--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:28:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsM/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -503.60 -507.23
2 -503.59 -506.93
--------------------------------------
TOTAL -503.59 -507.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892905 0.089435 0.346565 1.484922 0.862531 1282.86 1384.85 1.000
r(A<->C){all} 0.169026 0.020012 0.000038 0.459969 0.134334 254.08 311.26 1.000
r(A<->G){all} 0.173474 0.021574 0.000138 0.463583 0.132934 196.15 269.63 1.000
r(A<->T){all} 0.169511 0.021248 0.000013 0.472800 0.134107 243.88 249.17 1.000
r(C<->G){all} 0.151957 0.017309 0.000037 0.420191 0.116085 180.47 253.37 1.002
r(C<->T){all} 0.171365 0.021221 0.000010 0.473474 0.133443 129.07 161.76 1.000
r(G<->T){all} 0.164667 0.017619 0.000165 0.424536 0.135562 179.88 246.65 1.000
pi(A){all} 0.236291 0.000478 0.194240 0.278451 0.236079 1154.16 1163.35 1.000
pi(C){all} 0.308547 0.000548 0.264178 0.355273 0.308723 1230.21 1240.54 1.000
pi(G){all} 0.306112 0.000557 0.261431 0.353169 0.305773 1249.36 1335.68 1.000
pi(T){all} 0.149051 0.000328 0.115026 0.184898 0.148208 836.25 1080.83 1.000
alpha{1,2} 0.405734 0.221168 0.000127 1.341922 0.236388 1188.10 1195.50 1.000
alpha{3} 0.456308 0.250092 0.000340 1.482230 0.292638 1075.02 1113.78 1.000
pinvar{all} 0.995526 0.000028 0.985681 0.999995 0.997226 1197.03 1240.75 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -479.415449
Model 2: PositiveSelection -479.415469
Model 0: one-ratio -479.415443
Model 7: beta -479.415494
Model 8: beta&w>1 -479.415406
Model 0 vs 1 1.200000008338975E-5
Model 2 vs 1 3.999999989900971E-5
Model 8 vs 7 1.7600000001039007E-4
>C1
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C2
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C3
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C4
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C5
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C6
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124
C1 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C2 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C3 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C4 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C5 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C6 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
**************************************************
C1 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C2 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C3 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C4 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C5 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C6 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
**************************************************
C1 QRTKTNARTRKGPKRTIAGKKKAR
C2 QRTKTNARTRKGPKRTIAGKKKAR
C3 QRTKTNARTRKGPKRTIAGKKKAR
C4 QRTKTNARTRKGPKRTIAGKKKAR
C5 QRTKTNARTRKGPKRTIAGKKKAR
C6 QRTKTNARTRKGPKRTIAGKKKAR
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 124 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 124 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3720]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3720]--->[3720]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.653 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C2 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C3 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C4 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C5 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
C6 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
**************************************************
C1 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C2 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C3 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C4 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C5 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
C6 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
**************************************************
C1 QRTKTNARTRKGPKRTIAGKKKAR
C2 QRTKTNARTRKGPKRTIAGKKKAR
C3 QRTKTNARTRKGPKRTIAGKKKAR
C4 QRTKTNARTRKGPKRTIAGKKKAR
