 0:00:45
      248000 -- (-504.634) (-506.757) [-505.587] (-504.618) * (-502.115) (-503.369) [-504.420] (-503.446) -- 0:00:45
      248500 -- (-504.101) (-503.949) [-504.944] (-503.035) * (-502.262) [-502.675] (-505.592) (-504.774) -- 0:00:45
      249000 -- (-505.046) (-504.234) [-506.142] (-502.669) * (-502.107) (-504.844) [-502.290] (-505.519) -- 0:00:45
      249500 -- (-503.045) (-504.196) (-505.656) [-504.661] * (-506.120) (-503.420) [-502.245] (-508.025) -- 0:00:45
      250000 -- (-503.361) [-504.288] (-503.500) (-505.448) * (-509.954) (-503.402) [-504.313] (-503.925) -- 0:00:45

      Average standard deviation of split frequencies: 0.013461

      250500 -- [-509.125] (-502.626) (-506.616) (-505.360) * (-503.731) (-505.105) [-503.018] (-505.582) -- 0:00:44
      251000 -- (-508.087) (-506.025) (-504.250) [-507.104] * (-505.235) (-504.472) (-505.564) [-504.997] -- 0:00:44
      251500 -- [-504.320] (-503.615) (-504.610) (-507.550) * (-502.578) (-503.010) [-512.376] (-504.422) -- 0:00:44
      252000 -- (-504.513) (-510.129) (-505.986) [-502.577] * (-503.249) [-504.528] (-507.241) (-505.364) -- 0:00:44
      252500 -- [-506.556] (-507.824) (-507.789) (-503.701) * [-504.654] (-504.602) (-505.947) (-506.192) -- 0:00:44
      253000 -- (-504.999) (-502.444) (-506.282) [-504.991] * [-502.943] (-505.003) (-509.650) (-504.364) -- 0:00:44
      253500 -- [-505.013] (-504.255) (-506.831) (-503.378) * (-506.083) (-505.074) [-506.043] (-503.357) -- 0:00:44
      254000 -- (-503.213) (-508.553) (-506.656) [-503.997] * (-508.998) [-505.625] (-503.768) (-503.179) -- 0:00:44
      254500 -- [-503.798] (-504.362) (-506.509) (-508.136) * (-508.286) [-503.620] (-507.918) (-502.761) -- 0:00:43
      255000 -- [-502.845] (-507.239) (-504.744) (-506.809) * (-508.685) [-504.402] (-503.162) (-504.798) -- 0:00:43

      Average standard deviation of split frequencies: 0.012890

      255500 -- [-505.263] (-505.721) (-505.390) (-505.678) * (-504.601) [-503.614] (-506.124) (-506.963) -- 0:00:43
      256000 -- (-503.558) (-503.755) [-507.405] (-506.310) * (-502.794) [-506.679] (-505.454) (-504.641) -- 0:00:43
      256500 -- (-503.345) (-503.239) (-506.296) [-503.403] * (-502.222) (-503.512) [-504.958] (-504.627) -- 0:00:43
      257000 -- (-503.260) (-503.847) (-503.142) [-503.404] * (-506.832) (-504.811) [-503.876] (-504.231) -- 0:00:43
      257500 -- (-503.787) (-504.494) (-507.992) [-504.719] * (-506.992) [-503.400] (-507.482) (-504.230) -- 0:00:43
      258000 -- [-503.123] (-504.475) (-504.129) (-504.208) * (-505.223) (-505.052) (-503.314) [-503.593] -- 0:00:43
      258500 -- (-503.649) (-503.042) (-506.035) [-503.798] * (-503.502) [-503.202] (-502.873) (-504.104) -- 0:00:43
      259000 -- (-506.646) (-504.362) (-503.723) [-505.070] * (-502.801) (-502.238) (-503.400) [-504.308] -- 0:00:42
      259500 -- (-504.543) (-503.169) [-504.078] (-509.269) * (-502.469) [-502.595] (-507.643) (-504.983) -- 0:00:42
      260000 -- [-504.596] (-502.848) (-504.507) (-509.738) * (-503.627) (-502.334) (-506.740) [-504.311] -- 0:00:45

      Average standard deviation of split frequencies: 0.011554

      260500 -- [-503.970] (-504.755) (-505.247) (-506.317) * (-502.683) (-505.228) [-506.576] (-503.562) -- 0:00:45
      261000 -- (-504.902) (-503.300) (-505.117) [-504.425] * (-503.777) (-505.582) (-506.483) [-503.830] -- 0:00:45
      261500 -- (-503.255) (-502.879) (-505.013) [-503.270] * (-503.094) (-507.184) [-504.384] (-505.356) -- 0:00:45
      262000 -- (-506.723) (-507.554) [-504.013] (-503.673) * (-502.844) [-504.403] (-503.759) (-506.187) -- 0:00:45
      262500 -- (-502.989) (-504.090) [-505.341] (-504.058) * (-505.393) (-503.908) [-502.435] (-503.201) -- 0:00:44
      263000 -- (-502.472) (-506.605) [-504.030] (-503.034) * (-508.808) [-504.555] (-505.360) (-502.614) -- 0:00:44
      263500 -- (-503.722) (-504.630) [-503.542] (-505.101) * [-503.340] (-503.555) (-507.390) (-503.040) -- 0:00:44
      264000 -- (-503.300) (-507.741) (-505.169) [-504.040] * [-510.542] (-503.422) (-505.450) (-503.837) -- 0:00:44
      264500 -- [-507.469] (-507.278) (-503.239) (-504.150) * (-507.844) [-502.316] (-504.560) (-503.648) -- 0:00:44
      265000 -- (-503.546) (-503.592) [-502.568] (-505.947) * (-502.688) [-503.035] (-503.720) (-502.385) -- 0:00:44

      Average standard deviation of split frequencies: 0.012110

      265500 -- (-504.951) (-506.367) (-505.272) [-503.860] * [-502.955] (-502.184) (-502.808) (-506.879) -- 0:00:44
      266000 -- (-504.556) (-506.174) (-504.566) [-502.761] * (-505.795) [-504.231] (-502.886) (-512.012) -- 0:00:44
      266500 -- (-505.933) (-504.411) [-508.685] (-506.165) * (-504.658) (-502.871) (-504.739) [-505.253] -- 0:00:44
      267000 -- (-505.166) (-507.014) (-513.196) [-504.113] * [-505.348] (-502.984) (-504.964) (-504.017) -- 0:00:43
      267500 -- (-504.246) (-504.247) [-503.772] (-504.800) * (-504.294) (-503.320) [-504.224] (-502.795) -- 0:00:43
      268000 -- (-502.315) (-503.718) (-502.652) [-503.896] * (-502.388) [-502.338] (-505.562) (-502.784) -- 0:00:43
      268500 -- (-505.074) [-503.963] (-504.415) (-505.671) * (-505.877) [-504.278] (-504.517) (-504.244) -- 0:00:43
      269000 -- (-505.534) (-502.341) (-504.616) [-503.704] * (-504.256) [-505.750] (-505.992) (-505.196) -- 0:00:43
      269500 -- (-502.731) (-508.418) (-505.626) [-504.147] * (-504.638) [-505.300] (-503.394) (-504.381) -- 0:00:43
      270000 -- (-504.218) [-505.951] (-504.194) (-503.230) * [-503.314] (-503.711) (-502.466) (-504.478) -- 0:00:43

      Average standard deviation of split frequencies: 0.011708

      270500 -- (-503.749) [-503.577] (-506.733) (-505.875) * [-505.463] (-502.947) (-502.114) (-510.012) -- 0:00:43
      271000 -- [-504.945] (-510.244) (-502.953) (-505.573) * (-502.871) (-503.680) [-502.529] (-502.415) -- 0:00:43
      271500 -- (-503.743) (-507.722) (-505.281) [-505.744] * (-504.564) [-505.304] (-502.844) (-504.642) -- 0:00:42
      272000 -- (-504.776) (-504.610) [-502.916] (-503.162) * [-506.807] (-502.525) (-502.825) (-504.322) -- 0:00:42
      272500 -- (-506.312) (-506.259) (-502.741) [-503.080] * (-504.410) (-504.857) (-503.308) [-502.486] -- 0:00:42
      273000 -- (-506.209) (-506.754) [-503.708] (-505.913) * [-503.454] (-505.225) (-503.047) (-503.379) -- 0:00:42
      273500 -- (-505.098) (-504.405) (-504.058) [-502.998] * (-502.065) (-507.778) (-507.849) [-503.307] -- 0:00:42
      274000 -- (-503.608) (-503.543) [-502.638] (-503.991) * [-502.354] (-508.058) (-508.522) (-502.637) -- 0:00:42
      274500 -- (-505.009) (-505.022) (-505.567) [-502.188] * [-502.624] (-504.760) (-507.421) (-503.508) -- 0:00:42
      275000 -- (-502.872) [-504.121] (-504.463) (-503.474) * (-504.700) (-504.090) (-503.014) [-503.136] -- 0:00:42

      Average standard deviation of split frequencies: 0.011007

      275500 -- (-504.602) [-505.078] (-502.909) (-505.213) * (-503.348) [-502.616] (-504.066) (-504.434) -- 0:00:42
      276000 -- (-506.288) [-509.586] (-504.569) (-503.286) * [-502.387] (-504.380) (-502.991) (-503.509) -- 0:00:41
      276500 -- [-505.957] (-504.695) (-506.136) (-504.759) * (-503.249) [-502.920] (-504.285) (-503.476) -- 0:00:41
      277000 -- (-505.339) (-502.990) [-503.352] (-505.477) * [-503.720] (-504.897) (-504.117) (-506.874) -- 0:00:44
      277500 -- [-503.327] (-503.508) (-505.981) (-503.704) * (-502.445) [-502.864] (-503.539) (-506.151) -- 0:00:44
      278000 -- (-504.864) [-502.818] (-508.413) (-507.028) * (-503.957) (-502.279) (-503.475) [-504.147] -- 0:00:44
      278500 -- (-506.355) (-502.948) (-503.665) [-505.083] * (-505.732) (-503.212) [-504.736] (-505.516) -- 0:00:44
      279000 -- [-505.367] (-510.541) (-504.607) (-502.443) * (-504.826) (-503.507) [-505.053] (-506.467) -- 0:00:43
      279500 -- (-505.189) [-505.970] (-506.212) (-505.774) * (-504.810) (-506.957) [-502.470] (-504.386) -- 0:00:43
      280000 -- [-505.440] (-503.458) (-506.230) (-502.554) * (-503.197) (-503.125) (-502.829) [-506.441] -- 0:00:43

      Average standard deviation of split frequencies: 0.010264

      280500 -- (-513.136) (-502.296) [-508.842] (-509.370) * (-510.393) [-503.045] (-504.519) (-507.417) -- 0:00:43
      281000 -- (-505.218) (-504.017) (-504.988) [-503.652] * (-510.090) (-502.805) [-503.688] (-503.109) -- 0:00:43
      281500 -- [-503.850] (-504.673) (-505.854) (-505.804) * [-504.391] (-508.871) (-511.989) (-502.974) -- 0:00:43
      282000 -- (-503.735) (-502.328) [-505.009] (-502.643) * [-507.752] (-505.786) (-507.310) (-504.243) -- 0:00:43
      282500 -- (-505.839) [-502.666] (-504.169) (-502.249) * [-504.819] (-503.449) (-507.044) (-503.160) -- 0:00:43
      283000 -- (-502.708) (-502.736) (-501.990) [-504.460] * (-507.520) [-502.750] (-504.688) (-507.616) -- 0:00:43
      283500 -- (-503.404) [-508.148] (-505.731) (-504.312) * (-502.319) [-502.701] (-505.411) (-509.101) -- 0:00:42
      284000 -- [-502.537] (-504.946) (-505.971) (-503.276) * (-503.121) [-504.165] (-504.485) (-503.695) -- 0:00:42
      284500 -- (-503.464) (-508.927) [-502.924] (-503.723) * (-504.956) [-502.929] (-502.503) (-505.115) -- 0:00:42
      285000 -- [-504.265] (-504.329) (-504.534) (-504.239) * (-505.547) (-502.481) [-503.347] (-506.066) -- 0:00:42

      Average standard deviation of split frequencies: 0.009706

      285500 -- (-504.229) (-502.313) [-508.116] (-507.409) * [-503.402] (-504.297) (-504.874) (-502.399) -- 0:00:42
      286000 -- (-507.511) (-503.465) [-507.848] (-503.739) * (-505.248) (-503.781) [-507.078] (-502.218) -- 0:00:42
      286500 -- (-505.533) (-502.923) (-509.122) [-505.052] * (-506.588) (-504.133) [-505.003] (-507.538) -- 0:00:42
      287000 -- [-503.558] (-506.684) (-503.786) (-505.949) * (-502.590) (-504.301) (-505.506) [-507.829] -- 0:00:42
      287500 -- (-503.687) [-504.090] (-507.034) (-505.391) * (-503.048) (-504.879) (-504.776) [-504.859] -- 0:00:42
      288000 -- (-503.429) (-502.604) (-506.690) [-503.694] * (-504.251) (-504.054) (-505.543) [-505.436] -- 0:00:42
      288500 -- [-503.589] (-506.603) (-506.798) (-502.535) * [-503.169] (-504.173) (-508.243) (-505.495) -- 0:00:41
      289000 -- (-503.946) (-503.423) (-508.640) [-504.841] * (-502.363) (-504.692) [-509.751] (-506.931) -- 0:00:41
      289500 -- (-503.762) (-506.366) (-502.874) [-504.841] * (-503.993) (-507.163) (-507.327) [-503.555] -- 0:00:41
      290000 -- (-507.264) (-506.959) [-507.099] (-504.149) * (-503.351) (-506.819) (-505.563) [-503.115] -- 0:00:41

      Average standard deviation of split frequencies: 0.008289

      290500 -- (-506.942) [-502.980] (-508.198) (-505.777) * (-502.940) [-504.098] (-505.115) (-504.872) -- 0:00:41
      291000 -- (-504.161) (-505.712) (-507.037) [-507.128] * (-504.030) (-503.780) (-505.234) [-502.769] -- 0:00:41
      291500 -- (-506.802) [-502.756] (-504.097) (-504.837) * (-504.475) (-506.113) (-502.543) [-503.303] -- 0:00:41
      292000 -- (-506.093) [-504.055] (-511.899) (-503.972) * [-502.577] (-503.148) (-504.782) (-505.928) -- 0:00:41
      292500 -- [-505.961] (-505.932) (-504.409) (-504.102) * (-508.848) (-506.682) [-504.481] (-507.531) -- 0:00:41
      293000 -- (-504.041) (-505.775) (-505.770) [-505.416] * (-505.233) [-504.059] (-506.776) (-502.681) -- 0:00:41
      293500 -- (-503.492) [-504.522] (-505.484) (-509.043) * (-503.799) (-504.847) [-508.892] (-504.268) -- 0:00:43
      294000 -- (-502.689) [-503.799] (-507.055) (-505.048) * [-502.482] (-506.565) (-502.726) (-503.562) -- 0:00:43
      294500 -- [-503.994] (-504.257) (-503.076) (-502.437) * (-504.490) [-504.798] (-506.854) (-504.134) -- 0:00:43
      295000 -- (-504.148) (-504.967) (-502.651) [-508.005] * (-505.535) (-504.545) [-503.749] (-508.759) -- 0:00:43

      Average standard deviation of split frequencies: 0.009237

      295500 -- (-503.145) [-507.089] (-502.778) (-504.279) * (-507.280) [-503.136] (-505.313) (-505.568) -- 0:00:42
      296000 -- (-503.266) (-505.900) [-503.726] (-503.101) * (-505.615) (-508.739) (-504.269) [-503.237] -- 0:00:42
      296500 -- [-502.955] (-503.721) (-505.986) (-503.473) * (-505.225) (-504.119) [-505.128] (-503.562) -- 0:00:42
      297000 -- [-504.301] (-503.895) (-506.682) (-507.360) * [-507.309] (-504.564) (-502.408) (-506.926) -- 0:00:42
      297500 -- (-506.382) [-502.927] (-508.107) (-505.293) * (-502.937) [-504.030] (-502.577) (-504.382) -- 0:00:42
      298000 -- (-503.892) (-506.874) (-503.900) [-503.402] * [-504.014] (-505.127) (-508.608) (-503.251) -- 0:00:42
      298500 -- [-502.100] (-508.162) (-503.265) (-506.666) * [-503.802] (-504.403) (-507.292) (-504.329) -- 0:00:42
      299000 -- (-503.694) (-508.963) (-503.816) [-503.577] * (-503.874) [-505.462] (-502.570) (-503.042) -- 0:00:42
      299500 -- (-502.107) (-504.787) [-502.232] (-504.295) * (-508.626) (-505.458) [-504.841] (-505.481) -- 0:00:42
      300000 -- (-502.338) (-503.949) [-503.491] (-505.455) * (-503.427) [-505.901] (-504.860) (-503.592) -- 0:00:42

      Average standard deviation of split frequencies: 0.007230

      300500 -- [-502.338] (-503.944) (-505.189) (-502.523) * [-504.014] (-502.193) (-503.883) (-507.048) -- 0:00:41
      301000 -- [-502.631] (-504.519) (-505.878) (-502.506) * [-502.611] (-505.235) (-505.980) (-503.823) -- 0:00:41
      301500 -- (-502.689) (-505.032) (-503.316) [-505.685] * (-504.663) (-503.838) [-504.643] (-503.694) -- 0:00:41
      302000 -- [-504.677] (-504.962) (-510.731) (-504.240) * (-507.370) [-505.158] (-509.099) (-503.354) -- 0:00:41
      302500 -- (-505.241) (-507.271) [-504.536] (-504.980) * (-503.340) (-509.533) [-504.104] (-506.560) -- 0:00:41
      303000 -- (-504.687) [-511.265] (-505.354) (-503.040) * (-506.992) (-503.327) [-502.214] (-503.511) -- 0:00:41
      303500 -- (-503.255) (-504.357) (-506.248) [-503.789] * (-507.680) [-502.852] (-504.482) (-510.029) -- 0:00:41
      304000 -- (-504.677) (-502.980) [-503.724] (-503.826) * [-504.221] (-505.892) (-502.908) (-503.634) -- 0:00:41
      304500 -- (-506.723) (-503.663) [-504.733] (-502.406) * (-503.737) (-504.224) (-504.250) [-504.379] -- 0:00:41
      305000 -- (-508.451) (-502.475) (-506.550) [-503.181] * [-503.604] (-506.039) (-506.984) (-503.269) -- 0:00:41

      Average standard deviation of split frequencies: 0.007018

      305500 -- (-506.078) [-505.679] (-505.393) (-502.849) * (-504.162) (-507.672) (-504.800) [-504.706] -- 0:00:40
      306000 -- (-509.383) [-505.565] (-508.873) (-503.592) * (-504.851) (-503.110) (-503.752) [-502.936] -- 0:00:40
      306500 -- [-504.899] (-507.118) (-503.460) (-504.591) * (-503.988) [-503.763] (-503.678) (-504.834) -- 0:00:40
      307000 -- (-506.101) (-503.916) [-502.747] (-503.329) * (-503.066) (-509.382) [-503.843] (-505.270) -- 0:00:40
      307500 -- (-504.594) (-503.252) [-502.463] (-503.556) * [-504.037] (-505.179) (-507.845) (-508.117) -- 0:00:40
      308000 -- (-508.590) (-503.928) (-503.679) [-505.687] * (-504.803) (-502.314) [-505.716] (-508.456) -- 0:00:40
      308500 -- (-507.476) (-506.360) [-504.162] (-503.777) * [-503.253] (-503.743) (-505.607) (-504.692) -- 0:00:40
      309000 -- (-505.411) (-505.494) (-505.219) [-505.731] * [-502.750] (-508.380) (-502.256) (-503.203) -- 0:00:40
      309500 -- [-503.917] (-504.188) (-506.592) (-502.393) * (-503.930) (-502.800) [-502.607] (-504.517) -- 0:00:40
      310000 -- (-505.923) [-503.264] (-512.603) (-510.916) * [-508.187] (-504.993) (-503.912) (-506.807) -- 0:00:40

      Average standard deviation of split frequencies: 0.006605

      310500 -- (-503.789) (-507.145) [-509.340] (-503.781) * (-504.796) (-508.617) (-503.795) [-503.919] -- 0:00:42
      311000 -- (-504.263) (-506.837) (-503.094) [-504.974] * (-503.076) (-508.872) [-507.967] (-503.236) -- 0:00:42
      311500 -- (-502.840) (-506.416) [-503.094] (-503.163) * (-504.814) [-507.220] (-503.044) (-505.916) -- 0:00:41
      312000 -- (-504.864) (-502.767) (-505.222) [-503.646] * (-504.839) (-503.886) (-502.495) [-504.669] -- 0:00:41
      312500 -- [-503.051] (-502.607) (-504.949) (-504.049) * (-506.218) [-504.070] (-502.316) (-507.625) -- 0:00:41
      313000 -- (-510.184) [-504.087] (-503.358) (-505.576) * (-504.086) (-503.604) [-506.793] (-503.565) -- 0:00:41
      313500 -- [-504.576] (-504.706) (-504.806) (-502.808) * [-504.761] (-503.567) (-504.788) (-502.931) -- 0:00:41
      314000 -- (-506.958) (-502.746) (-504.257) [-502.498] * [-504.403] (-502.448) (-503.558) (-508.832) -- 0:00:41
      314500 -- (-502.403) [-503.267] (-503.211) (-502.045) * (-502.719) [-503.310] (-503.926) (-503.339) -- 0:00:41
      315000 -- (-502.394) (-505.012) (-503.775) [-503.862] * (-503.587) (-502.928) (-505.792) [-506.175] -- 0:00:41