C5 QRTKTNARTRKGPKRTIAGKKKAR
C6 QRTKTNARTRKGPKRTIAGKKKAR
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C2 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C3 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C4 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C5 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
C6 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
**************************************************
C1 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C2 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C3 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C4 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C5 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
C6 CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
**************************************************
C1 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C2 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C3 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C4 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C5 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
C6 TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
**************************************************
C1 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C2 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C3 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C4 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C5 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
C6 GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
**************************************************
C1 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C2 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C3 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C4 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C5 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
C6 AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
**************************************************
C1 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C2 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C3 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C4 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C5 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
C6 TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
**************************************************
C1 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C2 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C3 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C4 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C5 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
C6 CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
**************************************************
C1 TGCAGGCAAGAAGAAGGCCAGG
C2 TGCAGGCAAGAAGAAGGCCAGG
C3 TGCAGGCAAGAAGAAGGCCAGG
C4 TGCAGGCAAGAAGAAGGCCAGG
C5 TGCAGGCAAGAAGAAGGCCAGG
C6 TGCAGGCAAGAAGAAGGCCAGG
**********************
>C1
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C2
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C3
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C4
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C5
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C6
ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT
CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT
TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT
GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA
AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA
TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC
CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT
TGCAGGCAAGAAGAAGGCCAGG
>C1
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C2
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C3
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C4
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C5
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
>C6
MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 372 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579793204
Setting output file names to "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 267566631