      Average standard deviation of split frequencies: 0.007293

      315500 -- (-503.386) (-506.750) [-504.588] (-503.815) * [-506.541] (-503.159) (-502.200) (-503.062) -- 0:00:41
      316000 -- (-502.363) (-503.666) [-505.192] (-503.131) * [-505.083] (-505.061) (-504.596) (-504.329) -- 0:00:41
      316500 -- (-504.834) (-504.028) [-505.094] (-503.263) * (-502.756) [-502.185] (-502.981) (-503.281) -- 0:00:41
      317000 -- (-506.827) (-507.802) [-505.201] (-503.460) * (-503.064) [-505.196] (-503.753) (-502.491) -- 0:00:40
      317500 -- (-502.465) (-503.414) [-509.667] (-504.368) * [-502.362] (-510.721) (-505.642) (-505.418) -- 0:00:40
      318000 -- (-503.670) (-504.531) [-509.040] (-506.512) * (-502.865) [-504.717] (-503.218) (-504.404) -- 0:00:40
      318500 -- (-505.707) (-505.202) [-505.536] (-505.423) * (-507.448) [-502.577] (-505.236) (-502.632) -- 0:00:40
      319000 -- (-503.497) (-510.061) (-510.523) [-505.298] * (-504.440) [-502.666] (-507.230) (-506.871) -- 0:00:40
      319500 -- (-506.601) [-505.990] (-505.997) (-510.178) * (-504.058) [-503.199] (-510.111) (-504.653) -- 0:00:40
      320000 -- (-502.238) (-505.117) [-503.038] (-503.378) * [-504.275] (-506.680) (-505.053) (-505.282) -- 0:00:40

      Average standard deviation of split frequencies: 0.006659

      320500 -- (-506.270) [-503.443] (-505.472) (-502.494) * (-503.151) (-503.512) [-505.373] (-504.968) -- 0:00:40
      321000 -- (-503.653) (-510.776) (-503.834) [-503.936] * (-503.447) [-502.644] (-502.631) (-504.869) -- 0:00:40
      321500 -- (-504.049) (-509.769) [-503.711] (-505.907) * (-502.287) (-502.695) [-503.043] (-503.068) -- 0:00:40
      322000 -- (-502.692) [-504.087] (-505.981) (-502.344) * (-502.771) [-503.380] (-503.118) (-505.377) -- 0:00:40
      322500 -- (-504.611) [-504.263] (-505.383) (-503.078) * (-502.589) [-504.107] (-503.006) (-504.087) -- 0:00:39
      323000 -- (-503.334) (-503.964) (-505.637) [-504.932] * [-502.714] (-506.086) (-505.834) (-503.742) -- 0:00:39
      323500 -- (-502.795) [-505.577] (-503.946) (-502.482) * (-503.566) (-505.039) [-505.378] (-504.296) -- 0:00:39
      324000 -- (-509.923) (-504.426) [-504.359] (-503.244) * (-505.942) (-504.386) (-504.212) [-505.077] -- 0:00:39
      324500 -- [-506.330] (-504.094) (-506.278) (-503.822) * (-504.196) [-504.262] (-506.018) (-505.140) -- 0:00:39
      325000 -- (-503.480) (-503.621) (-503.826) [-502.320] * (-504.484) (-507.735) [-504.433] (-503.722) -- 0:00:39

      Average standard deviation of split frequencies: 0.006668

      325500 -- [-503.673] (-504.785) (-504.443) (-505.153) * (-502.908) (-506.295) [-502.460] (-504.361) -- 0:00:39
      326000 -- (-502.536) [-502.809] (-504.647) (-506.217) * (-502.515) (-507.713) [-502.906] (-504.492) -- 0:00:39
      326500 -- (-506.847) (-503.154) (-505.175) [-503.167] * (-506.795) (-504.290) [-506.631] (-504.952) -- 0:00:39
      327000 -- (-505.042) [-502.471] (-505.891) (-505.184) * (-505.849) [-504.207] (-505.972) (-504.753) -- 0:00:41
      327500 -- (-504.918) (-505.297) [-509.641] (-504.109) * (-504.190) (-503.072) (-507.100) [-503.508] -- 0:00:41
      328000 -- (-505.335) (-505.711) (-508.607) [-504.089] * (-501.970) [-505.492] (-503.594) (-505.671) -- 0:00:40
      328500 -- (-508.020) (-503.263) (-502.271) [-503.830] * [-502.171] (-502.531) (-508.350) (-509.622) -- 0:00:40
      329000 -- [-503.458] (-502.696) (-503.107) (-505.532) * [-505.587] (-503.576) (-509.766) (-505.074) -- 0:00:40
      329500 -- (-504.761) [-504.641] (-505.794) (-502.400) * (-502.632) [-508.680] (-510.502) (-504.529) -- 0:00:40
      330000 -- (-506.380) [-503.640] (-505.039) (-503.416) * (-503.456) (-506.919) [-505.866] (-503.962) -- 0:00:40

      Average standard deviation of split frequencies: 0.007049

      330500 -- [-502.143] (-505.894) (-505.945) (-502.872) * (-503.107) (-503.883) (-503.867) [-504.339] -- 0:00:40
      331000 -- (-501.951) [-504.018] (-506.164) (-505.866) * (-506.905) [-503.884] (-502.879) (-503.299) -- 0:00:40
      331500 -- (-504.313) [-504.990] (-504.145) (-505.148) * [-504.213] (-506.731) (-502.364) (-503.774) -- 0:00:40
      332000 -- (-504.469) (-504.193) [-505.134] (-503.995) * (-503.950) (-505.236) [-503.473] (-504.250) -- 0:00:40
      332500 -- (-502.395) (-503.823) (-507.086) [-502.726] * [-502.811] (-506.198) (-503.715) (-502.191) -- 0:00:40
      333000 -- (-502.540) (-503.398) [-502.608] (-503.784) * (-502.371) (-506.494) [-503.279] (-504.569) -- 0:00:40
      333500 -- (-503.381) (-503.112) [-503.254] (-502.608) * [-502.274] (-509.246) (-505.423) (-505.563) -- 0:00:39
      334000 -- (-505.672) (-507.871) (-504.323) [-504.081] * [-502.152] (-502.147) (-503.561) (-504.721) -- 0:00:39
      334500 -- (-508.417) (-504.779) (-503.373) [-503.248] * (-504.877) (-502.750) [-503.307] (-505.291) -- 0:00:39
      335000 -- [-505.484] (-503.632) (-506.780) (-505.496) * (-503.098) [-503.671] (-512.835) (-507.994) -- 0:00:39

      Average standard deviation of split frequencies: 0.006313

      335500 -- (-504.240) (-503.284) (-504.896) [-513.911] * [-504.013] (-506.592) (-506.668) (-503.215) -- 0:00:39
      336000 -- (-503.614) [-504.630] (-505.529) (-506.397) * (-506.342) (-503.436) (-502.891) [-505.165] -- 0:00:39
      336500 -- (-503.145) (-504.955) (-502.751) [-502.593] * (-503.851) (-503.998) [-503.525] (-505.383) -- 0:00:39
      337000 -- (-502.491) [-503.138] (-504.759) (-506.382) * [-504.897] (-503.894) (-502.942) (-505.830) -- 0:00:39
      337500 -- (-506.211) [-504.251] (-506.327) (-503.917) * (-503.937) [-504.005] (-505.020) (-504.859) -- 0:00:39
      338000 -- (-502.693) (-505.598) (-506.770) [-502.536] * (-505.050) [-505.053] (-502.931) (-503.538) -- 0:00:39
      338500 -- [-504.879] (-503.974) (-507.009) (-502.516) * (-504.568) (-504.644) (-505.550) [-506.499] -- 0:00:39
      339000 -- (-505.400) (-505.420) [-502.978] (-502.442) * (-508.139) (-503.378) [-502.473] (-503.715) -- 0:00:38
      339500 -- (-506.430) (-505.872) (-502.273) [-505.089] * (-506.841) (-504.047) (-506.713) [-503.292] -- 0:00:38
      340000 -- (-504.166) [-502.524] (-510.096) (-503.766) * (-508.387) [-502.383] (-504.331) (-505.023) -- 0:00:38

      Average standard deviation of split frequencies: 0.005861

      340500 -- [-502.077] (-507.042) (-509.105) (-504.329) * (-503.560) (-505.679) [-504.565] (-507.312) -- 0:00:38
      341000 -- (-503.214) (-503.918) [-503.566] (-502.732) * (-508.490) (-503.463) (-507.447) [-503.717] -- 0:00:38
      341500 -- (-505.709) (-505.666) (-502.445) [-504.986] * (-506.307) (-503.425) [-503.408] (-503.261) -- 0:00:38
      342000 -- (-502.363) (-502.218) [-503.885] (-508.076) * [-504.000] (-502.570) (-502.496) (-502.842) -- 0:00:38
      342500 -- [-504.485] (-504.160) (-503.410) (-506.038) * (-503.759) (-503.682) [-503.508] (-502.977) -- 0:00:38
      343000 -- (-502.738) (-505.691) [-502.447] (-503.987) * (-505.575) (-505.386) [-504.926] (-502.706) -- 0:00:40
      343500 -- (-504.902) (-504.415) [-504.748] (-504.064) * (-502.430) (-507.288) [-504.992] (-511.555) -- 0:00:40
      344000 -- (-505.532) [-503.826] (-507.000) (-502.847) * [-503.501] (-504.340) (-502.478) (-503.543) -- 0:00:40
      344500 -- (-510.919) (-504.131) (-505.858) [-506.319] * (-504.688) [-503.738] (-504.016) (-502.956) -- 0:00:39
      345000 -- (-505.186) [-507.988] (-502.526) (-504.500) * [-502.591] (-506.320) (-503.619) (-503.169) -- 0:00:39

      Average standard deviation of split frequencies: 0.006492

      345500 -- (-502.871) [-507.536] (-503.698) (-503.576) * (-503.591) (-503.141) (-505.480) [-504.001] -- 0:00:39
      346000 -- (-502.971) (-510.463) (-503.810) [-502.915] * (-505.441) [-502.571] (-502.579) (-504.294) -- 0:00:39
      346500 -- [-503.205] (-503.184) (-503.410) (-503.532) * (-503.479) (-503.354) (-502.175) [-507.684] -- 0:00:39
      347000 -- (-503.778) (-503.602) [-504.843] (-506.427) * [-503.708] (-502.691) (-503.990) (-504.368) -- 0:00:39
      347500 -- (-505.510) [-503.321] (-507.454) (-503.664) * (-503.207) (-506.708) [-502.168] (-503.482) -- 0:00:39
      348000 -- (-504.223) (-502.630) [-503.554] (-504.597) * (-504.192) [-506.020] (-503.234) (-503.780) -- 0:00:39
      348500 -- (-505.473) (-503.618) (-503.230) [-503.488] * (-503.291) (-504.820) [-503.897] (-503.147) -- 0:00:39
      349000 -- (-504.290) [-503.475] (-503.257) (-508.065) * (-509.306) (-505.178) (-504.024) [-503.657] -- 0:00:39
      349500 -- (-505.471) (-503.355) [-502.748] (-504.496) * (-505.028) (-503.555) [-504.345] (-502.321) -- 0:00:39
      350000 -- [-504.851] (-504.068) (-503.779) (-503.980) * (-503.768) (-503.412) [-508.549] (-504.668) -- 0:00:39

      Average standard deviation of split frequencies: 0.008278

      350500 -- (-504.996) (-503.532) (-504.923) [-503.161] * (-504.128) [-504.020] (-504.605) (-503.283) -- 0:00:38
      351000 -- [-502.708] (-504.140) (-503.947) (-502.430) * (-506.139) (-504.837) [-505.772] (-507.527) -- 0:00:38
      351500 -- (-504.505) [-507.118] (-502.504) (-504.989) * (-503.265) [-504.470] (-506.990) (-503.484) -- 0:00:38
      352000 -- (-506.051) [-504.691] (-506.903) (-503.198) * (-504.410) [-503.980] (-504.952) (-502.639) -- 0:00:38
      352500 -- (-506.378) [-502.672] (-504.854) (-503.287) * [-507.084] (-502.349) (-503.893) (-503.746) -- 0:00:38
      353000 -- (-505.123) [-502.982] (-504.329) (-503.277) * [-503.333] (-502.014) (-503.850) (-504.812) -- 0:00:38
      353500 -- [-502.568] (-502.831) (-509.274) (-502.224) * [-508.740] (-503.839) (-506.205) (-504.512) -- 0:00:38
      354000 -- (-506.520) [-504.036] (-505.203) (-504.691) * [-506.650] (-503.264) (-504.275) (-503.512) -- 0:00:38
      354500 -- [-502.797] (-508.226) (-506.864) (-507.817) * (-502.776) (-503.773) [-504.780] (-503.184) -- 0:00:38
      355000 -- (-502.982) [-505.100] (-506.638) (-506.731) * (-503.927) (-506.961) (-504.736) [-504.322] -- 0:00:38

      Average standard deviation of split frequencies: 0.008534

      355500 -- (-503.096) [-502.913] (-504.560) (-506.454) * (-506.004) (-505.544) (-508.397) [-503.136] -- 0:00:38
      356000 -- [-503.112] (-502.744) (-503.219) (-503.438) * [-506.122] (-505.118) (-503.588) (-505.047) -- 0:00:37
      356500 -- (-504.592) (-503.002) [-504.470] (-505.684) * (-508.672) [-502.827] (-510.496) (-506.840) -- 0:00:37
      357000 -- (-503.580) [-501.936] (-504.340) (-506.366) * (-506.239) (-502.258) (-504.378) [-506.913] -- 0:00:37
      357500 -- [-509.611] (-502.256) (-507.164) (-504.962) * (-506.678) (-502.719) [-503.956] (-505.861) -- 0:00:37
      358000 -- (-507.277) (-503.327) (-508.056) [-505.908] * (-506.451) (-504.001) [-503.493] (-505.106) -- 0:00:39
      358500 -- (-504.073) (-503.894) (-502.350) [-505.581] * (-505.727) (-506.407) [-503.017] (-505.541) -- 0:00:39
      359000 -- (-506.411) (-505.301) [-505.681] (-502.549) * (-504.523) (-504.498) [-503.132] (-504.159) -- 0:00:39
      359500 -- (-507.323) (-504.490) [-503.858] (-502.585) * (-502.353) (-505.286) [-504.321] (-503.832) -- 0:00:39
      360000 -- (-505.145) (-504.304) (-506.737) [-504.586] * (-507.947) (-503.872) [-508.319] (-506.495) -- 0:00:39

      Average standard deviation of split frequencies: 0.007842

      360500 -- [-502.734] (-503.340) (-505.964) (-511.332) * (-505.124) (-507.305) [-502.796] (-503.692) -- 0:00:39
      361000 -- (-502.988) (-503.999) [-502.352] (-502.942) * (-504.678) (-503.574) (-503.292) [-504.960] -- 0:00:38
      361500 -- (-503.185) (-504.598) (-504.565) [-503.391] * [-508.142] (-506.019) (-503.123) (-505.660) -- 0:00:38
      362000 -- (-504.308) [-504.047] (-503.794) (-507.444) * [-502.640] (-506.781) (-504.390) (-505.995) -- 0:00:38
      362500 -- (-504.479) (-503.518) [-502.755] (-504.499) * [-509.636] (-503.156) (-503.725) (-506.335) -- 0:00:38
      363000 -- (-507.084) (-503.647) (-503.943) [-503.041] * (-503.671) [-502.779] (-504.262) (-503.206) -- 0:00:38
      363500 -- [-505.645] (-509.551) (-504.879) (-503.692) * (-503.711) (-502.971) (-502.849) [-503.693] -- 0:00:38
      364000 -- [-502.996] (-504.330) (-506.136) (-504.656) * (-505.019) [-505.427] (-503.304) (-502.944) -- 0:00:38
      364500 -- (-503.412) [-503.761] (-505.129) (-504.164) * (-504.526) (-507.819) (-505.557) [-504.022] -- 0:00:38
      365000 -- (-503.903) [-502.970] (-505.916) (-507.534) * (-505.045) (-502.989) (-510.811) [-503.760] -- 0:00:38

      Average standard deviation of split frequencies: 0.008229

      365500 -- [-504.269] (-508.355) (-507.903) (-503.613) * [-505.369] (-503.067) (-504.372) (-506.274) -- 0:00:38
      366000 -- (-503.994) [-503.475] (-503.609) (-505.171) * (-504.496) (-505.198) (-503.899) [-504.341] -- 0:00:38
      366500 -- (-503.849) [-504.596] (-506.251) (-503.765) * (-503.992) (-502.530) (-508.473) [-505.411] -- 0:00:38
      367000 -- (-503.225) (-505.799) (-505.283) [-506.043] * [-505.505] (-504.024) (-502.832) (-503.309) -- 0:00:37
      367500 -- (-504.896) (-504.783) [-505.444] (-504.050) * (-504.641) (-502.950) [-502.370] (-506.393) -- 0:00:37
      368000 -- [-507.328] (-504.195) (-504.971) (-503.106) * (-503.251) [-503.261] (-504.643) (-505.545) -- 0:00:37
      368500 -- (-502.089) (-505.214) [-504.424] (-504.446) * (-504.461) [-504.056] (-508.650) (-503.615) -- 0:00:37
      369000 -- (-503.963) (-505.282) [-503.110] (-504.868) * (-503.791) [-504.249] (-506.012) (-503.122) -- 0:00:37
      369500 -- (-507.111) (-504.672) (-504.435) [-505.378] * (-507.629) (-502.722) [-503.547] (-508.654) -- 0:00:37
      370000 -- [-503.083] (-503.018) (-505.333) (-507.491) * (-509.613) (-503.613) (-503.386) [-504.800] -- 0:00:37

      Average standard deviation of split frequencies: 0.007556

      370500 -- (-505.727) (-502.966) (-503.631) [-505.126] * (-504.710) (-502.104) [-502.339] (-506.573) -- 0:00:37
      371000 -- (-502.695) (-506.734) (-505.363) [-503.649] * (-505.064) (-503.337) [-503.027] (-503.896) -- 0:00:37
      371500 -- (-503.306) (-504.183) [-505.179] (-503.586) * (-510.937) (-503.453) [-502.832] (-503.867) -- 0:00:37
      372000 -- (-503.968) [-505.946] (-503.940) (-502.505) * (-507.520) [-505.352] (-504.680) (-503.886) -- 0:00:38
      372500 -- (-504.217) (-505.591) (-504.047) [-502.155] * (-502.869) [-504.719] (-503.346) (-503.931) -- 0:00:38
      373000 -- (-504.571) (-509.452) (-507.257) [-504.005] * (-509.039) [-502.855] (-502.494) (-502.502) -- 0:00:38
      373500 -- [-502.784] (-504.504) (-503.201) (-511.244) * (-505.218) (-506.564) [-502.561] (-504.034) -- 0:00:38
      374000 -- (-503.966) (-509.033) (-503.318) [-506.141] * [-506.487] (-506.392) (-502.351) (-506.154) -- 0:00:38
      374500 -- (-503.206) (-504.885) [-503.690] (-505.599) * [-502.400] (-503.864) (-502.178) (-502.682) -- 0:00:38
      375000 -- (-502.501) [-505.116] (-507.432) (-505.335) * [-502.949] (-505.672) (-505.213) (-503.463) -- 0:00:38

      Average standard deviation of split frequencies: 0.008407

      375500 -- [-503.000] (-503.024) (-506.077) (-507.642) * [-503.063] (-503.055) (-502.934) (-502.619) -- 0:00:38
      376000 -- (-503.480) [-506.447] (-502.523) (-507.095) * [-505.464] (-507.407) (-503.912) (-503.879) -- 0:00:38
      376500 -- (-504.949) (-507.616) (-506.452) [-502.962] * (-506.359) (-503.622) (-506.487) [-503.587] -- 0:00:38
      377000 -- (-504.747) (-503.424) (-505.045) [-502.303] * (-503.623) [-503.610] (-505.955) (-503.564) -- 0:00:38
      377500 -- [-503.101] (-502.771) (-504.186) (-502.499) * (-505.552) (-503.619) [-508.161] (-506.675) -- 0:00:37
      378000 -- [-502.726] (-508.054) (-504.047) (-503.180) * (-505.412) (-504.432) (-505.471) [-503.134] -- 0:00:37
      378500 -- [-506.346] (-505.810) (-504.359) (-503.171) * (-505.260) (-502.736) (-506.838) [-503.628] -- 0:00:37
      379000 -- (-502.056) (-504.165) (-502.667) [-506.726] * [-502.704] (-504.305) (-506.306) (-505.668) -- 0:00:37
      379500 -- (-504.319) [-507.234] (-502.715) (-503.893) * (-504.388) (-506.143) [-502.565] (-504.655) -- 0:00:37
      380000 -- (-503.553) (-503.629) [-502.129] (-506.812) * (-506.557) [-504.324] (-504.222) (-504.434) -- 0:00:37

      Average standard deviation of split frequencies: 0.008669

      380500 -- [-505.108] (-505.272) (-503.705) (-505.041) * [-505.013] (-503.092) (-504.633) (-504.757) -- 0:00:37
      381000 -- (-505.942) (-503.060) [-503.940] (-508.798) * (-507.003) [-503.001] (-503.432) (-505.402) -- 0:00:37
      381500 -- (-503.636) (-504.594) [-503.822] (-506.743) * (-503.388) (-503.971) (-507.234) [-506.965] -- 0:00:37
      382000 -- [-503.277] (-505.310) (-505.925) (-503.283) * (-504.272) (-503.995) (-503.798) [-503.646] -- 0:00:37
      382500 -- [-505.458] (-503.320) (-505.446) (-503.836) * (-504.101) (-504.058) (-503.921) [-503.408] -- 0:00:37
      383000 -- (-505.702) (-504.505) [-502.448] (-502.159) * [-503.977] (-503.657) (-502.230) (-503.267) -- 0:00:37
      383500 -- [-502.315] (-503.307) (-505.599) (-503.449) * (-504.021) (-503.607) [-503.366] (-503.847) -- 0:00:36
      384000 -- (-502.494) [-503.087] (-505.168) (-507.505) * (-504.866) (-508.946) (-502.918) [-502.858] -- 0:00:36
      384500 -- (-504.738) (-504.960) (-504.181) [-506.178] * (-503.031) (-511.623) [-503.292] (-505.678) -- 0:00:36
      385000 -- (-506.892) (-503.947) (-504.464) [-503.149] * (-503.898) (-503.797) (-502.967) [-503.213] -- 0:00:36

      Average standard deviation of split frequencies: 0.008684

      385500 -- (-505.155) (-513.827) (-503.521) [-503.223] * [-504.268] (-503.325) (-503.267) (-510.016) -- 0:00:36
      386000 -- (-504.621) (-503.594) [-506.658] (-505.364) * [-504.003] (-503.758) (-504.559) (-507.687) -- 0:00:36
      386500 -- (-505.324) [-505.223] (-504.337) (-504.735) * (-505.208) (-505.246) [-504.001] (-504.140) -- 0:00:36
      387000 -- (-502.708) (-504.180) [-505.075] (-506.180) * (-504.813) (-508.818) [-504.176] (-503.788) -- 0:00:38
      387500 -- (-502.876) (-503.276) (-505.302) [-505.878] * (-504.916) (-508.927) [-506.303] (-506.200) -- 0:00:37
      388000 -- (-502.920) (-504.386) [-506.512] (-502.988) * (-506.617) (-503.647) (-505.549) [-502.557] -- 0:00:37
      388500 -- (-507.300) [-506.556] (-503.907) (-504.681) * (-505.132) (-505.341) [-504.721] (-503.753) -- 0:00:37
      389000 -- (-504.835) (-506.122) (-503.137) [-503.315] * (-504.150) [-504.873] (-503.702) (-506.656) -- 0:00:37
      389500 -- (-502.144) (-502.669) [-503.616] (-504.925) * (-503.259) (-503.230) [-504.663] (-503.943) -- 0:00:37
      390000 -- (-503.945) (-508.545) (-504.606) [-503.155] * (-504.346) (-502.475) [-503.728] (-503.375) -- 0:00:37

      Average standard deviation of split frequencies: 0.007910

      390500 -- (-504.493) (-502.921) [-507.054] (-506.703) * [-505.135] (-503.527) (-503.208) (-504.410) -- 0:00:37
      391000 -- (-504.931) (-506.210) [-505.029] (-505.569) * [-505.388] (-504.307) (-503.245) (-503.293) -- 0:00:37
      391500 -- [-503.750] (-506.356) (-502.961) (-505.294) * [-511.025] (-504.033) (-502.089) (-502.750) -- 0:00:37
      392000 -- (-504.844) (-503.083) (-503.426) [-502.480] * (-503.340) (-506.773) [-502.812] (-503.687) -- 0:00:37
      392500 -- [-505.848] (-503.362) (-504.922) (-505.394) * [-504.783] (-505.102) (-502.042) (-503.979) -- 0:00:37
      393000 -- [-505.937] (-509.762) (-503.697) (-509.558) * [-503.825] (-505.372) (-503.476) (-502.575) -- 0:00:37
      393500 -- (-504.283) [-504.057] (-504.131) (-505.825) * (-503.658) (-503.829) (-502.607) [-502.585] -- 0:00:36
      394000 -- (-511.180) (-504.868) (-503.155) [-506.979] * (-503.843) (-503.401) (-504.987) [-503.049] -- 0:00:36
      394500 -- (-506.370) (-506.137) (-508.383) [-503.335] * (-505.767) (-503.753) [-504.956] (-503.738) -- 0:00:36
      395000 -- (-505.108) [-503.284] (-502.297) (-505.095) * (-502.475) [-503.926] (-503.145) (-503.048) -- 0:00:36

      Average standard deviation of split frequencies: 0.007804

      395500 -- (-504.417) (-503.134) [-502.677] (-504.997) * (-502.441) (-506.958) (-504.421) [-505.896] -- 0:00:36
      396000 -- (-504.974) (-505.842) (-502.246) [-503.663] * (-505.966) (-505.911) (-504.391) [-502.738] -- 0:00:36
      396500 -- (-505.684) (-506.093) [-502.246] (-502.400) * (-509.532) [-502.880] (-504.407) (-502.445) -- 0:00:36
      397000 -- [-507.216] (-509.060) (-503.553) (-506.250) * (-503.749) [-503.723] (-504.008) (-505.624) -- 0:00:36
      397500 -- (-502.540) (-504.471) [-504.307] (-504.164) * [-505.733] (-502.181) (-502.914) (-503.433) -- 0:00:36
      398000 -- [-507.245] (-504.193) (-503.098) (-502.481) * (-509.470) [-505.187] (-502.258) (-507.983) -- 0:00:36
      398500 -- (-511.629) [-504.060] (-502.158) (-507.371) * (-504.043) (-502.572) [-504.541] (-505.493) -- 0:00:36
      399000 -- [-504.666] (-505.256) (-505.902) (-506.120) * (-502.901) (-505.644) [-506.577] (-503.119) -- 0:00:36
      399500 -- (-505.786) (-503.244) [-505.850] (-502.674) * [-502.616] (-505.199) (-503.532) (-507.165) -- 0:00:36
      400000 -- (-502.282) (-505.485) [-507.069] (-504.045) * (-502.984) (-503.522) [-503.948] (-507.817) -- 0:00:36

      Average standard deviation of split frequencies: 0.007974

      400500 -- [-506.495] (-507.028) (-504.893) (-507.808) * (-502.586) (-504.221) [-503.578] (-507.584) -- 0:00:35
      401000 -- (-505.402) (-506.757) [-503.258] (-503.408) * [-503.874] (-502.623) (-505.740) (-503.919) -- 0:00:35
      401500 -- (-502.725) (-502.956) (-504.188) [-503.518] * (-504.688) [-502.621] (-506.720) (-504.700) -- 0:00:37
      402000 -- [-504.610] (-507.851) (-511.559) (-503.297) * [-503.083] (-506.264) (-505.811) (-503.365) -- 0:00:37
      402500 -- (-504.297) (-507.630) [-503.501] (-504.438) * (-502.709) (-517.344) [-506.045] (-502.936) -- 0:00:37
      403000 -- [-503.297] (-507.832) (-505.429) (-502.671) * (-507.138) (-513.565) [-502.615] (-502.770) -- 0:00:37
      403500 -- (-508.537) (-504.850) [-502.226] (-502.354) * (-514.526) (-507.114) (-506.022) [-503.308] -- 0:00:36
      404000 -- (-505.024) (-505.651) [-503.873] (-504.996) * [-505.397] (-509.671) (-503.642) (-504.067) -- 0:00:36
      404500 -- [-502.621] (-503.258) (-503.826) (-503.036) * (-504.027) (-506.358) (-503.322) [-504.406] -- 0:00:36
      405000 -- (-502.367) [-504.280] (-507.274) (-503.526) * (-511.121) (-508.547) (-508.804) [-502.792] -- 0:00:36

      Average standard deviation of split frequencies: 0.008861

      405500 -- (-503.416) [-503.781] (-510.591) (-505.598) * [-502.513] (-510.122) (-506.347) (-507.204) -- 0:00:36
      406000 -- (-502.036) (-504.110) [-509.039] (-506.384) * (-506.355) [-504.404] (-504.405) (-506.828) -- 0:00:36
      406500 -- [-504.038] (-503.134) (-503.876) (-508.722) * [-503.276] (-503.906) (-506.806) (-505.364) -- 0:00:36
      407000 -- (-504.936) (-505.541) [-503.767] (-504.041) * (-503.883) (-504.557) [-505.365] (-504.283) -- 0:00:36
      407500 -- [-502.898] (-502.722) (-505.011) (-502.090) * (-505.306) [-502.924] (-507.186) (-505.613) -- 0:00:36
      408000 -- (-503.016) (-503.427) (-502.338) [-503.172] * [-502.632] (-504.039) (-502.457) (-503.723) -- 0:00:36
      408500 -- (-508.928) (-503.883) [-505.057] (-503.960) * [-502.374] (-504.662) (-504.180) (-504.577) -- 0:00:36
      409000 -- (-510.118) (-502.680) (-504.619) [-506.036] * (-502.912) (-506.742) [-503.851] (-502.853) -- 0:00:36
      409500 -- (-505.851) (-502.967) (-503.608) [-506.310] * [-503.807] (-504.174) (-505.098) (-503.175) -- 0:00:36
      410000 -- (-505.095) (-503.395) (-505.491) [-503.079] * (-502.615) (-508.186) (-502.969) [-502.408] -- 0:00:35

      Average standard deviation of split frequencies: 0.008458

      410500 -- (-508.356) (-502.617) (-502.384) [-503.901] * [-504.202] (-504.487) (-502.619) (-504.685) -- 0:00:35
      411000 -- [-502.583] (-504.021) (-507.539) (-504.140) * (-504.155) (-506.875) [-503.604] (-502.777) -- 0:00:35
      411500 -- (-504.504) (-503.736) [-504.707] (-504.785) * (-505.081) (-507.667) [-503.255] (-506.096) -- 0:00:35
      412000 -- (-505.168) (-505.746) (-505.140) [-505.711] * (-503.912) [-502.639] (-505.445) (-506.175) -- 0:00:35
      412500 -- (-504.177) [-502.739] (-506.625) (-503.038) * (-504.518) (-503.445) [-509.169] (-504.814) -- 0:00:35
      413000 -- (-506.377) (-503.167) (-504.940) [-503.266] * (-505.222) [-505.107] (-506.515) (-504.601) -- 0:00:35
      413500 -- (-502.174) (-503.660) (-506.299) [-504.267] * (-506.066) [-503.623] (-502.333) (-505.890) -- 0:00:35
      414000 -- (-502.871) [-503.204] (-504.518) (-503.765) * (-504.096) (-503.709) [-502.535] (-510.183) -- 0:00:35
      414500 -- (-505.016) [-504.543] (-505.098) (-514.923) * [-504.715] (-503.791) (-504.135) (-504.682) -- 0:00:35
      415000 -- (-508.707) (-508.013) (-508.719) [-506.956] * (-502.695) [-507.044] (-503.248) (-502.223) -- 0:00:35

      Average standard deviation of split frequencies: 0.008121

      415500 -- (-505.166) (-504.196) (-503.336) [-502.740] * (-504.173) [-504.522] (-504.274) (-503.390) -- 0:00:35
      416000 -- [-504.107] (-505.310) (-505.940) (-502.457) * [-505.042] (-505.710) (-505.866) (-504.165) -- 0:00:35
      416500 -- [-503.620] (-503.114) (-505.289) (-503.926) * (-505.512) (-504.808) (-502.685) [-506.278] -- 0:00:35
      417000 -- [-505.349] (-508.526) (-507.875) (-505.571) * (-503.564) [-504.484] (-503.326) (-502.982) -- 0:00:34
      417500 -- (-505.634) (-508.573) [-504.806] (-509.534) * (-505.256) (-502.930) [-502.843] (-506.071) -- 0:00:36
      418000 -- (-502.870) (-512.804) [-504.473] (-503.285) * (-505.109) (-503.958) (-504.149) [-504.938] -- 0:00:36
      418500 -- (-506.532) (-503.009) (-505.540) [-505.570] * (-503.738) [-503.202] (-506.644) (-502.914) -- 0:00:36
      419000 -- [-504.774] (-505.308) (-509.375) (-505.469) * [-503.232] (-503.323) (-506.333) (-503.744) -- 0:00:36
      419500 -- (-506.451) (-504.810) [-503.527] (-504.021) * (-504.603) [-503.336] (-507.096) (-506.010) -- 0:00:35
      420000 -- (-504.213) [-503.186] (-503.982) (-505.007) * [-504.982] (-506.134) (-504.762) (-505.741) -- 0:00:35

      Average standard deviation of split frequencies: 0.008280

      420500 -- (-507.345) (-503.180) [-504.666] (-504.526) * [-502.734] (-504.337) (-506.067) (-503.707) -- 0:00:35
      421000 -- [-505.316] (-503.622) (-505.034) (-502.286) * (-503.125) [-503.420] (-504.391) (-504.279) -- 0:00:35
      421500 -- (-504.226) [-505.897] (-501.973) (-502.594) * (-504.230) (-504.576) (-505.534) [-503.660] -- 0:00:35
      422000 -- (-503.243) [-505.655] (-507.100) (-506.767) * (-504.488) [-504.614] (-504.180) (-504.397) -- 0:00:35
      422500 -- (-503.240) (-505.137) (-502.934) [-509.148] * (-503.327) [-502.527] (-504.557) (-503.216) -- 0:00:35
      423000 -- (-502.924) [-508.890] (-504.841) (-513.243) * [-505.902] (-504.614) (-510.045) (-502.743) -- 0:00:35
      423500 -- (-502.739) (-504.259) [-502.718] (-509.946) * (-508.120) (-504.648) [-506.467] (-505.124) -- 0:00:35
      424000 -- (-503.308) [-505.038] (-506.500) (-509.417) * (-507.001) (-503.930) (-506.009) [-504.101] -- 0:00:35
      424500 -- (-507.290) (-504.163) [-505.469] (-507.230) * (-503.448) (-503.738) (-503.524) [-504.288] -- 0:00:35
      425000 -- (-504.466) [-505.596] (-503.583) (-506.810) * (-503.384) (-505.397) [-506.511] (-506.284) -- 0:00:35

      Average standard deviation of split frequencies: 0.008053

      425500 -- (-504.779) [-502.604] (-509.653) (-503.613) * (-502.344) (-504.558) (-508.479) [-503.375] -- 0:00:35
      426000 -- (-505.345) (-507.536) [-502.392] (-507.062) * [-502.743] (-503.232) (-505.817) (-503.110) -- 0:00:35
      426500 -- (-506.430) (-505.511) [-503.728] (-504.374) * (-503.442) [-504.646] (-504.259) (-503.645) -- 0:00:34
      427000 -- (-504.924) (-508.287) [-504.372] (-504.281) * (-503.220) (-505.721) [-503.035] (-503.269) -- 0:00:34
      427500 -- (-502.186) [-503.370] (-503.520) (-504.459) * (-503.993) (-506.802) (-503.315) [-502.180] -- 0:00:34
      428000 -- (-507.593) (-503.465) [-505.136] (-504.564) * (-503.274) (-507.001) [-502.871] (-502.053) -- 0:00:34
      428500 -- (-506.756) (-508.264) (-504.805) [-504.936] * (-504.863) (-503.179) [-503.571] (-503.209) -- 0:00:34
      429000 -- (-505.803) [-504.143] (-503.948) (-503.760) * [-501.950] (-503.473) (-502.769) (-503.474) -- 0:00:34
      429500 -- (-505.231) (-503.856) (-505.134) [-501.919] * [-502.000] (-502.196) (-506.266) (-507.096) -- 0:00:34
      430000 -- [-504.053] (-503.511) (-504.241) (-504.114) * (-504.073) (-503.781) [-506.520] (-503.601) -- 0:00:34

      Average standard deviation of split frequencies: 0.007966

      430500 -- (-503.664) (-504.901) [-503.804] (-502.318) * (-502.972) (-503.840) [-508.454] (-503.480) -- 0:00:34
      431000 -- (-502.966) (-505.151) (-502.649) [-502.767] * (-504.494) [-503.885] (-504.088) (-511.266) -- 0:00:34
      431500 -- [-505.758] (-507.270) (-503.498) (-503.593) * (-503.026) (-506.253) (-503.517) [-504.860] -- 0:00:34
      432000 -- [-505.160] (-506.129) (-503.147) (-503.203) * (-504.737) (-503.357) [-505.338] (-505.102) -- 0:00:34
      432500 -- [-503.471] (-503.261) (-505.527) (-502.688) * [-507.018] (-505.196) (-504.003) (-503.597) -- 0:00:34
      433000 -- [-504.378] (-503.089) (-505.613) (-505.905) * (-505.309) (-506.528) (-505.365) [-502.753] -- 0:00:34
      433500 -- (-504.552) [-503.946] (-503.520) (-505.053) * (-509.331) (-502.880) (-505.922) [-503.078] -- 0:00:35
      434000 -- [-503.634] (-503.003) (-505.637) (-505.092) * (-504.687) [-503.775] (-503.555) (-502.596) -- 0:00:35
      434500 -- (-505.873) (-506.822) (-504.570) [-501.956] * [-502.931] (-504.279) (-503.778) (-502.719) -- 0:00:35
      435000 -- (-503.679) (-504.591) (-510.787) [-503.904] * (-504.942) (-506.216) (-506.883) [-502.228] -- 0:00:35

      Average standard deviation of split frequencies: 0.007689

      435500 -- (-503.859) [-506.024] (-504.303) (-506.229) * (-502.735) (-503.167) [-504.134] (-504.074) -- 0:00:34
      436000 -- (-503.944) (-508.191) [-503.264] (-504.447) * [-502.900] (-504.068) (-504.608) (-502.672) -- 0:00:34
      436500 -- (-502.618) (-503.560) (-504.155) [-503.494] * [-505.800] (-503.816) (-506.282) (-504.523) -- 0:00:34
      437000 -- (-502.826) [-503.496] (-504.831) (-503.691) * (-504.865) [-505.059] (-508.547) (-504.531) -- 0:00:34
      437500 -- (-502.310) [-502.553] (-503.611) (-503.476) * (-503.050) (-505.243) (-502.354) [-504.434] -- 0:00:34
      438000 -- (-502.729) [-503.975] (-505.066) (-502.476) * [-505.155] (-505.287) (-503.681) (-507.209) -- 0:00:34
      438500 -- (-504.998) (-508.638) [-503.326] (-503.100) * (-503.125) (-507.454) [-503.160] (-507.004) -- 0:00:34
      439000 -- (-505.049) [-504.684] (-502.958) (-502.312) * (-502.325) [-505.263] (-505.864) (-505.479) -- 0:00:34
      439500 -- [-502.936] (-505.627) (-502.488) (-504.451) * [-503.202] (-507.243) (-505.228) (-502.452) -- 0:00:34
      440000 -- [-502.664] (-505.454) (-503.403) (-503.381) * (-503.775) (-502.571) (-503.806) [-503.746] -- 0:00:34

      Average standard deviation of split frequencies: 0.007904

      440500 -- (-504.496) (-504.039) (-504.629) [-502.862] * [-507.503] (-503.677) (-507.166) (-502.868) -- 0:00:34
      441000 -- (-503.144) (-505.111) (-509.360) [-502.666] * (-503.144) [-503.429] (-506.730) (-507.630) -- 0:00:34
      441500 -- (-507.003) [-504.900] (-502.901) (-508.484) * (-505.270) (-504.957) (-504.394) [-506.346] -- 0:00:34
      442000 -- [-503.910] (-508.997) (-506.858) (-505.670) * (-505.703) (-502.045) [-507.828] (-507.482) -- 0:00:34
      442500 -- (-505.145) (-502.969) [-503.171] (-502.889) * (-506.236) [-504.608] (-504.500) (-504.492) -- 0:00:34
      443000 -- (-508.732) (-504.866) [-506.916] (-503.431) * [-504.489] (-503.806) (-506.100) (-503.928) -- 0:00:33
      443500 -- (-507.885) (-503.796) [-503.675] (-503.108) * (-503.085) (-504.071) (-506.807) [-502.604] -- 0:00:33
      444000 -- [-504.316] (-504.290) (-503.051) (-503.667) * [-503.318] (-502.181) (-503.915) (-502.224) -- 0:00:33
      444500 -- (-508.824) [-503.214] (-504.714) (-503.287) * [-503.667] (-503.173) (-506.937) (-506.423) -- 0:00:33
      445000 -- (-506.338) [-503.248] (-505.270) (-507.775) * (-515.173) [-502.901] (-506.856) (-505.124) -- 0:00:33