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0794959148
Seed = 797280871
Swapseed = 1579793204
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -832.553837 -- -24.965149
Chain 2 -- -832.553837 -- -24.965149
Chain 3 -- -832.553837 -- -24.965149
Chain 4 -- -832.553710 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -832.553789 -- -24.965149
Chain 2 -- -832.553837 -- -24.965149
Chain 3 -- -832.553710 -- -24.965149
Chain 4 -- -832.553837 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-832.554] (-832.554) (-832.554) (-832.554) * [-832.554] (-832.554) (-832.554) (-832.554)
500 -- (-522.156) [-517.859] (-516.682) (-517.005) * (-513.702) [-513.849] (-512.620) (-516.864) -- 0:00:00
1000 -- [-519.069] (-511.353) (-518.852) (-516.221) * (-520.431) (-511.515) (-511.938) [-509.112] -- 0:00:00
1500 -- (-517.807) (-511.118) (-518.715) [-508.302] * [-509.322] (-519.544) (-512.662) (-513.678) -- 0:00:00
2000 -- (-511.487) [-510.905] (-516.306) (-518.150) * [-518.171] (-514.240) (-515.350) (-510.645) -- 0:00:00
2500 -- (-517.028) [-509.840] (-517.785) (-509.885) * (-514.859) [-515.033] (-516.155) (-515.574) -- 0:00:00
3000 -- (-513.993) [-514.282] (-519.015) (-517.860) * [-513.939] (-516.332) (-516.042) (-514.831) -- 0:00:00
3500 -- (-514.790) (-517.505) [-514.294] (-511.059) * (-509.428) [-509.026] (-514.798) (-514.172) -- 0:00:00
4000 -- (-511.530) [-509.469] (-520.439) (-512.523) * (-507.042) (-514.969) [-512.365] (-516.375) -- 0:00:00
4500 -- [-519.815] (-524.896) (-517.359) (-525.056) * (-510.344) [-514.209] (-508.732) (-518.568) -- 0:00:00
5000 -- (-509.158) (-511.581) [-517.050] (-507.282) * (-512.073) (-515.347) [-511.792] (-513.408) -- 0:00:00
Average standard deviation of split frequencies: 0.074826
5500 -- (-515.506) (-511.614) [-510.150] (-502.900) * [-511.313] (-507.155) (-525.358) (-510.756) -- 0:00:00
6000 -- (-526.818) [-515.255] (-518.389) (-504.374) * [-512.890] (-520.740) (-520.534) (-510.439) -- 0:00:00
6500 -- (-527.390) (-516.012) (-517.709) [-503.246] * [-509.238] (-513.847) (-517.949) (-509.023) -- 0:00:00
7000 -- (-517.998) (-517.504) (-516.522) [-504.612] * (-506.674) (-510.811) (-525.912) [-510.280] -- 0:00:00
7500 -- [-514.611] (-512.568) (-521.943) (-505.808) * (-524.331) (-513.231) (-520.381) [-512.394] -- 0:00:00
8000 -- (-517.101) (-519.002) [-516.694] (-505.549) * (-523.939) (-510.679) (-514.685) [-507.520] -- 0:00:00
8500 -- (-510.905) (-518.332) [-505.337] (-504.041) * [-511.669] (-509.021) (-527.631) (-513.414) -- 0:00:00
9000 -- (-517.746) [-515.433] (-503.311) (-503.975) * [-513.382] (-516.259) (-504.994) (-512.345) -- 0:00:00
9500 -- (-516.908) (-535.495) [-502.457] (-502.895) * (-515.806) (-508.974) (-509.656) [-512.399] -- 0:00:00
10000 -- (-517.172) [-507.029] (-504.108) (-505.397) * (-517.689) (-516.575) [-508.041] (-511.423) -- 0:00:00
Average standard deviation of split frequencies: 0.061381
10500 -- (-514.541) [-505.296] (-505.878) (-503.456) * (-514.968) [-515.454] (-505.736) (-517.811) -- 0:00:00
11000 -- (-512.403) (-504.273) [-503.629] (-502.961) * [-509.310] (-521.977) (-503.910) (-508.736) -- 0:00:00
11500 -- (-514.637) [-502.489] (-504.771) (-502.495) * [-512.114] (-512.480) (-506.413) (-507.316) -- 0:00:00
12000 -- (-514.444) [-503.348] (-504.238) (-505.564) * [-508.396] (-517.765) (-506.357) (-512.238) -- 0:00:00
12500 -- (-519.443) [-505.028] (-505.367) (-503.298) * [-511.859] (-521.709) (-504.057) (-508.123) -- 0:00:00
13000 -- (-515.322) [-503.142] (-502.442) (-504.705) * (-514.331) [-511.605] (-506.028) (-521.168) -- 0:00:00
13500 -- (-510.280) [-503.464] (-504.527) (-502.715) * (-528.521) [-510.753] (-503.381) (-513.463) -- 0:00:00
14000 -- (-520.923) [-502.953] (-502.815) (-507.922) * (-520.822) [-515.598] (-509.383) (-513.560) -- 0:00:00
14500 -- (-512.041) (-502.690) [-502.889] (-504.547) * (-510.893) (-520.803) [-504.713] (-515.715) -- 0:01:07
15000 -- (-515.485) (-503.715) [-503.044] (-505.530) * (-505.644) (-518.046) (-502.588) [-514.112] -- 0:01:05
Average standard deviation of split frequencies: 0.061872
15500 -- (-511.634) (-508.463) (-503.993) [-503.309] * [-503.988] (-511.345) (-503.812) (-517.801) -- 0:01:03
16000 -- (-511.221) (-503.373) [-504.122] (-507.741) * [-503.004] (-521.217) (-505.760) (-521.397) -- 0:01:01
16500 -- (-513.316) (-503.695) (-503.622) [-503.374] * (-503.812) [-509.916] (-504.331) (-520.918) -- 0:00:59
17000 -- (-518.000) (-504.105) (-506.033) [-503.494] * (-504.088) (-515.749) (-504.116) [-509.308] -- 0:00:57
17500 -- (-517.679) [-502.398] (-504.870) (-508.487) * [-505.851] (-513.334) (-508.512) (-507.708) -- 0:00:56
18000 -- [-513.150] (-503.554) (-504.540) (-508.463) * [-504.719] (-513.437) (-504.336) (-508.806) -- 0:00:54
18500 -- (-519.307) [-506.040] (-504.513) (-503.764) * (-504.379) (-515.748) [-506.450] (-506.507) -- 0:00:53
19000 -- (-514.686) (-505.382) (-506.228) [-504.049] * [-503.761] (-515.288) (-504.938) (-505.167) -- 0:00:51
19500 -- (-511.123) (-504.500) (-505.896) [-504.913] * (-509.386) [-517.755] (-503.221) (-504.594) -- 0:00:50
20000 -- (-515.375) (-502.971) [-504.314] (-503.238) * (-504.337) [-512.539] (-503.564) (-506.831) -- 0:00:49
Average standard deviation of split frequencies: 0.052329
20500 -- [-510.512] (-504.726) (-503.044) (-503.135) * (-505.396) (-511.536) (-504.673) [-503.435] -- 0:00:47
21000 -- (-526.238) [-505.120] (-503.352) (-503.872) * (-504.315) [-507.982] (-503.468) (-504.546) -- 0:00:46
21500 -- (-513.443) [-503.912] (-504.386) (-505.241) * [-508.659] (-512.684) (-505.018) (-506.741) -- 0:00:45
22000 -- (-517.345) (-505.562) [-504.229] (-503.430) * (-507.293) [-513.509] (-502.562) (-506.710) -- 0:00:44
22500 -- (-521.875) (-504.441) [-504.526] (-504.618) * [-505.810] (-512.394) (-503.647) (-505.180) -- 0:00:43
23000 -- (-522.167) [-503.451] (-503.803) (-505.276) * (-502.326) (-512.974) [-506.963] (-503.512) -- 0:00:42
23500 -- [-503.560] (-505.322) (-502.222) (-503.358) * (-502.628) (-514.743) (-503.949) [-502.404] -- 0:00:41
24000 -- (-503.596) (-503.927) [-502.031] (-502.193) * (-503.178) (-512.672) (-506.445) [-502.934] -- 0:00:40
24500 -- [-502.451] (-502.340) (-503.788) (-502.346) * (-502.477) [-513.343] (-505.501) (-504.625) -- 0:00:39
25000 -- [-505.613] (-502.204) (-506.625) (-504.336) * (-502.257) (-513.071) (-505.439) [-503.962] -- 0:00:39
Average standard deviation of split frequencies: 0.050076
25500 -- (-505.076) [-502.298] (-505.517) (-506.093) * (-504.413) (-511.033) (-504.636) [-503.835] -- 0:00:38
26000 -- (-503.790) [-502.740] (-504.493) (-504.192) * (-505.151) (-514.537) [-503.509] (-503.788) -- 0:00:37
26500 -- (-505.808) (-503.920) [-505.666] (-503.606) * [-503.613] (-517.516) (-504.612) (-503.743) -- 0:00:36
27000 -- (-502.946) [-505.721] (-503.358) (-503.414) * (-503.169) [-516.366] (-506.973) (-508.093) -- 0:00:36
27500 -- (-503.603) (-505.410) [-505.328] (-505.034) * (-506.977) [-514.027] (-504.884) (-503.340) -- 0:00:35
28000 -- [-505.192] (-503.768) (-507.649) (-504.759) * (-506.487) (-518.508) (-504.351) [-502.522] -- 0:00:34
28500 -- (-503.752) [-505.523] (-504.342) (-503.593) * (-503.422) (-515.245) [-504.701] (-502.837) -- 0:00:34
29000 -- [-502.178] (-507.104) (-504.415) (-508.606) * [-502.873] (-515.174) (-505.723) (-504.748) -- 0:00:33
29500 -- (-504.899) (-504.020) (-502.543) [-506.331] * (-502.738) [-516.808] (-507.809) (-507.418) -- 0:00:32
30000 -- (-506.050) [-506.227] (-502.359) (-503.045) * [-502.745] (-513.618) (-503.781) (-504.116) -- 0:00:32
Average standard deviation of split frequencies: 0.038430
30500 -- [-503.929] (-504.991) (-502.951) (-504.579) * [-502.853] (-513.026) (-503.604) (-506.632) -- 0:00:31
31000 -- (-504.837) [-507.042] (-502.386) (-505.507) * [-502.981] (-521.117) (-503.541) (-504.566) -- 0:01:02
31500 -- (-504.521) [-507.866] (-503.696) (-503.656) * (-502.637) (-517.794) (-503.189) [-503.993] -- 0:01:01
32000 -- (-503.715) [-504.460] (-503.467) (-505.270) * (-503.399) (-508.806) [-504.537] (-505.159) -- 0:01:00
32500 -- [-505.516] (-505.045) (-503.943) (-505.598) * (-504.291) [-510.679] (-503.964) (-502.520) -- 0:00:59
33000 -- (-506.364) (-502.685) [-504.936] (-505.035) * (-507.572) [-506.279] (-502.933) (-503.870) -- 0:00:58
33500 -- (-505.885) [-502.132] (-502.948) (-504.434) * [-511.249] (-510.670) (-502.227) (-503.850) -- 0:00:57