      Average standard deviation of split frequencies: 0.007868

      445500 -- [-504.586] (-504.010) (-504.292) (-502.877) * [-505.238] (-504.015) (-508.557) (-507.862) -- 0:00:33
      446000 -- (-509.190) [-502.147] (-504.057) (-502.787) * (-503.721) (-505.371) (-505.115) [-505.297] -- 0:00:33
      446500 -- (-506.442) (-503.024) (-507.726) [-504.414] * (-504.292) [-503.025] (-508.013) (-505.315) -- 0:00:33
      447000 -- [-505.421] (-505.388) (-508.817) (-504.970) * (-505.626) [-502.730] (-504.663) (-504.417) -- 0:00:33
      447500 -- (-502.639) [-502.877] (-503.031) (-504.092) * (-503.399) (-503.318) [-503.669] (-504.268) -- 0:00:33
      448000 -- (-506.337) [-503.560] (-502.587) (-506.322) * (-503.220) [-503.641] (-503.351) (-504.291) -- 0:00:33
      448500 -- (-503.560) (-508.360) [-504.640] (-505.296) * [-504.728] (-502.392) (-503.107) (-503.909) -- 0:00:33
      449000 -- (-503.219) (-503.763) [-504.329] (-504.435) * (-504.346) (-503.024) (-504.905) [-503.246] -- 0:00:33
      449500 -- (-506.849) [-505.617] (-502.247) (-503.447) * (-506.520) (-502.499) [-502.489] (-502.872) -- 0:00:33
      450000 -- [-504.136] (-502.717) (-504.153) (-503.109) * (-506.305) (-505.644) (-507.049) [-503.570] -- 0:00:34

      Average standard deviation of split frequencies: 0.007496

      450500 -- (-502.701) (-503.508) [-505.110] (-502.394) * (-503.310) [-503.085] (-503.696) (-503.601) -- 0:00:34
      451000 -- (-504.456) (-508.183) [-505.814] (-504.678) * [-503.829] (-506.651) (-502.774) (-503.880) -- 0:00:34
      451500 -- (-503.340) (-506.717) (-510.313) [-503.197] * (-504.552) (-503.959) (-503.204) [-504.159] -- 0:00:34
      452000 -- (-505.573) (-504.613) (-504.302) [-502.859] * (-509.412) [-503.336] (-506.252) (-506.052) -- 0:00:33
      452500 -- (-505.379) (-504.725) [-504.644] (-503.016) * (-505.936) (-508.885) (-505.941) [-507.401] -- 0:00:33
      453000 -- [-503.468] (-503.974) (-507.276) (-504.702) * [-503.497] (-505.989) (-503.174) (-506.200) -- 0:00:33
      453500 -- (-508.073) (-505.138) (-504.481) [-503.086] * (-503.253) (-504.616) [-510.214] (-505.949) -- 0:00:33
      454000 -- (-505.917) [-503.397] (-507.449) (-504.075) * [-505.618] (-504.594) (-506.852) (-503.946) -- 0:00:33
      454500 -- (-505.035) (-510.441) [-504.036] (-502.914) * (-503.791) (-507.642) [-503.264] (-502.609) -- 0:00:33
      455000 -- [-505.605] (-507.832) (-503.766) (-504.429) * (-505.716) (-504.940) [-507.422] (-506.254) -- 0:00:33

      Average standard deviation of split frequencies: 0.008141

      455500 -- (-503.535) [-502.943] (-503.081) (-503.441) * [-503.798] (-504.291) (-503.929) (-503.591) -- 0:00:33
      456000 -- (-504.687) [-503.388] (-505.256) (-505.926) * [-502.737] (-505.562) (-504.829) (-503.212) -- 0:00:33
      456500 -- (-503.042) (-505.407) [-504.286] (-505.828) * (-506.182) (-505.162) [-504.641] (-503.043) -- 0:00:33
      457000 -- [-505.370] (-505.004) (-502.806) (-503.898) * (-504.135) (-504.499) [-503.117] (-504.966) -- 0:00:33
      457500 -- (-502.966) (-502.326) (-503.338) [-503.681] * [-506.112] (-502.612) (-503.861) (-504.519) -- 0:00:33
      458000 -- (-506.018) [-505.621] (-505.892) (-503.799) * (-506.741) (-503.128) (-504.110) [-503.782] -- 0:00:33
      458500 -- (-507.426) (-506.182) (-506.032) [-508.483] * (-511.402) [-504.841] (-502.503) (-503.527) -- 0:00:33
      459000 -- (-505.405) [-505.173] (-508.115) (-506.026) * (-504.251) (-505.485) [-502.610] (-503.258) -- 0:00:33
      459500 -- (-506.153) (-503.177) (-502.848) [-505.773] * [-504.420] (-506.735) (-504.680) (-503.645) -- 0:00:32
      460000 -- [-505.205] (-502.353) (-506.809) (-505.716) * (-502.921) [-502.578] (-503.446) (-503.858) -- 0:00:32

      Average standard deviation of split frequencies: 0.008728

      460500 -- (-504.029) (-503.915) (-502.293) [-502.918] * (-503.923) (-504.080) [-503.927] (-505.372) -- 0:00:32
      461000 -- (-504.123) (-503.404) [-504.962] (-503.666) * (-503.162) [-506.691] (-504.132) (-505.908) -- 0:00:32
      461500 -- [-502.889] (-502.976) (-505.391) (-503.318) * (-505.350) [-504.022] (-504.154) (-505.327) -- 0:00:32
      462000 -- (-504.340) (-503.100) (-504.409) [-502.017] * (-503.412) (-506.148) (-503.563) [-506.730] -- 0:00:32
      462500 -- (-506.044) (-505.568) [-508.056] (-503.151) * (-503.210) (-507.704) (-503.578) [-506.258] -- 0:00:32
      463000 -- (-503.008) (-505.900) (-504.640) [-505.235] * (-505.202) [-503.184] (-503.158) (-508.399) -- 0:00:32
      463500 -- (-502.999) (-505.392) (-506.462) [-503.949] * (-504.220) (-502.844) [-505.759] (-505.354) -- 0:00:32
      464000 -- (-505.601) [-503.852] (-507.087) (-504.776) * (-503.412) (-504.656) (-504.924) [-502.456] -- 0:00:32
      464500 -- (-506.122) [-506.368] (-504.618) (-504.648) * (-504.845) (-504.516) (-508.427) [-506.671] -- 0:00:32
      465000 -- (-505.442) (-510.971) (-504.740) [-504.393] * (-511.314) (-502.782) (-503.164) [-502.865] -- 0:00:32

      Average standard deviation of split frequencies: 0.009045

      465500 -- (-502.803) (-505.021) (-504.429) [-503.989] * (-503.438) (-501.862) [-504.508] (-503.116) -- 0:00:32
      466000 -- [-503.958] (-503.567) (-504.590) (-503.186) * (-505.902) (-503.677) [-505.005] (-504.054) -- 0:00:32
      466500 -- [-503.021] (-507.035) (-504.908) (-503.090) * (-503.245) (-505.041) [-503.705] (-504.797) -- 0:00:33
      467000 -- (-510.242) (-502.704) (-503.643) [-508.431] * (-502.665) (-503.117) (-507.883) [-502.975] -- 0:00:33
      467500 -- (-510.050) (-502.504) [-503.964] (-507.525) * (-505.268) (-505.753) [-502.841] (-504.514) -- 0:00:33
      468000 -- [-508.071] (-504.804) (-507.080) (-503.672) * (-504.689) (-506.100) (-503.998) [-502.548] -- 0:00:32
      468500 -- (-503.410) (-505.674) [-502.839] (-510.503) * (-502.505) (-504.674) (-506.184) [-503.503] -- 0:00:32
      469000 -- [-502.889] (-507.905) (-505.553) (-503.710) * (-503.818) (-504.210) (-508.300) [-502.164] -- 0:00:32
      469500 -- (-504.377) [-508.389] (-508.849) (-505.123) * (-503.412) [-503.148] (-508.741) (-504.313) -- 0:00:32
      470000 -- (-503.712) [-504.738] (-502.594) (-503.572) * (-503.493) (-506.835) [-506.415] (-506.086) -- 0:00:32

      Average standard deviation of split frequencies: 0.008248

      470500 -- (-504.010) [-504.028] (-504.465) (-502.737) * (-503.897) (-503.722) (-506.008) [-505.088] -- 0:00:32
      471000 -- (-504.962) (-505.798) [-504.222] (-503.653) * (-503.756) (-506.022) (-505.637) [-504.398] -- 0:00:32
      471500 -- [-504.909] (-504.264) (-503.191) (-506.319) * [-502.337] (-507.690) (-504.566) (-506.301) -- 0:00:32
      472000 -- [-502.722] (-502.380) (-504.723) (-503.775) * [-503.033] (-505.282) (-506.332) (-506.548) -- 0:00:32
      472500 -- (-504.960) (-503.050) [-503.936] (-505.059) * [-504.554] (-503.614) (-503.246) (-505.139) -- 0:00:32
      473000 -- [-503.300] (-503.922) (-503.811) (-502.424) * (-503.658) (-504.905) (-503.859) [-504.576] -- 0:00:32
      473500 -- (-505.327) [-503.748] (-503.630) (-505.674) * (-502.890) [-505.592] (-504.982) (-503.066) -- 0:00:32
      474000 -- [-504.012] (-506.469) (-503.526) (-505.781) * [-508.520] (-502.905) (-503.981) (-504.316) -- 0:00:32
      474500 -- (-504.761) (-503.925) [-502.193] (-505.795) * (-506.034) (-502.691) (-507.442) [-508.941] -- 0:00:32
      475000 -- (-504.689) (-504.404) [-502.277] (-505.316) * [-504.199] (-504.358) (-503.927) (-503.622) -- 0:00:32

      Average standard deviation of split frequencies: 0.008108

      475500 -- [-505.686] (-503.358) (-508.637) (-506.602) * (-503.047) (-502.816) [-504.089] (-503.598) -- 0:00:31
      476000 -- (-504.242) (-504.111) (-502.997) [-505.193] * (-502.860) [-505.101] (-508.563) (-506.978) -- 0:00:31
      476500 -- (-507.874) (-502.967) (-503.066) [-505.356] * (-505.540) (-505.644) (-506.888) [-505.087] -- 0:00:31
      477000 -- (-507.201) (-505.975) [-502.929] (-505.122) * [-505.310] (-504.178) (-503.563) (-508.034) -- 0:00:31
      477500 -- (-506.131) (-503.527) [-504.207] (-502.689) * [-503.535] (-504.393) (-506.013) (-505.141) -- 0:00:31
      478000 -- [-505.951] (-504.315) (-504.791) (-508.219) * (-508.810) (-503.144) [-504.600] (-504.020) -- 0:00:31
      478500 -- (-503.331) [-503.826] (-505.384) (-504.797) * (-505.191) (-504.028) (-504.275) [-504.708] -- 0:00:31
      479000 -- (-505.197) [-503.446] (-504.194) (-503.237) * (-505.673) (-502.261) (-506.322) [-504.053] -- 0:00:31
      479500 -- (-504.399) [-502.806] (-504.022) (-503.328) * (-501.943) [-502.741] (-505.005) (-504.531) -- 0:00:31
      480000 -- [-502.444] (-502.489) (-503.939) (-506.602) * [-502.159] (-503.958) (-508.836) (-502.668) -- 0:00:31

      Average standard deviation of split frequencies: 0.008581

      480500 -- (-506.759) [-502.329] (-503.573) (-505.299) * [-503.413] (-502.311) (-510.645) (-507.672) -- 0:00:31
      481000 -- (-508.058) (-503.752) [-504.232] (-502.767) * (-504.467) [-504.377] (-504.883) (-506.291) -- 0:00:31
      481500 -- (-504.017) (-503.491) [-504.517] (-503.954) * (-502.283) (-504.198) [-504.041] (-505.995) -- 0:00:31
      482000 -- (-502.920) [-502.356] (-504.477) (-502.596) * (-506.482) (-504.877) (-504.872) [-503.369] -- 0:00:31
      482500 -- [-502.793] (-503.246) (-504.144) (-502.605) * [-504.200] (-502.907) (-504.598) (-503.429) -- 0:00:31
      483000 -- (-505.034) [-504.697] (-503.079) (-502.605) * (-505.160) (-502.589) [-505.431] (-504.381) -- 0:00:32
      483500 -- (-504.470) (-503.410) [-503.112] (-506.541) * (-503.217) (-504.130) (-506.353) [-504.269] -- 0:00:32
      484000 -- [-503.576] (-505.738) (-504.114) (-505.127) * (-507.230) (-502.666) [-504.126] (-505.916) -- 0:00:31
      484500 -- (-503.456) (-503.360) [-506.082] (-503.465) * (-502.678) (-506.607) [-503.338] (-503.865) -- 0:00:31
      485000 -- (-507.118) (-505.308) (-507.448) [-503.849] * (-505.575) (-505.497) [-503.955] (-503.507) -- 0:00:31

      Average standard deviation of split frequencies: 0.008501

      485500 -- (-507.929) (-503.614) [-505.647] (-502.673) * (-503.669) [-506.905] (-503.551) (-504.290) -- 0:00:31
      486000 -- [-502.356] (-507.083) (-502.501) (-505.314) * (-503.519) [-504.762] (-504.531) (-503.605) -- 0:00:31
      486500 -- (-503.762) (-506.074) (-503.067) [-503.251] * (-503.042) [-503.293] (-506.073) (-502.893) -- 0:00:31
      487000 -- [-502.219] (-504.563) (-506.004) (-504.318) * [-502.949] (-504.327) (-505.552) (-504.658) -- 0:00:31
      487500 -- (-507.019) (-504.039) (-503.372) [-504.613] * [-502.862] (-505.136) (-502.904) (-502.624) -- 0:00:31
      488000 -- [-504.687] (-503.258) (-503.312) (-506.332) * (-503.716) (-505.609) [-503.571] (-504.307) -- 0:00:31
      488500 -- (-505.268) [-503.524] (-507.948) (-502.966) * (-505.687) (-505.038) [-503.345] (-505.701) -- 0:00:31
      489000 -- [-503.788] (-507.261) (-507.051) (-504.919) * (-507.156) [-510.399] (-502.784) (-504.949) -- 0:00:31
      489500 -- (-504.011) [-502.275] (-507.128) (-503.396) * (-504.862) [-504.096] (-502.439) (-505.248) -- 0:00:31
      490000 -- (-506.863) (-505.274) (-503.712) [-507.882] * [-504.268] (-505.105) (-502.329) (-506.062) -- 0:00:31

      Average standard deviation of split frequencies: 0.008308

      490500 -- (-503.514) (-504.232) (-503.284) [-502.891] * (-504.726) (-502.727) [-503.804] (-502.916) -- 0:00:31
      491000 -- (-503.469) (-503.631) [-506.638] (-502.450) * (-504.556) (-508.496) (-503.576) [-503.845] -- 0:00:31
      491500 -- (-507.116) (-505.078) (-503.465) [-506.076] * (-504.473) (-503.668) (-506.131) [-503.697] -- 0:00:31
      492000 -- [-507.015] (-503.686) (-504.924) (-505.075) * (-503.681) [-505.940] (-507.920) (-503.561) -- 0:00:30
      492500 -- (-506.108) [-506.641] (-504.958) (-506.060) * [-506.098] (-507.696) (-505.689) (-508.902) -- 0:00:30
      493000 -- (-503.388) [-507.210] (-503.537) (-504.607) * (-504.381) [-504.397] (-507.860) (-511.615) -- 0:00:30
      493500 -- (-503.852) [-505.889] (-508.115) (-506.678) * (-502.594) [-503.844] (-505.897) (-505.167) -- 0:00:30
      494000 -- [-504.232] (-506.924) (-504.338) (-504.525) * (-505.547) (-505.007) [-503.179] (-503.296) -- 0:00:30
      494500 -- (-502.943) [-507.655] (-508.198) (-503.616) * (-504.787) (-503.972) (-503.831) [-506.715] -- 0:00:30
      495000 -- (-503.250) [-502.354] (-502.256) (-504.816) * (-504.585) (-505.867) (-506.427) [-505.835] -- 0:00:30

      Average standard deviation of split frequencies: 0.009385

      495500 -- (-503.651) [-502.703] (-503.603) (-503.139) * [-505.151] (-506.443) (-504.726) (-504.697) -- 0:00:30
      496000 -- (-504.705) [-503.687] (-505.729) (-506.564) * (-504.165) (-504.608) [-504.276] (-506.095) -- 0:00:30
      496500 -- (-504.102) (-503.295) (-505.355) [-505.218] * (-502.758) (-504.384) [-505.234] (-505.449) -- 0:00:30
      497000 -- (-504.470) (-507.448) [-504.857] (-503.849) * [-504.194] (-503.319) (-502.963) (-503.934) -- 0:00:30
      497500 -- (-504.045) [-505.029] (-508.088) (-505.252) * (-505.716) (-502.295) (-502.917) [-504.627] -- 0:00:30
      498000 -- (-504.023) (-504.528) [-503.830] (-504.130) * [-504.391] (-508.728) (-504.027) (-502.973) -- 0:00:30
      498500 -- (-508.937) [-503.075] (-507.325) (-504.830) * (-504.087) (-505.435) [-506.059] (-502.044) -- 0:00:30
      499000 -- (-504.073) [-502.726] (-502.747) (-505.080) * (-510.798) (-505.009) [-506.158] (-504.352) -- 0:00:31
      499500 -- (-504.521) [-504.123] (-502.784) (-514.088) * [-504.616] (-503.836) (-504.657) (-503.401) -- 0:00:31
      500000 -- (-506.409) (-504.147) [-502.950] (-505.612) * (-504.302) (-506.215) [-502.382] (-503.017) -- 0:00:31

      Average standard deviation of split frequencies: 0.008529

      500500 -- (-505.533) [-504.928] (-502.780) (-505.129) * (-502.925) (-506.393) [-503.521] (-503.219) -- 0:00:30
      501000 -- (-506.019) [-506.391] (-507.291) (-503.078) * (-505.369) (-504.791) [-503.542] (-504.562) -- 0:00:30
      501500 -- [-503.831] (-505.868) (-505.427) (-505.415) * (-503.566) (-503.730) (-502.069) [-504.075] -- 0:00:30
      502000 -- (-504.315) [-503.749] (-502.607) (-506.945) * (-504.679) (-503.002) [-505.394] (-504.668) -- 0:00:30
      502500 -- (-508.788) (-505.493) [-502.001] (-503.632) * [-503.942] (-503.392) (-505.310) (-503.142) -- 0:00:30
      503000 -- [-504.413] (-504.236) (-503.720) (-502.426) * [-503.444] (-502.935) (-505.229) (-505.355) -- 0:00:30
      503500 -- (-503.334) (-506.261) [-503.502] (-502.857) * (-504.243) (-503.115) (-506.644) [-503.593] -- 0:00:30
      504000 -- (-502.811) (-505.761) [-504.324] (-503.016) * (-507.015) (-505.455) (-508.679) [-503.728] -- 0:00:30
      504500 -- [-504.568] (-502.491) (-504.721) (-508.489) * (-503.705) (-505.520) [-507.401] (-505.041) -- 0:00:30
      505000 -- (-502.981) (-503.268) [-503.584] (-502.559) * (-504.034) (-506.413) (-506.071) [-505.337] -- 0:00:30

      Average standard deviation of split frequencies: 0.008165

      505500 -- (-503.079) (-506.041) (-504.323) [-502.683] * (-504.564) (-503.388) [-503.131] (-503.015) -- 0:00:30
      506000 -- [-502.545] (-505.906) (-504.062) (-503.392) * [-506.447] (-507.101) (-503.223) (-503.085) -- 0:00:30
      506500 -- [-504.516] (-504.439) (-505.770) (-506.748) * (-504.669) (-505.531) (-502.943) [-503.773] -- 0:00:30
      507000 -- (-505.822) (-503.673) (-505.633) [-504.058] * [-502.942] (-503.175) (-505.411) (-504.577) -- 0:00:30
      507500 -- (-502.349) [-505.877] (-504.537) (-503.733) * (-503.197) (-502.943) (-502.898) [-504.835] -- 0:00:30
      508000 -- (-502.203) (-504.265) [-505.282] (-503.601) * (-503.387) [-503.538] (-504.937) (-505.260) -- 0:00:30
      508500 -- [-503.773] (-505.752) (-509.404) (-503.061) * (-504.579) [-502.349] (-505.882) (-505.357) -- 0:00:29
      509000 -- [-502.276] (-504.921) (-502.945) (-508.299) * [-503.205] (-503.003) (-503.611) (-504.467) -- 0:00:29
      509500 -- [-503.404] (-502.890) (-504.210) (-508.416) * [-502.085] (-503.802) (-505.044) (-504.064) -- 0:00:29
      510000 -- (-503.802) (-503.407) (-504.609) [-502.600] * (-504.196) [-504.065] (-505.062) (-505.738) -- 0:00:29