34000 -- (-503.545) [-502.331] (-501.990) (-506.439) * (-506.402) [-508.516] (-503.265) (-508.242) -- 0:00:56
34500 -- (-505.603) (-505.106) [-502.825] (-503.426) * (-504.551) [-507.084] (-503.393) (-502.442) -- 0:00:55
35000 -- [-505.755] (-507.195) (-507.680) (-501.977) * (-503.943) (-511.374) (-505.805) [-503.124] -- 0:00:55
Average standard deviation of split frequencies: 0.040593
35500 -- (-504.250) [-503.478] (-502.503) (-502.713) * (-504.475) (-519.116) (-505.091) [-503.138] -- 0:00:54
36000 -- [-504.180] (-503.357) (-504.246) (-503.029) * (-502.085) [-508.573] (-505.250) (-503.810) -- 0:00:53
36500 -- (-504.447) (-502.946) [-505.501] (-505.500) * (-503.622) (-512.986) [-502.903] (-504.591) -- 0:00:52
37000 -- (-504.209) [-502.980] (-509.049) (-504.158) * (-506.432) (-514.404) [-504.863] (-504.045) -- 0:00:52
37500 -- (-504.719) (-503.872) [-502.721] (-503.709) * (-504.483) [-513.677] (-506.504) (-504.424) -- 0:00:51
38000 -- (-504.157) [-502.989] (-503.013) (-505.355) * (-505.707) (-511.602) (-503.912) [-503.338] -- 0:00:50
38500 -- [-505.058] (-506.489) (-503.267) (-507.537) * [-504.283] (-509.186) (-506.224) (-505.021) -- 0:00:49
39000 -- (-504.982) [-504.698] (-506.162) (-504.090) * (-504.736) [-508.646] (-506.354) (-504.509) -- 0:00:49
39500 -- (-504.462) [-504.530] (-502.955) (-506.263) * (-504.482) (-509.179) (-505.890) [-505.384] -- 0:00:48
40000 -- (-505.022) [-505.283] (-506.892) (-506.766) * (-505.912) (-515.615) (-504.055) [-505.944] -- 0:00:48
Average standard deviation of split frequencies: 0.039657
40500 -- (-505.697) (-505.963) (-503.631) [-507.280] * (-504.473) (-524.978) [-504.511] (-507.763) -- 0:00:47
41000 -- (-505.796) (-506.285) (-508.849) [-506.432] * (-504.178) (-511.318) (-505.874) [-503.968] -- 0:00:46
41500 -- (-507.885) (-504.761) (-505.176) [-503.474] * (-503.739) [-509.696] (-504.345) (-502.975) -- 0:00:46
42000 -- [-502.926] (-503.457) (-503.480) (-511.561) * (-501.900) (-524.908) (-503.990) [-503.979] -- 0:00:45
42500 -- [-504.535] (-508.117) (-502.666) (-504.319) * [-502.538] (-522.577) (-504.991) (-504.021) -- 0:00:45
43000 -- (-505.974) [-510.178] (-504.605) (-504.050) * (-504.661) [-520.759] (-506.289) (-504.902) -- 0:00:44
43500 -- [-504.523] (-505.690) (-503.736) (-503.708) * (-503.350) (-523.980) (-502.744) [-502.872] -- 0:00:43
44000 -- (-503.730) [-502.330] (-504.658) (-504.456) * (-502.144) [-513.562] (-503.962) (-502.127) -- 0:00:43
44500 -- [-506.475] (-502.692) (-506.078) (-504.624) * [-504.873] (-513.728) (-502.639) (-505.359) -- 0:00:42
45000 -- (-507.199) (-504.940) (-503.723) [-503.649] * (-504.755) (-516.365) (-503.916) [-502.645] -- 0:00:42
Average standard deviation of split frequencies: 0.037576
45500 -- (-507.121) [-502.862] (-503.357) (-503.080) * (-505.338) [-509.795] (-502.895) (-504.086) -- 0:00:41
46000 -- (-504.543) (-507.546) (-504.789) [-505.130] * (-505.602) (-525.040) (-504.930) [-502.108] -- 0:00:41
46500 -- (-506.017) [-502.381] (-503.050) (-503.500) * (-506.086) (-513.154) (-505.155) [-502.966] -- 0:00:41
47000 -- (-504.318) [-502.812] (-506.888) (-502.216) * (-513.900) (-508.589) (-507.111) [-502.359] -- 0:00:40
47500 -- (-504.562) [-504.838] (-506.544) (-505.226) * [-505.397] (-512.070) (-503.811) (-504.298) -- 0:00:40
48000 -- (-503.203) [-505.657] (-507.511) (-503.782) * (-509.928) (-513.833) (-506.001) [-503.725] -- 0:00:59
48500 -- (-503.246) [-503.662] (-504.437) (-502.434) * [-505.422] (-512.501) (-507.198) (-507.375) -- 0:00:58
49000 -- (-504.949) (-502.511) (-508.240) [-503.583] * (-505.305) [-514.146] (-507.281) (-505.536) -- 0:00:58
49500 -- (-508.668) (-503.509) (-506.600) [-503.332] * (-504.414) [-513.136] (-505.217) (-505.621) -- 0:00:57
50000 -- (-510.933) (-502.494) [-506.936] (-507.932) * (-503.605) (-512.667) (-504.169) [-503.159] -- 0:00:57
Average standard deviation of split frequencies: 0.034768
50500 -- (-502.946) (-502.865) [-508.718] (-504.956) * (-504.770) (-516.427) [-503.647] (-503.796) -- 0:00:56
51000 -- (-503.028) (-504.863) (-504.680) [-504.754] * [-503.099] (-516.003) (-503.999) (-505.053) -- 0:00:55
51500 -- (-502.767) (-504.637) (-502.955) [-502.737] * (-503.343) [-509.284] (-503.633) (-503.776) -- 0:00:55
52000 -- (-505.943) (-507.823) (-503.236) [-502.451] * (-504.828) (-516.902) [-503.463] (-504.577) -- 0:00:54
52500 -- (-502.977) (-504.199) [-505.629] (-504.077) * [-504.695] (-523.457) (-504.095) (-502.987) -- 0:00:54
53000 -- [-504.222] (-503.049) (-509.120) (-504.207) * [-505.265] (-508.127) (-505.032) (-502.628) -- 0:00:53
53500 -- (-505.149) (-509.428) [-505.865] (-502.257) * (-503.280) (-520.475) (-507.346) [-502.297] -- 0:00:53
54000 -- [-502.096] (-507.461) (-506.437) (-504.403) * (-502.925) (-515.559) [-505.727] (-503.036) -- 0:00:52
54500 -- (-502.341) (-504.765) (-507.771) [-506.129] * (-504.633) (-512.986) (-504.741) [-507.338] -- 0:00:52
55000 -- (-502.258) [-504.668] (-506.408) (-507.632) * (-507.243) [-508.902] (-504.387) (-503.865) -- 0:00:51
Average standard deviation of split frequencies: 0.033229
55500 -- (-513.189) (-503.559) [-503.832] (-502.086) * (-505.846) (-515.951) (-502.788) [-504.204] -- 0:00:51
56000 -- (-505.056) (-504.442) (-506.431) [-503.439] * (-502.888) (-510.420) [-505.603] (-506.300) -- 0:00:50
56500 -- (-502.191) (-504.034) [-507.198] (-503.275) * (-503.546) [-509.385] (-502.506) (-503.768) -- 0:00:50
57000 -- (-503.226) [-505.763] (-504.183) (-506.397) * (-502.711) (-508.030) [-503.096] (-502.819) -- 0:00:49
57500 -- (-511.771) [-505.668] (-503.472) (-503.369) * [-506.134] (-510.718) (-502.158) (-509.304) -- 0:00:49
58000 -- (-504.368) [-504.145] (-504.745) (-505.457) * (-504.007) (-514.394) [-503.157] (-508.160) -- 0:00:48
58500 -- (-504.988) (-504.773) [-505.630] (-505.528) * (-503.861) [-512.433] (-504.092) (-505.587) -- 0:00:48
59000 -- (-504.163) (-509.991) [-506.040] (-505.588) * (-502.979) (-508.088) [-506.170] (-506.508) -- 0:00:47
59500 -- [-503.205] (-506.447) (-504.065) (-507.644) * [-504.194] (-516.371) (-504.843) (-505.742) -- 0:00:47
60000 -- (-505.919) (-506.133) (-505.390) [-508.293] * [-503.423] (-515.893) (-508.875) (-505.353) -- 0:00:47
Average standard deviation of split frequencies: 0.033824
60500 -- (-504.278) (-505.680) (-508.694) [-503.653] * (-503.770) (-516.761) [-504.039] (-504.960) -- 0:00:46
61000 -- (-505.000) (-504.288) [-503.634] (-503.577) * (-505.120) (-522.163) (-506.094) [-504.687] -- 0:00:46
61500 -- (-505.978) [-503.740] (-506.642) (-502.596) * (-505.509) (-528.312) (-505.175) [-502.717] -- 0:00:45
62000 -- (-507.567) (-502.324) [-503.859] (-503.871) * (-507.280) [-503.422] (-503.724) (-505.208) -- 0:00:45
62500 -- (-505.174) (-505.498) (-505.444) [-502.695] * (-504.143) [-504.774] (-511.641) (-505.511) -- 0:00:45
63000 -- (-506.603) (-505.828) (-503.051) [-502.195] * (-502.926) (-505.502) (-510.621) [-503.398] -- 0:00:44
63500 -- [-510.611] (-505.968) (-504.951) (-502.375) * (-504.537) (-505.825) [-507.405] (-505.905) -- 0:00:44
64000 -- [-503.906] (-504.644) (-502.613) (-506.421) * (-504.531) (-502.501) (-503.121) [-504.383] -- 0:00:43
64500 -- (-502.654) (-504.696) [-502.446] (-507.178) * [-503.812] (-504.438) (-503.478) (-503.744) -- 0:00:58
65000 -- (-505.358) (-502.442) [-504.529] (-505.838) * (-504.242) [-503.017] (-504.453) (-503.344) -- 0:00:57
Average standard deviation of split frequencies: 0.032311
65500 -- (-505.036) [-502.471] (-510.993) (-504.951) * (-505.629) [-502.726] (-502.945) (-504.222) -- 0:00:57
66000 -- [-505.542] (-502.677) (-508.060) (-504.759) * (-505.613) (-505.891) [-504.436] (-503.894) -- 0:00:56
66500 -- [-505.817] (-503.221) (-514.614) (-508.537) * [-503.930] (-504.350) (-504.637) (-503.677) -- 0:00:56
67000 -- (-503.918) (-502.877) (-507.478) [-506.465] * (-502.028) [-502.947] (-505.182) (-504.471) -- 0:00:55
67500 -- (-505.687) [-503.334] (-502.893) (-502.729) * [-504.519] (-509.314) (-504.110) (-509.494) -- 0:00:55
68000 -- (-508.317) (-503.755) [-505.096] (-504.115) * (-504.594) [-502.509] (-506.055) (-507.801) -- 0:00:54
68500 -- (-507.382) (-502.211) (-504.496) [-502.822] * (-505.698) [-506.105] (-502.083) (-505.269) -- 0:00:54
69000 -- [-502.926] (-509.593) (-514.069) (-503.314) * (-503.658) (-505.973) [-507.199] (-504.319) -- 0:00:53
69500 -- (-505.748) [-502.330] (-508.165) (-505.499) * (-504.924) (-505.355) (-502.796) [-502.947] -- 0:00:53