      Average standard deviation of split frequencies: 0.008205

      510500 -- [-502.740] (-506.250) (-503.864) (-507.805) * (-509.218) (-506.478) [-503.991] (-504.621) -- 0:00:29
      511000 -- (-505.708) (-506.655) (-504.189) [-504.237] * (-504.209) (-503.479) [-503.424] (-506.731) -- 0:00:29
      511500 -- (-503.076) (-507.516) [-506.476] (-502.282) * (-502.747) (-504.553) [-503.697] (-504.632) -- 0:00:29
      512000 -- [-507.977] (-508.334) (-503.150) (-502.146) * (-508.165) (-504.140) [-505.176] (-506.867) -- 0:00:29
      512500 -- (-502.410) (-506.476) [-503.726] (-504.193) * (-505.313) [-505.606] (-504.996) (-504.220) -- 0:00:29
      513000 -- (-503.533) (-505.865) (-502.869) [-503.782] * [-505.576] (-504.447) (-503.691) (-505.438) -- 0:00:29
      513500 -- [-511.308] (-504.101) (-503.204) (-504.377) * (-504.787) (-503.757) (-504.859) [-504.220] -- 0:00:30
      514000 -- [-504.161] (-502.466) (-503.261) (-502.072) * [-503.001] (-505.715) (-503.930) (-502.682) -- 0:00:30
      514500 -- (-506.724) (-504.245) (-505.454) [-506.204] * (-502.731) (-503.438) (-505.099) [-504.299] -- 0:00:30
      515000 -- (-504.833) (-506.168) [-503.844] (-504.730) * (-503.939) [-502.554] (-503.564) (-502.910) -- 0:00:30

      Average standard deviation of split frequencies: 0.008425

      515500 -- (-504.859) (-511.324) [-504.829] (-503.944) * (-509.552) (-503.426) (-503.965) [-505.961] -- 0:00:30
      516000 -- [-504.106] (-508.480) (-503.670) (-504.062) * (-503.988) (-503.168) [-503.729] (-504.264) -- 0:00:30
      516500 -- (-503.884) [-506.357] (-507.988) (-503.308) * (-508.412) [-503.328] (-502.813) (-506.389) -- 0:00:29
      517000 -- (-503.228) [-503.651] (-504.690) (-503.575) * (-505.423) (-506.487) (-503.323) [-503.865] -- 0:00:29
      517500 -- (-506.110) [-502.769] (-504.332) (-506.636) * (-502.179) [-506.130] (-503.751) (-502.580) -- 0:00:29
      518000 -- [-503.859] (-507.911) (-505.844) (-503.287) * (-502.725) (-509.660) (-504.276) [-505.865] -- 0:00:29
      518500 -- (-504.929) (-506.115) [-503.814] (-504.692) * (-502.826) [-503.693] (-503.054) (-503.019) -- 0:00:29
      519000 -- [-505.717] (-509.636) (-506.424) (-503.383) * (-505.793) [-503.426] (-503.121) (-504.529) -- 0:00:29
      519500 -- (-502.443) [-505.270] (-504.871) (-505.585) * (-505.375) [-503.741] (-503.313) (-503.189) -- 0:00:29
      520000 -- [-503.860] (-506.563) (-507.619) (-503.968) * (-511.539) (-503.227) (-503.344) [-504.828] -- 0:00:29

      Average standard deviation of split frequencies: 0.007669

      520500 -- (-507.075) (-505.219) (-503.470) [-503.320] * [-504.434] (-503.670) (-503.251) (-503.808) -- 0:00:29
      521000 -- [-508.399] (-502.828) (-505.300) (-504.063) * [-502.582] (-503.481) (-503.296) (-503.398) -- 0:00:29
      521500 -- (-505.043) (-505.316) (-505.570) [-503.030] * (-502.885) (-503.107) (-502.404) [-503.818] -- 0:00:29
      522000 -- (-509.713) [-503.289] (-502.889) (-503.768) * (-504.634) [-506.108] (-503.275) (-503.640) -- 0:00:29
      522500 -- (-506.218) (-503.783) (-507.025) [-504.421] * (-507.651) (-508.243) (-505.344) [-504.932] -- 0:00:29
      523000 -- (-505.652) (-504.513) [-503.247] (-503.378) * (-507.438) (-505.282) [-504.211] (-507.322) -- 0:00:29
      523500 -- (-505.469) (-503.570) (-504.630) [-505.783] * (-504.367) (-507.544) [-502.555] (-507.135) -- 0:00:29
      524000 -- (-509.475) (-503.519) [-503.813] (-505.651) * (-503.624) [-508.761] (-504.733) (-504.286) -- 0:00:29
      524500 -- (-506.304) (-507.925) [-506.197] (-503.113) * (-503.657) (-504.528) [-503.839] (-504.290) -- 0:00:29
      525000 -- (-504.115) [-505.905] (-508.634) (-501.957) * (-506.028) [-506.106] (-510.596) (-502.279) -- 0:00:28

      Average standard deviation of split frequencies: 0.007960

      525500 -- (-504.488) (-502.165) [-507.461] (-503.246) * (-510.006) [-503.258] (-506.396) (-502.080) -- 0:00:28
      526000 -- (-502.880) (-507.149) [-505.822] (-507.460) * (-507.432) (-504.089) (-505.701) [-502.951] -- 0:00:28
      526500 -- (-505.816) (-508.730) (-505.380) [-503.296] * (-506.221) (-503.243) [-504.294] (-508.768) -- 0:00:28
      527000 -- (-513.894) (-503.123) [-505.366] (-502.845) * (-503.367) [-501.986] (-506.124) (-503.324) -- 0:00:28
      527500 -- (-504.191) (-505.016) (-505.195) [-503.356] * (-502.503) (-511.725) (-507.746) [-502.825] -- 0:00:28
      528000 -- (-505.689) (-506.297) [-503.583] (-504.421) * (-502.928) [-502.748] (-505.203) (-505.082) -- 0:00:28
      528500 -- (-510.760) (-506.558) (-508.705) [-507.577] * (-503.277) (-503.482) (-504.567) [-507.206] -- 0:00:28
      529000 -- (-504.073) (-505.023) (-503.207) [-505.255] * (-506.731) [-503.468] (-502.920) (-504.449) -- 0:00:29
      529500 -- (-505.927) [-506.386] (-505.407) (-507.226) * (-508.130) (-505.422) [-502.854] (-505.950) -- 0:00:29
      530000 -- (-506.107) (-504.478) [-506.651] (-506.294) * [-506.399] (-504.620) (-505.817) (-505.239) -- 0:00:29

      Average standard deviation of split frequencies: 0.008570

      530500 -- (-506.212) [-505.584] (-508.227) (-504.325) * (-508.195) (-504.613) (-505.044) [-505.463] -- 0:00:29
      531000 -- (-504.769) (-503.148) (-505.539) [-506.717] * (-504.760) (-504.600) (-506.348) [-504.352] -- 0:00:29
      531500 -- (-504.411) (-504.554) (-508.122) [-504.398] * (-503.759) [-503.555] (-508.800) (-506.277) -- 0:00:29
      532000 -- (-505.768) [-503.416] (-505.656) (-504.860) * (-502.892) (-502.872) (-508.813) [-503.445] -- 0:00:29
      532500 -- (-503.458) [-502.215] (-503.849) (-506.101) * [-503.845] (-506.622) (-504.924) (-504.583) -- 0:00:28
      533000 -- (-503.670) (-503.533) [-503.692] (-503.231) * (-503.391) (-506.452) [-503.919] (-504.189) -- 0:00:28
      533500 -- (-504.725) (-506.190) [-502.107] (-503.805) * [-502.640] (-505.032) (-502.811) (-503.962) -- 0:00:28
      534000 -- (-505.174) (-505.663) [-504.893] (-505.076) * (-502.554) (-507.205) (-503.823) [-503.476] -- 0:00:28
      534500 -- (-505.221) (-505.935) (-502.771) [-506.919] * (-503.595) (-504.943) [-503.291] (-502.579) -- 0:00:28
      535000 -- [-504.498] (-506.979) (-503.408) (-505.092) * (-502.663) (-504.263) (-503.671) [-503.864] -- 0:00:28

      Average standard deviation of split frequencies: 0.008847

      535500 -- (-507.315) (-502.959) [-505.463] (-503.890) * [-503.140] (-504.036) (-506.511) (-505.471) -- 0:00:28
      536000 -- (-502.311) (-503.764) [-503.416] (-507.734) * (-503.315) [-504.391] (-505.336) (-504.331) -- 0:00:28
      536500 -- (-503.575) (-502.879) (-510.519) [-502.729] * (-505.284) (-504.483) (-509.206) [-503.176] -- 0:00:28
      537000 -- (-503.343) (-503.811) [-504.364] (-505.747) * (-504.748) (-505.507) [-504.284] (-504.512) -- 0:00:28
      537500 -- (-502.992) (-504.392) [-503.950] (-502.273) * (-505.007) (-505.023) (-506.431) [-502.288] -- 0:00:28
      538000 -- (-506.871) (-506.681) [-503.095] (-503.982) * (-504.359) (-506.658) (-503.767) [-502.152] -- 0:00:28
      538500 -- (-506.710) (-502.641) [-504.564] (-504.488) * (-505.105) (-503.024) [-503.176] (-503.071) -- 0:00:28
      539000 -- (-506.652) (-504.657) [-503.801] (-503.151) * (-507.002) (-510.639) [-505.187] (-502.762) -- 0:00:28
      539500 -- (-504.545) (-504.311) [-506.748] (-507.631) * (-505.912) [-503.174] (-506.058) (-504.386) -- 0:00:28
      540000 -- (-504.185) (-503.747) [-504.288] (-502.543) * [-505.570] (-505.985) (-502.475) (-509.235) -- 0:00:28

      Average standard deviation of split frequencies: 0.008873

      540500 -- (-506.952) (-504.445) [-506.021] (-504.918) * [-503.021] (-504.558) (-505.245) (-504.226) -- 0:00:28
      541000 -- (-505.660) (-502.386) [-503.542] (-505.044) * (-504.605) [-503.874] (-506.363) (-506.055) -- 0:00:27
      541500 -- [-509.446] (-503.093) (-504.741) (-504.076) * (-508.154) [-505.347] (-504.878) (-506.435) -- 0:00:27
      542000 -- (-507.167) (-507.362) [-505.626] (-503.502) * [-502.270] (-508.143) (-503.896) (-506.942) -- 0:00:27
      542500 -- (-507.379) [-503.986] (-503.856) (-505.880) * (-509.208) (-504.258) (-502.985) [-503.618] -- 0:00:27
      543000 -- (-506.304) (-507.993) [-505.307] (-504.635) * (-510.145) [-504.732] (-503.693) (-507.392) -- 0:00:27
      543500 -- (-503.066) (-507.042) (-502.478) [-504.676] * (-503.697) (-503.481) (-503.947) [-503.846] -- 0:00:27
      544000 -- (-503.972) [-504.966] (-503.121) (-502.624) * (-504.951) (-505.002) (-502.844) [-503.666] -- 0:00:27
      544500 -- (-504.157) (-506.463) [-504.025] (-503.700) * [-503.532] (-505.378) (-503.709) (-504.673) -- 0:00:27
      545000 -- (-513.211) [-505.149] (-502.538) (-508.093) * (-507.185) (-503.165) [-503.236] (-506.583) -- 0:00:27

      Average standard deviation of split frequencies: 0.009142

      545500 -- [-503.008] (-504.137) (-504.077) (-504.163) * [-502.991] (-508.377) (-504.681) (-503.887) -- 0:00:28
      546000 -- [-503.118] (-504.664) (-504.833) (-503.545) * (-505.035) (-504.559) [-502.883] (-507.749) -- 0:00:28
      546500 -- (-504.566) (-502.714) (-507.495) [-504.717] * (-504.398) (-504.758) [-507.907] (-504.694) -- 0:00:28
      547000 -- (-504.541) (-502.392) (-505.505) [-502.854] * (-502.323) [-506.074] (-503.316) (-505.714) -- 0:00:28
      547500 -- (-506.246) (-504.033) [-502.610] (-502.816) * (-508.953) [-505.200] (-506.218) (-503.572) -- 0:00:28
      548000 -- [-505.738] (-502.705) (-502.132) (-505.062) * (-506.082) (-502.808) (-503.808) [-503.716] -- 0:00:28
      548500 -- (-505.895) [-503.592] (-502.677) (-506.001) * (-504.124) [-504.206] (-507.998) (-503.752) -- 0:00:27
      549000 -- [-505.444] (-503.465) (-503.981) (-504.807) * (-502.875) (-502.773) (-513.966) [-505.626] -- 0:00:27
      549500 -- (-505.513) (-503.712) (-507.219) [-505.646] * (-504.814) [-502.658] (-503.479) (-506.500) -- 0:00:27
      550000 -- (-506.171) (-506.964) (-504.913) [-505.275] * (-503.179) (-503.991) (-503.657) [-505.596] -- 0:00:27

      Average standard deviation of split frequencies: 0.009417

      550500 -- (-510.373) (-503.642) (-503.279) [-503.143] * [-502.383] (-503.530) (-504.869) (-509.252) -- 0:00:27
      551000 -- [-506.244] (-503.876) (-502.469) (-502.324) * (-507.417) [-504.122] (-507.296) (-502.980) -- 0:00:27
      551500 -- (-503.666) [-504.442] (-503.882) (-503.031) * [-504.688] (-503.556) (-506.459) (-505.357) -- 0:00:27
      552000 -- [-503.659] (-501.996) (-503.995) (-508.956) * [-506.102] (-505.777) (-505.057) (-508.439) -- 0:00:27
      552500 -- (-503.340) (-501.991) [-505.706] (-506.667) * [-504.778] (-503.269) (-503.138) (-505.160) -- 0:00:27
      553000 -- [-502.666] (-503.055) (-502.871) (-503.424) * (-504.480) [-505.872] (-503.677) (-503.778) -- 0:00:27
      553500 -- (-511.552) [-503.926] (-506.990) (-503.924) * [-502.516] (-503.432) (-506.764) (-503.679) -- 0:00:27
      554000 -- (-502.773) (-505.830) [-504.079] (-504.755) * (-502.386) (-507.318) (-504.009) [-503.396] -- 0:00:27
      554500 -- [-503.162] (-502.513) (-503.092) (-503.794) * (-503.062) (-505.723) (-504.798) [-502.786] -- 0:00:27
      555000 -- [-507.099] (-506.553) (-502.638) (-502.933) * (-502.894) [-503.276] (-505.707) (-505.143) -- 0:00:27

      Average standard deviation of split frequencies: 0.008778

      555500 -- (-504.724) [-504.903] (-504.527) (-503.218) * (-503.051) (-503.347) [-503.676] (-503.145) -- 0:00:27
      556000 -- [-504.211] (-504.383) (-503.728) (-509.431) * (-505.597) (-502.471) (-504.690) [-504.051] -- 0:00:27
      556500 -- [-503.725] (-504.489) (-504.057) (-505.276) * (-506.994) [-502.465] (-504.129) (-504.403) -- 0:00:27
      557000 -- (-502.640) (-506.153) [-503.466] (-507.805) * (-507.173) [-506.646] (-505.630) (-502.632) -- 0:00:27
      557500 -- (-503.188) (-505.878) (-503.949) [-506.204] * (-505.098) [-506.367] (-507.550) (-504.015) -- 0:00:26
      558000 -- (-502.744) (-505.406) (-508.293) [-506.163] * (-505.352) [-503.763] (-508.020) (-505.762) -- 0:00:26
      558500 -- (-503.473) (-506.418) [-503.590] (-503.390) * (-504.047) [-506.428] (-505.717) (-504.386) -- 0:00:26
      559000 -- (-503.931) (-503.938) [-503.942] (-506.459) * (-504.198) (-505.348) [-502.930] (-503.989) -- 0:00:26
      559500 -- (-505.779) (-504.154) (-503.791) [-505.609] * (-507.097) (-503.011) (-505.079) [-508.784] -- 0:00:26
      560000 -- (-509.548) [-506.493] (-506.194) (-503.738) * (-505.376) (-504.892) [-502.843] (-504.736) -- 0:00:26

      Average standard deviation of split frequencies: 0.008903

      560500 -- [-505.486] (-502.778) (-508.125) (-506.056) * (-502.635) (-510.584) [-503.447] (-505.798) -- 0:00:26
      561000 -- (-506.111) [-503.225] (-503.854) (-502.937) * [-503.197] (-508.653) (-504.636) (-503.665) -- 0:00:26
      561500 -- (-505.373) (-503.724) (-506.812) [-503.053] * (-502.803) [-503.174] (-512.862) (-503.699) -- 0:00:26
      562000 -- (-502.022) (-506.354) [-504.469] (-503.489) * (-505.503) (-506.870) [-503.723] (-504.562) -- 0:00:27
      562500 -- (-504.082) [-505.947] (-504.972) (-503.619) * (-504.256) (-507.729) (-503.196) [-503.617] -- 0:00:27
      563000 -- (-504.815) (-502.731) (-503.151) [-502.627] * (-504.221) [-508.401] (-508.541) (-503.468) -- 0:00:27
      563500 -- [-503.197] (-503.359) (-503.315) (-503.258) * [-506.879] (-505.194) (-504.912) (-505.028) -- 0:00:27
      564000 -- (-506.759) (-507.180) [-505.832] (-503.911) * (-509.325) (-504.577) [-503.436] (-505.199) -- 0:00:27
      564500 -- (-502.249) [-505.893] (-502.865) (-504.062) * [-507.420] (-506.215) (-506.787) (-502.225) -- 0:00:27
      565000 -- (-503.324) (-505.946) [-504.049] (-503.584) * [-503.360] (-504.275) (-503.369) (-503.123) -- 0:00:26

      Average standard deviation of split frequencies: 0.008672

      565500 -- [-505.226] (-505.573) (-504.409) (-503.649) * (-503.908) [-503.306] (-504.108) (-504.065) -- 0:00:26
      566000 -- (-503.833) (-506.441) (-506.243) [-502.877] * [-503.717] (-505.090) (-505.781) (-503.153) -- 0:00:26
      566500 -- (-506.394) (-509.524) (-506.691) [-502.964] * (-503.017) (-505.546) (-506.231) [-504.235] -- 0:00:26
      567000 -- (-505.202) [-503.151] (-505.443) (-504.510) * (-502.570) (-505.144) [-504.580] (-503.623) -- 0:00:26
      567500 -- [-508.785] (-501.927) (-507.766) (-504.171) * [-505.562] (-506.663) (-508.393) (-503.243) -- 0:00:26
      568000 -- [-503.132] (-506.647) (-504.578) (-503.012) * (-503.194) (-506.026) (-504.050) [-503.425] -- 0:00:26
      568500 -- (-504.871) [-503.618] (-509.370) (-507.896) * (-503.940) (-502.815) [-502.501] (-502.809) -- 0:00:26
      569000 -- (-503.125) (-504.355) [-504.968] (-504.077) * (-503.177) [-502.870] (-503.062) (-502.900) -- 0:00:26
      569500 -- [-502.826] (-503.144) (-503.052) (-503.286) * (-505.195) [-502.888] (-506.850) (-502.995) -- 0:00:26
      570000 -- (-503.822) [-504.694] (-506.098) (-505.238) * (-507.029) [-502.890] (-503.313) (-503.757) -- 0:00:26

      Average standard deviation of split frequencies: 0.009087

      570500 -- (-508.249) [-502.184] (-504.339) (-504.190) * (-504.419) [-504.096] (-503.381) (-504.972) -- 0:00:26
      571000 -- (-508.112) (-502.413) (-502.997) [-502.290] * [-506.798] (-502.894) (-507.527) (-503.430) -- 0:00:26
      571500 -- (-506.277) (-503.161) (-502.542) [-503.671] * (-505.888) (-505.178) [-504.136] (-503.042) -- 0:00:26
      572000 -- (-505.226) (-503.919) (-503.754) [-503.209] * (-503.276) [-502.590] (-503.849) (-502.508) -- 0:00:26
      572500 -- (-504.084) (-504.365) (-503.781) [-502.516] * (-506.073) (-503.936) (-505.408) [-503.342] -- 0:00:26
      573000 -- (-504.645) (-502.385) (-503.909) [-503.026] * (-504.309) [-504.636] (-503.356) (-504.058) -- 0:00:26
      573500 -- [-504.002] (-503.444) (-505.643) (-502.408) * [-502.946] (-504.180) (-504.276) (-503.432) -- 0:00:26
      574000 -- [-511.113] (-506.033) (-504.613) (-507.861) * (-506.641) (-504.719) (-505.337) [-503.065] -- 0:00:25
      574500 -- [-504.433] (-505.073) (-505.667) (-504.089) * (-502.812) (-504.872) [-503.443] (-502.851) -- 0:00:25
      575000 -- (-503.924) [-503.475] (-506.187) (-504.447) * [-502.764] (-503.015) (-502.753) (-505.695) -- 0:00:25