70000 -- (-509.758) [-502.433] (-503.587) (-507.912) * (-507.395) (-507.091) (-503.246) [-502.513] -- 0:00:53
Average standard deviation of split frequencies: 0.028017
70500 -- (-505.476) (-504.283) (-503.587) [-504.785] * (-506.093) (-506.042) [-502.729] (-503.471) -- 0:00:52
71000 -- (-505.023) (-504.995) [-505.960] (-505.611) * (-502.556) [-505.366] (-507.192) (-505.062) -- 0:00:52
71500 -- (-503.345) (-505.937) [-506.473] (-507.247) * (-503.681) (-507.870) (-506.911) [-507.816] -- 0:00:51
72000 -- (-502.926) (-506.126) [-509.203] (-502.203) * (-505.919) (-502.749) [-504.099] (-502.314) -- 0:00:51
72500 -- (-509.601) [-502.046] (-503.353) (-505.007) * [-502.498] (-503.256) (-503.271) (-503.918) -- 0:00:51
73000 -- [-508.122] (-504.480) (-503.504) (-503.097) * (-504.571) [-505.198] (-506.074) (-503.115) -- 0:00:50
73500 -- [-502.893] (-503.157) (-508.937) (-502.075) * (-505.457) [-504.459] (-503.302) (-502.970) -- 0:00:50
74000 -- (-504.701) (-506.699) (-504.935) [-502.445] * (-502.951) [-504.083] (-502.483) (-503.561) -- 0:00:50
74500 -- (-503.160) [-508.017] (-503.850) (-502.497) * (-503.359) [-505.811] (-503.386) (-503.554) -- 0:00:49
75000 -- (-509.347) [-505.745] (-505.947) (-504.706) * (-506.512) (-504.900) (-505.665) [-504.527] -- 0:00:49
Average standard deviation of split frequencies: 0.022020
75500 -- (-511.821) [-502.866] (-503.973) (-504.977) * [-503.705] (-502.656) (-505.226) (-505.398) -- 0:00:48
76000 -- (-504.969) [-503.359] (-506.665) (-507.572) * (-505.993) (-505.697) (-503.780) [-504.061] -- 0:00:48
76500 -- (-505.373) [-503.286] (-505.312) (-508.897) * [-504.541] (-505.772) (-503.237) (-506.325) -- 0:00:48
77000 -- (-505.230) [-503.578] (-504.403) (-509.860) * (-506.047) [-506.132] (-504.934) (-505.068) -- 0:00:47
77500 -- (-505.051) [-503.491] (-503.930) (-504.717) * [-504.636] (-507.544) (-503.087) (-505.788) -- 0:00:47
78000 -- (-505.459) (-504.656) [-504.387] (-503.239) * (-504.957) (-502.576) [-506.508] (-505.034) -- 0:00:47
78500 -- (-504.399) (-505.378) (-503.656) [-504.898] * (-503.198) (-503.097) [-504.222] (-510.231) -- 0:00:46
79000 -- (-505.199) (-510.837) [-505.100] (-503.725) * (-503.075) (-506.530) [-504.959] (-504.345) -- 0:00:46
79500 -- (-503.406) [-502.607] (-506.690) (-504.330) * (-503.628) (-506.253) (-502.651) [-502.798] -- 0:00:46
80000 -- [-504.064] (-507.047) (-505.156) (-506.037) * (-505.004) (-503.160) (-504.560) [-503.836] -- 0:00:46
Average standard deviation of split frequencies: 0.022791
80500 -- (-502.647) [-503.851] (-506.189) (-505.867) * (-505.115) (-505.429) (-504.644) [-507.637] -- 0:00:45
81000 -- (-506.209) [-504.484] (-507.228) (-502.265) * [-506.759] (-505.123) (-504.976) (-504.192) -- 0:00:56
81500 -- (-506.436) (-502.588) (-506.079) [-506.186] * (-502.460) (-508.450) [-506.906] (-504.570) -- 0:00:56
82000 -- (-504.139) [-502.184] (-503.959) (-505.695) * (-503.542) [-503.987] (-505.479) (-504.455) -- 0:00:55
82500 -- (-506.128) [-502.092] (-504.379) (-504.673) * [-504.349] (-506.164) (-506.756) (-505.238) -- 0:00:55
83000 -- (-508.148) (-509.299) (-502.836) [-503.475] * [-506.940] (-512.902) (-506.193) (-507.204) -- 0:00:55
83500 -- (-505.296) [-504.333] (-503.652) (-506.411) * (-505.696) [-504.978] (-506.766) (-504.030) -- 0:00:54
84000 -- (-504.258) (-505.306) (-505.058) [-504.156] * (-502.489) (-507.120) [-506.728] (-502.642) -- 0:00:54
84500 -- (-503.861) (-503.740) [-505.243] (-502.780) * (-503.231) [-503.639] (-506.699) (-502.107) -- 0:00:54
85000 -- (-503.901) (-503.235) [-505.136] (-503.148) * (-503.784) (-505.102) [-506.299] (-502.023) -- 0:00:53
Average standard deviation of split frequencies: 0.019459
85500 -- (-503.437) (-504.863) [-502.878] (-503.811) * (-503.491) (-505.956) [-504.863] (-502.046) -- 0:00:53
86000 -- (-507.059) [-504.135] (-503.221) (-503.516) * (-504.784) (-503.873) [-506.019] (-503.239) -- 0:00:53
86500 -- (-507.598) [-502.426] (-502.790) (-503.993) * (-506.006) [-504.164] (-502.358) (-503.690) -- 0:00:52
87000 -- (-503.464) [-502.910] (-504.521) (-504.888) * [-502.638] (-503.887) (-503.340) (-505.541) -- 0:00:52
87500 -- (-504.866) (-504.509) (-503.340) [-502.777] * [-504.841] (-504.432) (-509.386) (-503.702) -- 0:00:52