      Average standard deviation of split frequencies: 0.008088

      575500 -- (-505.867) (-502.995) [-503.078] (-504.939) * (-507.890) (-504.636) (-506.638) [-505.398] -- 0:00:25
      576000 -- (-504.180) (-502.625) (-505.106) [-508.251] * [-504.194] (-504.102) (-505.297) (-505.124) -- 0:00:25
      576500 -- [-504.095] (-503.089) (-502.745) (-506.826) * (-505.535) [-503.982] (-505.358) (-503.239) -- 0:00:25
      577000 -- (-502.946) (-506.635) [-503.074] (-507.522) * (-502.705) (-505.746) (-505.694) [-502.791] -- 0:00:25
      577500 -- (-502.200) (-504.308) (-507.637) [-506.663] * (-504.783) (-505.491) (-503.183) [-505.210] -- 0:00:26
      578000 -- (-504.260) (-504.464) [-503.763] (-504.710) * (-506.894) (-505.332) (-505.943) [-504.049] -- 0:00:26
      578500 -- (-509.644) (-504.399) [-505.083] (-502.488) * (-502.634) (-502.692) [-505.860] (-503.064) -- 0:00:26
      579000 -- (-505.710) (-505.955) (-503.282) [-505.006] * (-505.281) [-505.145] (-507.450) (-503.624) -- 0:00:26
      579500 -- (-504.202) (-504.901) [-508.361] (-510.565) * (-503.195) (-503.688) [-507.701] (-505.587) -- 0:00:26
      580000 -- (-503.302) (-502.969) [-503.614] (-509.954) * (-505.407) (-506.696) (-504.103) [-505.844] -- 0:00:26

      Average standard deviation of split frequencies: 0.008524

      580500 -- [-505.621] (-502.910) (-502.158) (-507.336) * (-504.944) (-505.626) (-502.632) [-506.085] -- 0:00:26
      581000 -- (-506.008) (-503.481) [-503.891] (-508.144) * (-504.179) (-504.858) (-504.075) [-506.381] -- 0:00:25
      581500 -- (-507.234) (-503.405) (-507.229) [-503.785] * (-506.101) (-506.500) [-503.160] (-505.597) -- 0:00:25
      582000 -- (-506.201) (-503.675) (-503.252) [-503.117] * [-507.093] (-504.115) (-503.329) (-503.050) -- 0:00:25
      582500 -- (-503.348) (-505.563) [-503.994] (-503.380) * (-504.757) (-506.325) [-504.631] (-506.610) -- 0:00:25
      583000 -- (-505.761) (-506.610) (-505.664) [-503.167] * (-502.807) (-504.558) (-502.540) [-504.292] -- 0:00:25
      583500 -- (-503.604) [-503.154] (-506.171) (-507.486) * [-506.951] (-502.242) (-507.201) (-502.913) -- 0:00:25
      584000 -- [-505.812] (-504.248) (-506.952) (-505.292) * (-505.863) [-503.825] (-510.429) (-502.905) -- 0:00:25
      584500 -- (-503.609) (-504.969) (-505.726) [-503.828] * (-507.236) (-505.332) (-505.647) [-503.157] -- 0:00:25
      585000 -- (-502.806) (-506.836) (-504.205) [-504.612] * (-507.128) (-502.968) [-502.209] (-504.199) -- 0:00:25

      Average standard deviation of split frequencies: 0.008281

      585500 -- (-505.318) [-503.174] (-503.821) (-503.444) * (-502.873) (-503.639) [-503.951] (-506.316) -- 0:00:25
      586000 -- [-504.786] (-503.615) (-504.959) (-503.165) * (-502.614) (-503.680) [-504.131] (-505.815) -- 0:00:25
      586500 -- (-502.533) (-506.784) [-503.193] (-502.177) * [-505.885] (-505.416) (-504.039) (-503.680) -- 0:00:25
      587000 -- (-507.602) [-505.006] (-504.151) (-503.327) * (-505.527) (-508.106) [-507.569] (-502.277) -- 0:00:25
      587500 -- (-505.193) (-504.702) [-504.178] (-503.021) * (-505.224) [-503.564] (-504.243) (-503.965) -- 0:00:25
      588000 -- (-505.166) (-503.649) (-503.884) [-505.007] * (-503.345) [-503.602] (-505.117) (-503.964) -- 0:00:25
      588500 -- (-506.986) [-503.123] (-508.161) (-503.299) * [-504.296] (-503.967) (-508.786) (-503.944) -- 0:00:25
      589000 -- (-507.013) (-503.122) (-504.683) [-506.966] * [-503.996] (-509.479) (-505.781) (-504.301) -- 0:00:25
      589500 -- (-502.777) (-504.603) [-504.552] (-505.716) * (-504.959) (-504.961) [-505.421] (-505.514) -- 0:00:25
      590000 -- (-506.706) (-511.640) (-504.891) [-505.001] * (-504.262) (-505.118) (-506.203) [-508.531] -- 0:00:25

      Average standard deviation of split frequencies: 0.007934

      590500 -- (-505.251) [-504.122] (-505.913) (-509.214) * (-505.546) (-508.545) [-504.991] (-509.962) -- 0:00:24
      591000 -- (-503.557) [-504.461] (-503.836) (-504.873) * (-506.915) [-505.937] (-505.159) (-504.799) -- 0:00:24
      591500 -- (-502.756) (-506.877) (-503.304) [-503.571] * [-504.726] (-504.355) (-503.307) (-502.610) -- 0:00:24
      592000 -- (-504.575) [-503.752] (-503.776) (-502.957) * (-507.372) (-503.562) (-502.075) [-502.828] -- 0:00:24
      592500 -- (-503.308) (-506.623) (-505.462) [-502.654] * [-504.517] (-505.476) (-503.946) (-503.445) -- 0:00:24
      593000 -- (-502.503) (-502.417) [-503.582] (-507.297) * (-504.201) (-503.840) [-505.971] (-504.995) -- 0:00:24
      593500 -- (-504.012) (-502.623) [-507.222] (-502.517) * (-508.196) [-504.834] (-503.226) (-503.469) -- 0:00:24
      594000 -- (-504.780) (-503.806) (-502.516) [-503.282] * (-503.098) (-504.029) (-505.921) [-504.137] -- 0:00:25
      594500 -- (-504.297) (-505.390) [-502.470] (-503.534) * (-503.038) (-503.863) [-503.262] (-502.020) -- 0:00:25
      595000 -- (-504.389) (-503.975) (-505.974) [-503.647] * (-502.235) [-505.881] (-504.933) (-502.392) -- 0:00:25

      Average standard deviation of split frequencies: 0.007677

      595500 -- (-517.898) (-505.514) (-504.244) [-503.374] * (-502.732) (-503.219) [-503.755] (-505.897) -- 0:00:25
      596000 -- (-504.456) (-505.545) (-502.744) [-502.810] * (-503.631) (-504.770) (-502.523) [-504.758] -- 0:00:25
      596500 -- [-503.286] (-502.181) (-503.496) (-502.910) * (-507.383) (-503.968) (-504.260) [-504.912] -- 0:00:25
      597000 -- (-504.388) [-503.258] (-506.149) (-503.238) * (-504.222) (-504.205) [-503.965] (-505.508) -- 0:00:24
      597500 -- (-504.028) [-502.448] (-504.696) (-503.776) * (-503.904) [-505.496] (-507.207) (-502.266) -- 0:00:24
      598000 -- [-503.004] (-502.480) (-502.322) (-506.872) * (-503.522) (-506.068) [-504.681] (-502.485) -- 0:00:24
      598500 -- (-505.225) (-505.021) (-502.894) [-502.484] * (-507.108) (-504.440) (-507.938) [-502.209] -- 0:00:24
      599000 -- (-502.402) (-502.888) [-504.366] (-504.249) * (-505.655) (-506.539) [-506.236] (-503.248) -- 0:00:24
      599500 -- (-504.253) (-506.503) (-507.124) [-504.026] * (-503.275) (-503.942) [-503.242] (-506.381) -- 0:00:24
      600000 -- [-504.094] (-504.370) (-507.281) (-502.693) * (-505.122) (-504.401) [-504.826] (-502.991) -- 0:00:24

      Average standard deviation of split frequencies: 0.007433

      600500 -- (-504.259) (-507.252) (-502.458) [-502.076] * (-503.178) [-504.688] (-504.610) (-505.272) -- 0:00:24
      601000 -- (-503.429) (-503.859) (-504.348) [-502.391] * (-505.287) (-502.520) [-504.817] (-505.736) -- 0:00:24
      601500 -- (-503.653) (-508.076) (-505.096) [-502.684] * (-503.878) (-503.005) (-502.697) [-505.970] -- 0:00:24
      602000 -- (-507.200) (-503.878) (-507.490) [-502.401] * (-506.538) [-502.489] (-502.706) (-507.057) -- 0:00:24
      602500 -- [-504.025] (-504.006) (-503.409) (-502.967) * [-504.281] (-503.100) (-502.901) (-503.430) -- 0:00:24
      603000 -- (-503.454) (-505.034) (-504.989) [-502.299] * (-505.196) (-502.084) [-502.479] (-506.228) -- 0:00:24
      603500 -- (-505.050) (-502.940) (-504.307) [-506.183] * [-504.747] (-503.104) (-504.796) (-506.752) -- 0:00:24
      604000 -- (-502.765) (-507.391) (-502.869) [-504.810] * (-503.634) (-505.818) [-505.696] (-503.643) -- 0:00:24
      604500 -- (-507.595) (-505.625) (-503.068) [-503.247] * (-504.093) (-505.787) (-504.688) [-503.257] -- 0:00:24
      605000 -- [-502.304] (-505.533) (-505.920) (-505.104) * [-504.531] (-508.675) (-506.228) (-503.963) -- 0:00:24

      Average standard deviation of split frequencies: 0.007459

      605500 -- [-502.262] (-504.450) (-502.527) (-503.618) * [-503.223] (-506.014) (-505.958) (-506.014) -- 0:00:24
      606000 -- (-503.337) [-503.434] (-502.881) (-502.617) * (-508.400) (-504.750) (-507.981) [-505.431] -- 0:00:24
      606500 -- (-503.054) (-503.114) [-503.896] (-503.772) * (-504.111) [-503.510] (-506.804) (-504.275) -- 0:00:24
      607000 -- [-503.702] (-506.864) (-504.777) (-506.389) * (-508.759) (-507.898) [-506.854] (-502.612) -- 0:00:23
      607500 -- (-504.716) (-505.464) (-504.950) [-506.770] * (-504.412) (-504.768) [-505.517] (-503.559) -- 0:00:23
      608000 -- [-504.619] (-505.650) (-505.161) (-503.695) * (-504.839) (-505.447) (-504.763) [-503.455] -- 0:00:23
      608500 -- (-504.952) [-505.290] (-507.456) (-503.129) * (-504.795) (-503.500) (-502.837) [-504.412] -- 0:00:23
      609000 -- (-504.957) [-502.631] (-508.921) (-503.872) * (-504.418) (-503.074) [-502.315] (-503.881) -- 0:00:23
      609500 -- (-507.219) [-506.945] (-508.246) (-503.507) * [-503.715] (-504.714) (-504.625) (-507.240) -- 0:00:23
      610000 -- (-504.286) [-503.289] (-504.444) (-504.580) * (-504.870) (-502.930) [-503.729] (-504.150) -- 0:00:23

      Average standard deviation of split frequencies: 0.007311

      610500 -- (-505.976) [-505.310] (-503.832) (-503.753) * [-504.937] (-503.083) (-507.915) (-502.863) -- 0:00:24
      611000 -- (-503.288) (-502.507) (-503.197) [-502.793] * (-505.634) (-503.971) [-503.994] (-502.921) -- 0:00:24
      611500 -- [-503.388] (-504.082) (-502.623) (-505.324) * [-503.258] (-503.295) (-503.406) (-503.598) -- 0:00:24
      612000 -- (-502.001) [-507.127] (-505.835) (-505.956) * [-502.899] (-505.250) (-504.317) (-503.184) -- 0:00:24
      612500 -- [-505.756] (-505.355) (-502.895) (-507.833) * [-504.399] (-505.396) (-508.030) (-504.280) -- 0:00:24
      613000 -- (-504.247) (-504.453) (-504.072) [-506.089] * (-507.853) [-506.066] (-504.288) (-503.054) -- 0:00:23
      613500 -- (-505.029) [-503.114] (-513.107) (-507.461) * (-503.008) (-507.892) [-504.287] (-506.877) -- 0:00:23
      614000 -- (-502.299) [-504.464] (-506.635) (-507.439) * [-502.360] (-506.958) (-506.206) (-503.158) -- 0:00:23
      614500 -- [-503.286] (-502.803) (-503.916) (-504.040) * (-502.393) [-506.957] (-504.743) (-504.742) -- 0:00:23
      615000 -- [-505.621] (-507.188) (-507.623) (-505.874) * (-503.437) (-509.904) (-505.188) [-503.679] -- 0:00:23

      Average standard deviation of split frequencies: 0.007428

      615500 -- (-505.054) [-503.641] (-505.116) (-504.719) * (-504.843) (-505.827) (-505.151) [-503.464] -- 0:00:23
      616000 -- (-507.374) (-503.816) (-505.820) [-504.938] * (-506.767) [-503.035] (-504.736) (-502.681) -- 0:00:23
      616500 -- (-509.712) (-505.795) (-503.193) [-503.420] * (-505.883) (-506.524) (-509.599) [-503.121] -- 0:00:23
      617000 -- (-503.725) (-503.600) [-502.870] (-507.883) * (-503.885) (-509.974) (-514.786) [-504.052] -- 0:00:23
      617500 -- [-503.168] (-504.105) (-503.716) (-507.801) * (-503.188) (-506.559) [-503.468] (-504.848) -- 0:00:23
      618000 -- (-503.828) [-508.982] (-503.994) (-505.948) * (-505.830) [-504.899] (-503.552) (-503.344) -- 0:00:23
      618500 -- (-503.652) (-505.509) [-503.064] (-504.683) * [-504.744] (-504.030) (-503.501) (-503.431) -- 0:00:23
      619000 -- (-504.861) (-506.562) (-504.233) [-504.758] * [-502.872] (-505.661) (-503.853) (-504.904) -- 0:00:23
      619500 -- (-504.610) [-506.214] (-506.238) (-503.749) * (-504.799) [-504.410] (-503.554) (-510.782) -- 0:00:23
      620000 -- [-503.385] (-504.161) (-504.216) (-502.669) * (-511.713) [-506.612] (-510.411) (-502.947) -- 0:00:23

      Average standard deviation of split frequencies: 0.007014

      620500 -- (-504.070) [-503.820] (-502.514) (-503.656) * (-507.015) (-503.200) (-503.797) [-503.338] -- 0:00:23
      621000 -- (-504.527) [-507.277] (-506.924) (-507.068) * (-507.173) (-503.915) (-505.177) [-507.507] -- 0:00:23
      621500 -- (-504.085) (-505.593) (-503.039) [-504.805] * (-505.821) [-502.884] (-511.213) (-503.852) -- 0:00:23
      622000 -- (-505.406) (-504.959) (-503.584) [-503.857] * (-505.948) [-503.733] (-503.217) (-504.963) -- 0:00:23
      622500 -- [-506.841] (-505.318) (-504.771) (-502.604) * (-506.157) [-502.277] (-503.879) (-504.203) -- 0:00:23
      623000 -- (-507.241) (-505.601) [-504.811] (-504.728) * (-502.819) [-504.646] (-504.922) (-502.208) -- 0:00:22
      623500 -- (-506.200) (-503.494) (-505.394) [-506.985] * (-505.235) (-505.578) (-503.980) [-502.840] -- 0:00:22
      624000 -- (-505.620) (-503.752) [-503.513] (-504.335) * (-502.934) [-503.656] (-502.785) (-503.207) -- 0:00:22
      624500 -- [-503.523] (-506.555) (-502.501) (-505.778) * (-502.858) [-503.256] (-507.907) (-505.531) -- 0:00:22
      625000 -- (-503.334) (-502.254) (-506.229) [-502.613] * [-504.600] (-504.702) (-504.454) (-510.364) -- 0:00:22

      Average standard deviation of split frequencies: 0.007442

      625500 -- [-502.585] (-502.388) (-506.397) (-503.949) * (-503.270) (-503.301) (-504.758) [-502.667] -- 0:00:22
      626000 -- (-503.256) (-503.675) (-504.060) [-502.790] * [-502.917] (-503.049) (-506.611) (-503.657) -- 0:00:22
      626500 -- (-504.160) (-505.964) [-504.030] (-503.036) * (-505.633) [-503.102] (-507.237) (-507.787) -- 0:00:23
      627000 -- (-505.030) [-505.503] (-504.432) (-504.179) * (-509.493) (-503.032) [-509.026] (-503.976) -- 0:00:23
      627500 -- (-504.931) (-504.371) [-507.147] (-503.088) * [-504.201] (-503.006) (-510.592) (-506.340) -- 0:00:23
      628000 -- (-504.589) (-506.994) [-509.552] (-504.619) * [-502.586] (-503.892) (-503.913) (-503.604) -- 0:00:23
      628500 -- [-504.977] (-507.162) (-503.587) (-502.744) * [-503.034] (-503.479) (-511.217) (-506.466) -- 0:00:23
      629000 -- (-509.107) [-506.076] (-506.065) (-502.551) * [-504.540] (-505.109) (-505.198) (-506.085) -- 0:00:23
      629500 -- (-503.850) [-501.964] (-504.731) (-504.283) * (-507.135) [-504.874] (-503.641) (-504.129) -- 0:00:22
      630000 -- (-502.895) (-502.129) (-502.680) [-503.307] * [-506.352] (-507.792) (-506.160) (-507.322) -- 0:00:22

      Average standard deviation of split frequencies: 0.007343

      630500 -- (-503.751) (-503.703) [-503.163] (-502.276) * (-503.847) [-503.978] (-511.638) (-505.430) -- 0:00:22
      631000 -- (-504.333) (-504.847) [-503.373] (-506.068) * (-505.633) (-506.252) [-508.866] (-507.093) -- 0:00:22
      631500 -- (-504.276) [-502.118] (-503.112) (-502.579) * (-504.306) (-505.811) (-508.222) [-502.225] -- 0:00:22
      632000 -- [-502.777] (-503.933) (-504.637) (-504.825) * (-506.122) (-505.326) (-504.779) [-504.261] -- 0:00:22
      632500 -- (-502.427) [-505.132] (-505.196) (-503.044) * (-503.183) (-502.978) (-510.019) [-503.508] -- 0:00:22
      633000 -- (-503.979) (-503.886) (-505.020) [-505.299] * (-503.589) (-508.411) [-503.611] (-502.544) -- 0:00:22
      633500 -- (-504.053) (-503.556) [-503.535] (-503.936) * (-502.798) (-504.940) (-504.430) [-507.853] -- 0:00:22
      634000 -- [-503.817] (-507.600) (-503.737) (-503.017) * [-503.359] (-502.565) (-506.726) (-507.189) -- 0:00:22
      634500 -- (-509.031) [-504.325] (-510.524) (-504.534) * [-503.824] (-506.047) (-507.590) (-502.997) -- 0:00:22
      635000 -- [-505.934] (-504.588) (-504.014) (-506.683) * (-506.208) (-507.944) (-502.728) [-502.326] -- 0:00:22

      Average standard deviation of split frequencies: 0.007935

      635500 -- (-505.182) (-504.583) (-504.435) [-504.815] * (-503.211) (-504.842) (-503.882) [-503.782] -- 0:00:22
      636000 -- (-507.216) (-504.374) (-504.790) [-503.711] * (-509.239) [-505.715] (-504.127) (-507.129) -- 0:00:22
      636500 -- [-503.943] (-504.145) (-504.432) (-506.007) * (-506.376) (-508.331) [-505.259] (-502.138) -- 0:00:22
      637000 -- [-503.674] (-503.957) (-503.107) (-502.420) * (-504.153) [-505.959] (-503.739) (-504.060) -- 0:00:22
      637500 -- (-504.440) (-503.336) (-503.167) [-502.128] * [-504.021] (-504.855) (-504.615) (-504.250) -- 0:00:22
      638000 -- (-503.846) (-506.158) (-503.305) [-504.081] * (-503.264) (-509.190) (-503.153) [-503.657] -- 0:00:22
      638500 -- (-505.832) (-504.712) (-506.838) [-503.131] * (-502.576) (-507.134) (-505.944) [-505.034] -- 0:00:22
      639000 -- (-504.739) (-505.001) (-506.046) [-503.909] * (-503.485) [-506.668] (-503.838) (-503.350) -- 0:00:22
      639500 -- (-502.764) (-504.314) [-503.448] (-507.654) * (-505.043) (-502.984) (-503.660) [-503.222] -- 0:00:21
      640000 -- (-502.459) (-508.445) [-503.664] (-505.807) * [-505.245] (-509.133) (-503.831) (-504.474) -- 0:00:21

      Average standard deviation of split frequencies: 0.007661

      640500 -- (-506.289) (-505.021) (-503.535) [-504.043] * (-503.368) (-507.158) (-502.856) [-507.486] -- 0:00:21
      641000 -- (-508.149) (-502.873) [-502.648] (-503.341) * (-503.379) (-506.405) (-504.624) [-503.279] -- 0:00:21
      641500 -- (-506.462) (-504.687) [-503.635] (-503.155) * [-503.787] (-505.884) (-505.827) (-502.495) -- 0:00:21
      642000 -- [-507.351] (-503.031) (-505.247) (-504.840) * (-502.856) [-505.012] (-507.921) (-504.166) -- 0:00:21
      642500 -- (-505.015) [-505.861] (-504.819) (-504.881) * [-505.663] (-503.813) (-507.443) (-502.999) -- 0:00:22
      643000 -- (-504.015) [-507.397] (-504.670) (-506.915) * [-502.940] (-507.078) (-509.062) (-503.123) -- 0:00:22
      643500 -- (-504.743) (-507.957) (-505.092) [-505.955] * (-503.116) (-503.680) (-506.327) [-503.762] -- 0:00:22
      644000 -- (-507.801) (-504.976) [-504.771] (-503.948) * (-505.076) (-507.794) (-503.409) [-504.078] -- 0:00:22
      644500 -- (-502.214) [-504.140] (-504.446) (-504.179) * (-504.856) (-507.720) (-503.333) [-503.226] -- 0:00:22
      645000 -- (-504.479) (-507.014) (-505.323) [-503.719] * (-508.717) [-507.988] (-504.095) (-502.705) -- 0:00:22

      Average standard deviation of split frequencies: 0.007898

      645500 -- [-502.721] (-509.647) (-504.849) (-509.016) * (-502.911) (-509.265) (-505.475) [-503.105] -- 0:00:21
      646000 -- (-503.811) [-502.394] (-502.630) (-511.513) * [-502.858] (-503.050) (-505.066) (-506.745) -- 0:00:21
      646500 -- (-501.955) (-508.766) [-503.875] (-505.968) * [-503.328] (-504.881) (-505.132) (-506.043) -- 0:00:21
      647000 -- (-505.747) [-504.471] (-504.731) (-505.912) * [-504.331] (-507.747) (-506.775) (-504.027) -- 0:00:21
      647500 -- (-503.140) [-503.184] (-507.365) (-506.872) * (-504.500) [-507.131] (-504.060) (-504.471) -- 0:00:21
      648000 -- (-506.848) (-505.744) (-504.705) [-503.659] * (-505.649) (-502.463) (-502.815) [-502.553] -- 0:00:21
      648500 -- (-504.371) (-504.270) [-504.451] (-506.062) * (-506.120) [-502.762] (-505.143) (-502.780) -- 0:00:21
      649000 -- (-506.142) [-506.755] (-504.162) (-507.166) * (-502.874) (-504.952) [-504.205] (-504.281) -- 0:00:21
      649500 -- (-504.191) (-503.560) [-502.627] (-502.488) * (-504.164) (-503.681) (-505.937) [-503.814] -- 0:00:21
      650000 -- [-503.890] (-505.241) (-507.458) (-507.254) * (-509.431) (-503.050) [-508.444] (-502.354) -- 0:00:21

      Average standard deviation of split frequencies: 0.007501

      650500 -- [-510.501] (-508.497) (-504.050) (-505.724) * (-504.650) (-505.132) [-504.915] (-503.265) -- 0:00:21
      651000 -- (-502.414) [-504.795] (-505.560) (-504.521) * (-505.364) (-505.794) [-506.443] (-503.976) -- 0:00:21
      651500 -- [-502.611] (-503.636) (-507.416) (-506.866) * (-505.167) (-505.639) (-502.800) [-502.203] -- 0:00:21
      652000 -- (-503.072) (-504.489) (-504.909) [-504.127] * (-504.468) (-509.096) (-506.014) [-503.325] -- 0:00:21
      652500 -- (-505.416) (-504.925) [-503.889] (-506.969) * (-505.142) (-511.210) [-506.723] (-503.987) -- 0:00:21
      653000 -- (-508.363) [-503.344] (-503.399) (-503.683) * [-503.789] (-509.144) (-508.170) (-506.551) -- 0:00:21
      653500 -- [-505.702] (-503.552) (-502.888) (-505.052) * (-506.507) [-504.255] (-508.255) (-511.025) -- 0:00:21
      654000 -- (-504.616) (-503.925) [-502.809] (-505.399) * (-503.162) (-504.603) [-504.969] (-503.450) -- 0:00:21
      654500 -- (-514.807) (-505.430) [-503.735] (-507.541) * (-506.675) (-504.266) (-506.358) [-502.165] -- 0:00:21
      655000 -- (-505.226) [-502.367] (-502.528) (-502.845) * (-504.435) (-507.353) [-505.764] (-506.948) -- 0:00:21

      Average standard deviation of split frequencies: 0.007693

      655500 -- (-504.277) [-502.362] (-506.628) (-505.092) * (-503.240) (-506.912) [-505.258] (-505.068) -- 0:00:21
      656000 -- [-504.352] (-502.683) (-504.530) (-504.336) * (-503.069) (-503.083) (-509.192) [-504.157] -- 0:00:20
      656500 -- (-503.346) (-503.302) (-504.098) [-504.003] * (-507.296) [-503.068] (-503.585) (-505.096) -- 0:00:20
      657000 -- (-511.107) [-502.654] (-508.690) (-503.758) * (-502.959) [-504.365] (-508.637) (-503.585) -- 0:00:20
      657500 -- (-502.156) (-503.554) (-506.279) [-503.125] * (-503.190) [-504.364] (-508.478) (-503.934) -- 0:00:20
      658000 -- [-502.364] (-506.046) (-503.244) (-503.435) * (-505.714) (-504.736) (-506.288) [-505.816] -- 0:00:20
      658500 -- (-503.280) (-507.894) (-502.870) [-504.206] * [-503.063] (-507.604) (-503.165) (-505.721) -- 0:00:20
      659000 -- (-503.200) (-507.630) [-505.367] (-505.423) * (-503.893) (-506.749) (-504.523) [-502.933] -- 0:00:20
      659500 -- (-505.570) (-503.814) [-503.928] (-506.186) * [-504.867] (-507.342) (-503.218) (-507.992) -- 0:00:21
      660000 -- [-505.085] (-502.688) (-503.682) (-504.077) * (-503.861) (-504.133) (-502.687) [-504.753] -- 0:00:21

      Average standard deviation of split frequencies: 0.007471

      660500 -- (-504.552) (-502.751) [-502.046] (-503.664) * [-503.437] (-503.819) (-504.290) (-503.259) -- 0:00:21
      661000 -- [-502.910] (-507.371) (-504.752) (-503.703) * [-504.945] (-504.652) (-504.424) (-503.982) -- 0:00:21
      661500 -- [-502.105] (-503.372) (-507.078) (-503.379) * (-504.957) (-505.654) (-506.098) [-506.669] -- 0:00:20
      662000 -- [-503.438] (-505.479) (-504.397) (-505.674) * (-503.987) (-505.335) (-504.459) [-504.228] -- 0:00:20
      662500 -- (-504.284) [-506.024] (-505.336) (-506.962) * (-507.358) [-503.469] (-504.818) (-504.932) -- 0:00:20
      663000 -- (-505.839) (-504.492) (-505.845) [-503.795] * (-503.786) (-508.005) [-505.479] (-505.010) -- 0:00:20
      663500 -- [-504.210] (-503.451) (-504.543) (-504.549) * [-506.796] (-504.098) (-503.377) (-506.222) -- 0:00:20
      664000 -- (-505.602) (-503.699) [-504.367] (-510.323) * [-503.200] (-511.076) (-506.115) (-505.140) -- 0:00:20
      664500 -- [-503.567] (-504.942) (-504.977) (-507.036) * (-503.735) (-510.541) (-503.181) [-503.707] -- 0:00:20
      665000 -- [-504.325] (-505.336) (-506.884) (-504.227) * [-502.789] (-506.756) (-502.990) (-503.802) -- 0:00:20

      Average standard deviation of split frequencies: 0.007495

      665500 -- (-507.133) (-502.317) [-502.598] (-504.950) * [-503.377] (-507.710) (-503.396) (-505.668) -- 0:00:20
      666000 -- (-503.847) [-504.156] (-502.898) (-503.792) * (-505.223) (-504.868) (-502.802) [-503.839] -- 0:00:20
      666500 -- [-503.246] (-506.103) (-505.255) (-503.732) * [-503.685] (-507.605) (-504.512) (-503.451) -- 0:00:20
      667000 -- (-504.504) [-504.347] (-503.155) (-502.839) * (-502.927) (-507.659) (-504.830) [-504.640] -- 0:00:20
      667500 -- (-509.750) (-505.948) [-502.403] (-502.940) * (-504.660) (-506.765) (-510.517) [-502.508] -- 0:00:20
      668000 -- (-506.510) (-507.204) [-505.540] (-502.323) * (-506.183) (-507.104) [-504.463] (-503.434) -- 0:00:20
      668500 -- (-503.417) (-509.461) [-504.766] (-502.991) * (-509.137) (-504.200) [-507.214] (-504.149) -- 0:00:20
      669000 -- (-504.545) [-506.612] (-506.912) (-503.969) * (-505.420) [-503.380] (-505.302) (-505.204) -- 0:00:20
      669500 -- (-508.315) (-504.868) (-503.704) [-504.409] * [-505.473] (-504.739) (-504.034) (-503.449) -- 0:00:20
      670000 -- (-505.083) [-503.667] (-504.663) (-505.844) * (-503.070) [-503.865] (-503.682) (-505.809) -- 0:00:20

      Average standard deviation of split frequencies: 0.007608

      670500 -- [-504.508] (-507.060) (-503.529) (-505.916) * (-503.326) (-504.842) (-503.656) [-506.700] -- 0:00:20
      671000 -- (-504.742) (-506.062) (-504.165) [-505.542] * (-505.588) (-505.625) [-502.780] (-505.026) -- 0:00:20
      671500 -- (-502.529) (-503.989) [-503.482] (-508.342) * (-508.872) (-508.588) [-504.149] (-503.752) -- 0:00:20
      672000 -- (-505.961) (-503.374) [-502.240] (-503.942) * [-504.026] (-505.456) (-503.623) (-503.637) -- 0:00:20
      672500 -- (-505.675) (-503.910) (-502.732) [-503.694] * (-510.153) (-506.228) (-508.508) [-503.647] -- 0:00:19
      673000 -- (-505.409) (-508.072) [-503.535] (-504.064) * (-503.374) [-507.242] (-504.693) (-503.399) -- 0:00:19
      673500 -- (-506.437) [-502.764] (-503.459) (-504.003) * (-505.879) (-502.476) (-504.000) [-505.059] -- 0:00:19
      674000 -- (-507.646) (-504.308) [-503.826] (-502.892) * (-505.933) (-504.767) (-505.596) [-504.211] -- 0:00:19
      674500 -- (-507.006) [-506.101] (-504.329) (-513.810) * (-502.847) (-505.344) (-504.155) [-506.475] -- 0:00:19
      675000 -- (-505.652) [-505.710] (-504.941) (-506.567) * [-503.852] (-504.471) (-502.555) (-506.047) -- 0:00:19

      Average standard deviation of split frequencies: 0.007548

      675500 -- (-507.612) [-507.424] (-505.961) (-502.448) * (-504.176) (-504.028) (-502.898) [-507.329] -- 0:00:20
      676000 -- (-503.440) (-505.537) (-507.274) [-503.052] * (-503.510) (-505.716) [-502.076] (-504.587) -- 0:00:20
      676500 -- (-504.671) [-504.103] (-503.568) (-504.726) * (-503.273) [-504.138] (-503.908) (-506.908) -- 0:00:20
      677000 -- (-502.631) (-506.395) (-505.624) [-503.156] * (-505.824) [-505.977] (-505.318) (-504.265) -- 0:00:20
      677500 -- (-504.210) (-503.869) (-503.866) [-502.463] * (-508.618) (-508.730) [-503.017] (-503.902) -- 0:00:19
      678000 -- (-504.483) [-502.504] (-508.494) (-502.595) * (-502.955) [-505.258] (-503.017) (-503.469) -- 0:00:19
      678500 -- (-503.808) (-505.171) (-508.635) [-503.818] * (-504.056) (-508.400) [-503.314] (-502.663) -- 0:00:19
      679000 -- [-503.137] (-502.892) (-504.588) (-508.664) * (-502.773) (-505.935) [-502.171] (-502.710) -- 0:00:19
      679500 -- (-502.839) (-502.362) [-504.439] (-506.026) * (-503.694) [-504.693] (-502.200) (-504.384) -- 0:00:19
      680000 -- (-502.956) [-503.368] (-504.272) (-506.006) * (-504.725) (-503.391) (-503.353) [-502.557] -- 0:00:19

      Average standard deviation of split frequencies: 0.007292

      680500 -- (-504.659) [-505.498] (-504.165) (-518.423) * (-508.569) (-502.695) (-503.341) [-503.851] -- 0:00:19
      681000 -- [-505.605] (-503.091) (-504.667) (-505.763) * (-508.193) [-503.465] (-505.900) (-505.077) -- 0:00:19
      681500 -- (-505.174) (-505.306) [-502.415] (-504.830) * (-508.154) (-504.300) (-505.752) [-504.087] -- 0:00:19
      682000 -- [-505.868] (-504.289) (-505.346) (-506.499) * (-503.576) [-507.530] (-503.214) (-503.886) -- 0:00:19
      682500 -- (-506.895) [-504.653] (-504.454) (-505.418) * (-505.007) (-504.109) [-505.227] (-507.564) -- 0:00:19
      683000 -- (-504.505) (-504.030) [-504.267] (-505.075) * [-504.191] (-502.539) (-503.757) (-505.353) -- 0:00:19
      683500 -- (-503.748) (-504.031) (-505.825) [-507.211] * (-504.493) (-503.169) [-504.485] (-505.351) -- 0:00:19
      684000 -- (-505.506) (-503.538) (-508.707) [-503.722] * [-504.442] (-503.158) (-502.121) (-505.178) -- 0:00:19
      684500 -- (-503.715) [-503.319] (-505.407) (-503.260) * [-502.184] (-503.118) (-503.208) (-508.589) -- 0:00:19
      685000 -- (-507.699) (-504.572) (-505.449) [-502.477] * (-505.263) (-502.614) (-503.586) [-508.025] -- 0:00:19

      Average standard deviation of split frequencies: 0.007074

      685500 -- (-509.296) [-503.862] (-504.259) (-503.192) * (-503.024) [-504.969] (-504.520) (-503.068) -- 0:00:19
      686000 -- [-505.068] (-505.745) (-504.725) (-503.943) * (-503.625) [-502.857] (-503.934) (-503.096) -- 0:00:19
      686500 -- (-503.859) [-503.274] (-502.966) (-505.971) * (-502.670) (-503.508) [-503.776] (-505.141) -- 0:00:19
      687000 -- [-504.203] (-503.864) (-505.601) (-505.448) * (-505.506) (-508.389) (-502.962) [-503.767] -- 0:00:19
      687500 -- (-505.184) [-503.659] (-503.906) (-503.965) * (-503.545) [-503.246] (-505.238) (-505.687) -- 0:00:19
      688000 -- (-505.477) (-506.421) (-505.536) [-503.862] * (-504.783) (-504.103) [-505.712] (-504.260) -- 0:00:19
      688500 -- [-502.998] (-505.175) (-502.696) (-504.887) * (-504.048) [-504.295] (-503.354) (-504.817) -- 0:00:19
      689000 -- [-505.982] (-504.499) (-506.310) (-503.796) * (-507.071) (-504.873) (-504.838) [-503.739] -- 0:00:18
      689500 -- [-504.322] (-504.169) (-502.761) (-509.939) * (-506.205) (-503.261) (-504.202) [-504.276] -- 0:00:18
      690000 -- (-504.725) [-508.758] (-504.013) (-509.238) * (-506.332) [-504.098] (-512.658) (-503.796) -- 0:00:18

      Average standard deviation of split frequencies: 0.007147

      690500 -- (-503.203) (-505.660) [-506.339] (-506.933) * (-505.829) (-504.897) (-505.152) [-503.116] -- 0:00:18
      691000 -- [-503.345] (-503.824) (-507.195) (-504.441) * [-502.898] (-506.745) (-504.639) (-507.696) -- 0:00:18
      691500 -- (-504.274) (-506.460) (-505.810) [-505.918] * (-504.586) [-505.057] (-503.164) (-505.208) -- 0:00:18
      692000 -- (-504.824) (-505.861) [-507.351] (-506.629) * (-506.584) [-505.205] (-506.387) (-502.166) -- 0:00:18
      692500 -- (-508.922) (-504.586) [-504.737] (-505.571) * [-505.815] (-506.999) (-508.188) (-502.022) -- 0:00:19
      693000 -- (-503.208) (-503.618) (-503.731) [-503.806] * [-506.261] (-503.384) (-506.157) (-505.434) -- 0:00:19
      693500 -- [-508.418] (-503.214) (-506.533) (-505.689) * (-505.632) (-503.920) [-506.160] (-504.957) -- 0:00:19
      694000 -- (-503.107) (-506.356) [-503.222] (-505.154) * (-506.125) (-504.420) [-502.918] (-502.336) -- 0:00:18
      694500 -- (-507.901) (-505.247) [-503.409] (-502.855) * (-509.332) (-504.867) [-503.952] (-504.809) -- 0:00:18
      695000 -- [-504.786] (-502.708) (-505.497) (-503.552) * (-507.513) (-504.929) [-505.188] (-507.310) -- 0:00:18

      Average standard deviation of split frequencies: 0.007450

      695500 -- [-504.075] (-502.751) (-506.195) (-507.279) * (-503.353) (-503.532) [-503.386] (-507.700) -- 0:00:18
      696000 -- (-503.722) [-503.632] (-502.845) (-504.490) * (-506.918) (-505.328) (-504.123) [-503.937] -- 0:00:18
      696500 -- (-505.863) (-510.178) [-504.839] (-503.700) * (-503.476) (-503.255) [-503.923] (-504.804) -- 0:00:18
      697000 -- (-505.963) [-503.421] (-504.629) (-503.441) * (-505.618) (-503.645) (-503.940) [-504.082] -- 0:00:18
      697500 -- (-503.219) (-504.226) (-505.051) [-505.456] * [-508.337] (-502.897) (-502.784) (-506.277) -- 0:00:18
      698000 -- (-503.430) (-503.436) (-503.327) [-503.353] * (-502.854) (-503.144) (-505.796) [-508.191] -- 0:00:18
      698500 -- (-502.648) (-503.222) [-505.573] (-503.882) * (-503.197) [-503.979] (-506.611) (-505.873) -- 0:00:18
      699000 -- (-502.170) (-505.700) (-504.494) [-503.421] * (-504.990) (-506.218) [-505.505] (-505.202) -- 0:00:18
      699500 -- (-504.222) [-507.831] (-503.070) (-503.253) * (-503.932) [-504.990] (-503.603) (-503.928) -- 0:00:18
      700000 -- (-503.020) [-504.184] (-503.900) (-506.363) * (-503.484) [-503.531] (-503.350) (-503.776) -- 0:00:18

      Average standard deviation of split frequencies: 0.006644

      700500 -- (-502.779) (-503.963) (-508.441) [-507.964] * (-503.466) (-503.340) (-505.955) [-505.379] -- 0:00:18
      701000 -- (-502.901) (-505.889) (-506.344) [-504.602] * (-504.240) (-509.841) [-506.744] (-503.577) -- 0:00:18
      701500 -- (-504.387) (-503.355) [-507.071] (-504.722) * (-503.899) (-508.304) (-503.273) [-504.047] -- 0:00:18
      702000 -- [-502.909] (-503.054) (-505.654) (-505.474) * [-505.492] (-504.919) (-504.378) (-502.007) -- 0:00:18
      702500 -- (-503.775) (-504.379) (-507.896) [-505.285] * (-504.380) (-503.312) [-504.253] (-505.327) -- 0:00:18
      703000 -- (-507.783) [-502.489] (-506.240) (-505.444) * (-503.830) (-505.543) [-503.234] (-504.083) -- 0:00:18
      703500 -- (-509.782) (-502.138) [-506.317] (-505.726) * (-503.639) (-506.664) [-503.449] (-505.353) -- 0:00:18
      704000 -- (-507.290) [-502.138] (-503.894) (-503.640) * (-504.730) [-504.138] (-502.587) (-503.616) -- 0:00:18
      704500 -- (-506.473) (-502.505) (-506.060) [-502.372] * (-502.419) (-502.407) (-506.597) [-506.135] -- 0:00:18
      705000 -- (-505.728) (-505.399) [-504.675] (-505.092) * (-504.397) [-503.390] (-507.844) (-505.000) -- 0:00:17

      Average standard deviation of split frequencies: 0.006913

      705500 -- (-506.313) [-505.191] (-504.081) (-506.190) * [-504.719] (-504.130) (-504.267) (-503.486) -- 0:00:17
      706000 -- [-502.828] (-506.334) (-506.286) (-505.076) * [-505.994] (-502.423) (-504.652) (-504.135) -- 0:00:17
      706500 -- [-505.299] (-504.596) (-503.803) (-502.385) * (-509.304) (-505.348) [-505.487] (-502.963) -- 0:00:17
      707000 -- (-505.346) [-505.356] (-502.080) (-502.429) * (-504.996) (-507.094) [-502.825] (-503.439) -- 0:00:17
      707500 -- (-507.267) [-503.541] (-506.775) (-502.590) * (-503.973) (-502.107) [-505.528] (-510.854) -- 0:00:17
      708000 -- (-506.680) (-504.711) (-505.927) [-505.338] * [-504.738] (-502.932) (-504.808) (-503.902) -- 0:00:17
      708500 -- (-506.082) [-502.752] (-504.433) (-505.223) * (-503.932) (-502.967) [-505.277] (-507.201) -- 0:00:17
      709000 -- [-504.275] (-502.342) (-504.076) (-503.573) * (-513.615) [-507.243] (-504.872) (-504.861) -- 0:00:18
      709500 -- (-505.464) (-502.616) [-502.854] (-503.288) * (-509.934) (-510.146) [-503.164] (-506.665) -- 0:00:18
      710000 -- [-504.803] (-503.722) (-506.413) (-503.176) * (-508.330) [-505.348] (-502.907) (-507.386) -- 0:00:17

      Average standard deviation of split frequencies: 0.006716

      710500 -- [-506.077] (-503.473) (-506.530) (-506.814) * (-508.922) (-503.722) (-504.323) [-505.189] -- 0:00:17
      711000 -- (-504.773) [-503.999] (-503.750) (-504.495) * (-508.005) [-502.519] (-503.428) (-504.928) -- 0:00:17
      711500 -- (-504.223) (-504.891) (-503.890) [-504.186] * (-505.071) (-502.878) (-503.197) [-503.268] -- 0:00:17
      712000 -- (-503.794) [-503.644] (-505.896) (-503.757) * (-507.446) (-505.735) [-504.506] (-503.480) -- 0:00:17
      712500 -- (-506.334) (-503.942) (-504.166) [-506.155] * (-505.701) [-503.147] (-503.652) (-505.177) -- 0:00:17
      713000 -- (-505.933) [-504.300] (-505.862) (-503.204) * [-503.714] (-502.817) (-505.432) (-503.610) -- 0:00:17
      713500 -- (-505.810) (-502.750) (-503.800) [-503.421] * (-506.173) (-503.126) (-504.006) [-503.447] -- 0:00:17
      714000 -- (-505.759) (-503.586) [-503.671] (-503.448) * (-503.168) (-503.474) [-504.427] (-506.425) -- 0:00:17
      714500 -- (-507.042) (-505.695) (-504.081) [-503.432] * (-503.152) (-503.033) [-504.587] (-506.912) -- 0:00:17
      715000 -- (-503.396) (-505.937) (-507.119) [-509.043] * (-505.813) (-503.673) (-505.215) [-506.240] -- 0:00:17

      Average standard deviation of split frequencies: 0.007242

      715500 -- [-503.605] (-504.433) (-507.090) (-504.519) * (-506.961) (-503.256) (-503.599) [-507.626] -- 0:00:17
      716000 -- (-507.236) [-503.139] (-504.887) (-503.592) * (-506.907) (-504.500) (-504.401) [-502.983] -- 0:00:17
      716500 -- (-503.613) (-506.334) [-502.784] (-505.320) * (-502.467) (-507.133) [-505.439] (-503.980) -- 0:00:17
      717000 -- [-506.061] (-504.243) (-504.527) (-503.333) * (-505.494) (-505.497) (-504.876) [-505.342] -- 0:00:17
      717500 -- (-502.665) [-502.128] (-505.424) (-504.135) * (-504.181) [-504.065] (-506.419) (-505.731) -- 0:00:17
      718000 -- (-508.591) (-502.597) [-503.874] (-503.430) * (-502.754) [-503.810] (-502.383) (-506.798) -- 0:00:17
      718500 -- (-505.156) (-503.131) [-509.259] (-504.895) * (-504.239) (-503.641) [-502.718] (-503.114) -- 0:00:17
      719000 -- (-505.140) (-506.086) [-503.310] (-503.529) * [-502.662] (-503.096) (-502.548) (-502.641) -- 0:00:17
      719500 -- (-502.577) (-508.408) (-503.231) [-503.440] * (-504.373) (-507.420) [-505.535] (-503.823) -- 0:00:17
      720000 -- (-503.466) [-503.356] (-504.047) (-502.317) * (-510.078) [-503.666] (-504.658) (-504.004) -- 0:00:17

      Average standard deviation of split frequencies: 0.007413

      720500 -- (-505.665) [-506.407] (-503.832) (-505.398) * (-507.342) (-502.968) (-503.178) [-504.705] -- 0:00:17
      721000 -- [-502.297] (-505.580) (-504.864) (-503.229) * [-507.416] (-504.304) (-504.522) (-504.582) -- 0:00:17
      721500 -- (-503.842) (-503.118) (-505.992) [-502.940] * (-507.024) (-502.964) (-506.055) [-504.298] -- 0:00:16
      722000 -- [-503.402] (-503.205) (-507.867) (-506.747) * (-502.982) (-503.612) [-504.597] (-503.109) -- 0:00:16
      722500 -- (-506.001) [-502.672] (-502.499) (-502.639) * (-503.607) (-502.858) (-503.496) [-502.772] -- 0:00:16
      723000 -- (-506.048) (-504.291) [-503.105] (-503.501) * (-507.636) (-504.920) [-503.768] (-503.673) -- 0:00:16
      723500 -- (-503.048) [-502.620] (-503.722) (-505.588) * (-503.809) (-504.135) (-504.147) [-503.598] -- 0:00:16
      724000 -- (-504.218) (-505.535) (-503.544) [-504.589] * (-505.424) (-504.816) (-502.480) [-504.839] -- 0:00:16
      724500 -- (-504.030) (-505.125) [-503.167] (-504.258) * [-503.526] (-506.887) (-507.365) (-504.833) -- 0:00:16
      725000 -- [-505.451] (-504.882) (-504.596) (-504.342) * (-504.346) (-509.584) [-503.471] (-505.016) -- 0:00:16

      Average standard deviation of split frequencies: 0.007359

      725500 -- [-504.928] (-505.331) (-503.401) (-502.492) * (-507.250) [-504.583] (-502.311) (-502.433) -- 0:00:17
      726000 -- (-505.285) [-503.872] (-503.072) (-502.604) * [-503.224] (-502.661) (-503.027) (-505.912) -- 0:00:16
      726500 -- (-504.859) (-508.770) (-504.289) [-504.131] * (-506.148) [-503.997] (-502.672) (-506.596) -- 0:00:16
      727000 -- (-502.622) (-506.741) (-503.241) [-502.114] * (-504.277) (-503.452) [-502.605] (-508.290) -- 0:00:16
      727500 -- (-505.874) (-503.948) (-505.743) [-505.626] * (-503.641) [-503.156] (-504.486) (-508.318) -- 0:00:16
      728000 -- (-503.897) [-504.901] (-505.418) (-504.552) * [-503.607] (-506.189) (-505.990) (-505.012) -- 0:00:16
      728500 -- (-502.562) (-503.428) [-503.631] (-505.207) * [-503.153] (-504.055) (-504.112) (-505.774) -- 0:00:16
      729000 -- (-503.416) (-504.907) [-503.273] (-505.666) * [-505.358] (-506.795) (-504.236) (-506.759) -- 0:00:16
      729500 -- (-505.538) (-502.749) [-505.473] (-510.353) * (-503.916) [-504.394] (-507.586) (-502.974) -- 0:00:16
      730000 -- (-503.412) (-505.504) (-504.914) [-504.625] * [-506.957] (-505.196) (-512.622) (-502.466) -- 0:00:16

      Average standard deviation of split frequencies: 0.007269

      730500 -- (-503.655) (-504.133) (-505.753) [-503.117] * (-503.952) [-505.750] (-503.153) (-502.822) -- 0:00:16
      731000 -- (-505.569) [-502.271] (-505.328) (-504.599) * [-505.162] (-504.718) (-505.141) (-503.923) -- 0:00:16
      731500 -- (-503.532) (-506.575) [-504.373] (-502.604) * (-504.788) [-502.564] (-511.292) (-504.966) -- 0:00:16
      732000 -- (-506.504) (-506.058) (-504.218) [-503.551] * (-505.084) (-505.668) [-502.775] (-508.779) -- 0:00:16
      732500 -- (-502.951) (-506.141) (-505.436) [-503.017] * [-504.381] (-504.960) (-503.047) (-502.815) -- 0:00:16
      733000 -- (-502.993) (-505.770) (-504.291) [-504.022] * [-504.227] (-503.162) (-503.022) (-502.245) -- 0:00:16
      733500 -- [-505.346] (-505.808) (-504.138) (-507.207) * (-507.757) [-504.497] (-504.626) (-504.263) -- 0:00:16
      734000 -- (-504.161) (-505.682) [-503.626] (-503.154) * (-508.969) (-505.530) [-505.046] (-502.277) -- 0:00:16
      734500 -- (-504.044) (-505.769) [-508.541] (-503.986) * [-503.151] (-503.278) (-504.297) (-502.948) -- 0:00:16
      735000 -- (-502.596) (-504.575) (-502.625) [-505.147] * (-503.868) (-502.697) [-502.815] (-505.374) -- 0:00:16

      Average standard deviation of split frequencies: 0.007131

      735500 -- [-505.949] (-504.629) (-503.936) (-504.069) * (-503.430) (-502.250) (-505.615) [-505.044] -- 0:00:16
      736000 -- (-504.486) (-501.970) (-503.923) [-503.519] * (-503.492) (-502.227) [-507.145] (-503.955) -- 0:00:16
      736500 -- (-502.784) (-502.725) (-507.996) [-503.749] * (-506.556) (-506.397) [-505.891] (-503.897) -- 0:00:16
      737000 -- (-505.685) (-504.093) [-503.552] (-503.988) * [-505.483] (-504.363) (-506.083) (-508.821) -- 0:00:16
      737500 -- (-504.468) (-506.292) [-503.007] (-502.605) * (-504.113) (-506.777) [-503.948] (-504.661) -- 0:00:16
      738000 -- (-503.188) (-502.919) (-503.978) [-504.445] * (-504.128) (-506.340) (-504.389) [-504.340] -- 0:00:15
      738500 -- (-504.054) (-510.504) (-506.087) [-503.831] * [-502.258] (-502.114) (-507.975) (-502.084) -- 0:00:15
      739000 -- (-504.011) (-506.724) [-508.056] (-502.158) * [-504.224] (-503.949) (-509.896) (-504.677) -- 0:00:15
      739500 -- (-507.073) (-501.921) (-502.340) [-505.900] * (-504.385) [-504.679] (-503.517) (-504.100) -- 0:00:15
      740000 -- (-502.459) (-506.940) [-506.562] (-505.766) * (-503.103) (-504.309) [-504.801] (-504.876) -- 0:00:15

      Average standard deviation of split frequencies: 0.007213

      740500 -- (-505.394) [-506.308] (-504.540) (-506.545) * (-504.584) [-505.661] (-505.040) (-502.392) -- 0:00:15
      741000 -- (-505.648) (-506.817) (-506.982) [-505.671] * (-504.175) [-505.808] (-503.303) (-503.563) -- 0:00:15
      741500 -- (-512.716) (-503.892) (-504.880) [-505.604] * (-511.881) (-506.744) [-502.612] (-503.522) -- 0:00:15
      742000 -- (-507.481) (-506.349) [-502.748] (-505.787) * (-508.228) [-504.234] (-504.795) (-502.690) -- 0:00:15
      742500 -- [-502.930] (-504.626) (-503.278) (-507.839) * (-505.719) (-507.022) (-503.971) [-504.655] -- 0:00:15
      743000 -- (-505.577) [-504.591] (-505.469) (-504.225) * [-503.752] (-507.238) (-506.323) (-505.028) -- 0:00:15
      743500 -- [-504.270] (-505.633) (-507.519) (-502.606) * (-504.525) (-503.570) (-505.661) [-505.406] -- 0:00:15
      744000 -- (-503.376) (-503.857) (-505.676) [-506.924] * (-507.742) [-505.645] (-505.042) (-503.466) -- 0:00:15
      744500 -- (-502.152) [-503.064] (-509.681) (-502.911) * (-507.262) [-502.739] (-506.918) (-505.436) -- 0:00:15
      745000 -- (-503.264) (-503.404) [-505.666] (-502.645) * [-503.753] (-503.618) (-503.790) (-505.189) -- 0:00:15

      Average standard deviation of split frequencies: 0.006656

      745500 -- (-504.292) [-503.776] (-507.690) (-502.533) * (-508.514) [-503.323] (-503.406) (-505.760) -- 0:00:15
      746000 -- [-505.835] (-506.876) (-503.478) (-508.831) * (-507.642) (-502.449) (-502.800) [-507.043] -- 0:00:15
      746500 -- (-509.239) (-503.909) [-507.627] (-504.350) * (-509.003) [-507.140] (-505.445) (-505.594) -- 0:00:15
      747000 -- (-505.604) (-503.543) [-503.354] (-505.368) * [-504.046] (-504.550) (-505.568) (-507.473) -- 0:00:15
      747500 -- (-505.382) (-503.650) [-503.312] (-503.191) * (-503.204) (-505.279) [-503.069] (-505.652) -- 0:00:15
      748000 -- (-506.283) [-503.112] (-503.348) (-504.009) * [-505.576] (-510.032) (-504.057) (-504.041) -- 0:00:15
      748500 -- (-502.622) (-502.516) [-503.151] (-503.320) * (-503.143) [-504.762] (-503.375) (-506.699) -- 0:00:15
      749000 -- [-504.993] (-502.610) (-503.273) (-505.087) * [-502.060] (-503.460) (-504.846) (-503.656) -- 0:00:15
      749500 -- (-504.951) [-503.469] (-507.155) (-502.337) * (-506.119) (-504.080) (-503.202) [-504.117] -- 0:00:15
      750000 -- (-506.420) (-505.307) (-503.121) [-502.242] * (-503.996) (-502.811) (-504.210) [-502.845] -- 0:00:15

      Average standard deviation of split frequencies: 0.007201

      750500 -- (-504.642) [-505.700] (-505.045) (-501.909) * (-503.984) (-503.004) (-503.578) [-503.013] -- 0:00:15
      751000 -- (-507.412) [-506.705] (-505.887) (-504.863) * [-505.964] (-503.149) (-507.406) (-503.448) -- 0:00:15
      751500 -- [-503.489] (-502.961) (-509.949) (-504.478) * (-509.773) (-502.874) (-504.893) [-502.056] -- 0:00:15
      752000 -- (-508.658) (-505.548) (-506.974) [-506.555] * (-507.512) (-505.540) [-504.863] (-504.046) -- 0:00:15
      752500 -- (-510.247) [-506.164] (-508.186) (-505.102) * [-504.281] (-507.552) (-504.236) (-503.909) -- 0:00:15
      753000 -- (-502.751) [-509.344] (-507.911) (-504.517) * (-503.264) (-503.331) (-504.694) [-504.915] -- 0:00:15
      753500 -- (-506.232) [-504.689] (-505.195) (-503.164) * (-502.641) (-505.338) (-505.870) [-504.632] -- 0:00:15
      754000 -- (-503.413) (-504.098) (-509.031) [-503.325] * (-504.248) [-504.959] (-504.470) (-504.201) -- 0:00:15
      754500 -- (-505.256) (-502.760) (-515.119) [-504.201] * (-506.824) [-502.157] (-505.602) (-503.362) -- 0:00:14
      755000 -- (-503.279) (-503.712) [-504.396] (-504.934) * (-507.592) (-505.245) (-503.670) [-505.646] -- 0:00:14

      Average standard deviation of split frequencies: 0.006901

      755500 -- (-508.778) [-503.663] (-506.944) (-504.537) * [-509.944] (-506.097) (-504.582) (-503.613) -- 0:00:14
      756000 -- (-501.969) (-505.142) [-504.856] (-504.260) * [-503.593] (-506.956) (-506.650) (-504.001) -- 0:00:14
      756500 -- (-502.343) (-506.110) (-507.056) [-502.107] * [-506.506] (-510.508) (-504.375) (-504.540) -- 0:00:14
      757000 -- (-506.059) (-504.930) [-503.402] (-502.900) * (-507.550) [-504.083] (-503.366) (-505.265) -- 0:00:14
      757500 -- (-504.564) (-502.671) [-503.432] (-503.332) * (-509.823) [-505.014] (-502.924) (-506.727) -- 0:00:15
      758000 -- (-504.707) [-504.634] (-508.474) (-505.112) * (-505.160) [-502.910] (-505.769) (-508.038) -- 0:00:15
      758500 -- (-505.245) (-503.831) [-505.396] (-505.839) * (-505.131) (-502.809) (-504.687) [-503.506] -- 0:00:14
      759000 -- (-503.737) (-502.828) [-505.556] (-506.285) * [-506.188] (-510.752) (-508.573) (-504.828) -- 0:00:14
      759500 -- [-504.198] (-502.706) (-503.259) (-509.372) * [-504.524] (-503.305) (-503.180) (-504.176) -- 0:00:14
      760000 -- (-504.723) (-504.070) [-504.932] (-506.537) * (-504.294) (-507.196) [-502.732] (-504.726) -- 0:00:14

      Average standard deviation of split frequencies: 0.006900

      760500 -- (-505.678) (-504.200) (-504.391) [-504.475] * (-503.924) [-504.460] (-504.601) (-502.702) -- 0:00:14
      761000 -- (-505.035) (-505.360) [-507.771] (-504.241) * (-507.254) [-506.644] (-504.781) (-506.273) -- 0:00:14
      761500 -- [-507.119] (-505.286) (-504.653) (-503.273) * (-505.704) (-502.268) [-504.070] (-502.727) -- 0:00:14
      762000 -- [-504.156] (-505.800) (-505.225) (-504.647) * [-502.844] (-502.752) (-503.636) (-504.000) -- 0:00:14
      762500 -- (-503.932) (-503.388) [-502.795] (-503.643) * (-503.620) (-515.329) [-504.836] (-504.817) -- 0:00:14
      763000 -- (-506.409) (-502.218) [-503.944] (-506.795) * [-504.755] (-504.705) (-510.481) (-505.631) -- 0:00:14
      763500 -- (-509.017) (-505.555) (-502.467) [-505.021] * (-507.528) [-503.785] (-503.570) (-504.441) -- 0:00:14
      764000 -- (-503.742) (-506.562) (-502.049) [-504.369] * [-503.855] (-506.430) (-503.384) (-504.921) -- 0:00:14
      764500 -- [-507.381] (-503.520) (-506.064) (-503.759) * (-502.644) (-504.098) [-502.814] (-505.801) -- 0:00:14
      765000 -- (-505.182) (-502.175) (-505.819) [-502.951] * [-503.100] (-507.623) (-503.646) (-505.562) -- 0:00:14

      Average standard deviation of split frequencies: 0.007016

      765500 -- [-507.278] (-502.490) (-504.039) (-506.453) * (-507.014) (-502.888) (-504.289) [-503.269] -- 0:00:14
      766000 -- (-506.840) (-507.075) [-502.787] (-508.128) * (-503.870) (-503.546) [-503.421] (-503.169) -- 0:00:14
      766500 -- [-504.232] (-505.328) (-503.227) (-505.781) * (-505.299) [-503.044] (-503.776) (-504.228) -- 0:00:14
      767000 -- (-505.798) (-502.988) (-503.938) [-506.090] * [-506.492] (-507.104) (-504.672) (-502.847) -- 0:00:14
      767500 -- (-504.791) (-509.267) [-504.089] (-506.645) * (-506.074) (-505.432) [-504.947] (-504.135) -- 0:00:14
      768000 -- [-505.089] (-507.419) (-507.022) (-505.577) * (-507.845) (-504.204) [-503.234] (-510.847) -- 0:00:14
      768500 -- (-505.050) [-506.606] (-505.892) (-503.558) * (-510.102) (-504.737) [-502.865] (-508.373) -- 0:00:14
      769000 -- [-504.460] (-509.000) (-507.157) (-503.813) * [-504.880] (-504.253) (-503.907) (-509.088) -- 0:00:14
      769500 -- [-503.415] (-505.689) (-510.213) (-505.427) * (-503.749) (-504.204) (-503.817) [-505.708] -- 0:00:14
      770000 -- (-503.901) (-503.920) [-505.105] (-506.150) * (-504.697) (-504.169) [-506.624] (-505.979) -- 0:00:14

      Average standard deviation of split frequencies: 0.006932

      770500 -- (-505.208) (-505.415) (-503.507) [-504.765] * [-504.044] (-504.184) (-503.916) (-504.358) -- 0:00:13
      771000 -- [-504.609] (-510.727) (-502.331) (-504.194) * [-503.475] (-505.296) (-504.063) (-506.832) -- 0:00:13
      771500 -- (-504.102) (-505.999) (-502.722) [-507.478] * (-503.651) (-502.909) [-505.802] (-509.608) -- 0:00:13
      772000 -- (-506.971) (-506.987) [-504.792] (-509.030) * (-503.349) [-502.428] (-504.462) (-506.904) -- 0:00:13
      772500 -- [-505.183] (-502.849) (-506.149) (-510.985) * (-503.065) [-504.229] (-502.218) (-504.965) -- 0:00:13
      773000 -- (-504.756) (-503.028) (-502.651) [-505.785] * (-503.737) [-502.735] (-505.556) (-503.876) -- 0:00:13
      773500 -- [-505.631] (-503.267) (-502.759) (-503.135) * (-504.115) [-506.887] (-504.036) (-502.916) -- 0:00:13
      774000 --