88000 -- (-505.811) (-507.162) (-504.429) [-503.530] * [-504.561] (-503.692) (-503.765) (-502.291) -- 0:00:51
88500 -- (-508.585) (-504.119) (-503.792) [-503.484] * (-506.518) (-502.595) [-503.554] (-502.420) -- 0:00:51
89000 -- (-504.324) [-504.496] (-502.893) (-506.002) * (-507.470) (-504.287) (-505.492) [-505.778] -- 0:00:51
89500 -- (-508.925) [-503.926] (-506.815) (-502.779) * (-503.072) (-507.546) [-502.543] (-503.471) -- 0:00:50
90000 -- (-508.420) (-504.893) (-506.012) [-503.930] * (-506.489) (-503.361) [-504.776] (-504.546) -- 0:00:50
Average standard deviation of split frequencies: 0.018775
90500 -- (-506.993) (-505.746) (-503.213) [-504.601] * (-505.254) (-504.832) (-506.648) [-503.000] -- 0:00:50
91000 -- (-502.669) (-506.311) (-503.258) [-504.260] * (-504.311) (-505.383) [-502.819] (-504.732) -- 0:00:49
91500 -- (-502.962) (-509.448) (-502.833) [-505.427] * (-504.905) (-502.957) [-503.425] (-503.567) -- 0:00:49
92000 -- (-502.727) (-508.745) (-505.957) [-502.340] * (-507.021) [-503.663] (-506.163) (-508.221) -- 0:00:49
92500 -- (-504.954) (-507.339) (-506.424) [-504.198] * (-505.086) (-507.339) (-506.068) [-505.149] -- 0:00:49
93000 -- (-505.689) [-502.696] (-505.284) (-502.663) * (-505.307) (-502.405) (-506.002) [-504.178] -- 0:00:48
93500 -- (-504.494) (-503.929) (-508.622) [-503.843] * (-504.273) (-504.077) (-503.589) [-505.416] -- 0:00:48
94000 -- [-505.305] (-505.987) (-505.080) (-503.754) * (-505.170) (-505.084) (-506.127) [-503.563] -- 0:00:48
94500 -- [-505.625] (-505.623) (-505.510) (-504.212) * (-505.393) (-504.193) (-506.261) [-505.130] -- 0:00:47
95000 -- (-503.689) (-507.034) (-504.358) [-506.171] * [-503.911] (-507.206) (-504.455) (-505.896) -- 0:00:47
Average standard deviation of split frequencies: 0.019396
95500 -- (-504.360) (-508.371) [-503.673] (-510.633) * (-503.451) [-503.662] (-503.723) (-507.626) -- 0:00:47
96000 -- (-505.446) [-503.997] (-505.650) (-509.510) * (-503.208) (-507.984) (-502.811) [-503.572] -- 0:00:47
96500 -- (-506.407) (-505.465) [-505.848] (-503.689) * (-504.611) (-503.076) (-504.052) [-503.424] -- 0:00:46
97000 -- (-504.793) [-504.156] (-503.335) (-510.657) * (-509.499) [-502.878] (-504.459) (-503.638) -- 0:00:46
97500 -- [-507.880] (-502.825) (-506.578) (-512.315) * (-505.329) (-505.871) (-504.244) [-504.579] -- 0:00:55
98000 -- (-505.292) (-503.784) (-505.901) [-505.614] * [-504.243] (-507.052) (-505.426) (-505.902) -- 0:00:55
98500 -- (-505.794) (-503.190) [-503.092] (-505.856) * (-504.662) (-506.562) (-505.523) [-504.908] -- 0:00:54
99000 -- (-503.934) [-503.193] (-506.139) (-502.664) * (-504.815) (-505.377) (-507.155) [-505.616] -- 0:00:54
99500 -- (-503.416) (-503.820) (-504.282) [-502.796] * (-505.186) (-505.280) [-506.555] (-503.457) -- 0:00:54
100000 -- (-504.570) [-502.968] (-503.101) (-503.357) * [-504.721] (-505.692) (-504.755) (-508.761) -- 0:00:54
Average standard deviation of split frequencies: 0.018263
100500 -- (-505.596) [-508.185] (-503.502) (-505.676) * (-508.027) [-504.996] (-506.519) (-505.328) -- 0:00:53
101000 -- [-505.486] (-508.572) (-503.942) (-502.339) * (-503.480) (-503.880) (-503.932) [-504.492] -- 0:00:53
101500 -- [-501.975] (-502.774) (-503.821) (-502.942) * (-503.722) (-505.508) (-508.296) [-503.687] -- 0:00:53
102000 -- (-502.230) (-503.230) [-504.577] (-503.477) * (-503.112) (-504.374) (-509.176) [-502.675] -- 0:00:52
102500 -- (-502.923) (-504.936) (-503.675) [-505.779] * [-502.676] (-506.344) (-507.594) (-502.526) -- 0:00:52
103000 -- [-502.917] (-506.478) (-507.079) (-506.197) * (-502.277) (-506.530) [-503.146] (-505.037) -- 0:00:52
103500 -- (-507.066) [-503.786] (-506.208) (-503.658) * [-502.421] (-505.315) (-504.102) (-502.895) -- 0:00:51
104000 -- [-503.936] (-503.798) (-502.612) (-502.991) * (-503.620) [-503.629] (-503.790) (-502.346) -- 0:00:51
104500 -- (-509.737) (-503.724) [-502.685] (-502.768) * (-505.084) (-509.707) (-503.930) [-502.664] -- 0:00:51
105000 -- (-502.557) (-503.155) [-504.061] (-505.110) * (-508.598) (-507.450) [-502.478] (-502.724) -- 0:00:51
Average standard deviation of split frequencies: 0.017566
105500 -- (-502.166) (-502.878) (-506.087) [-502.086] * (-514.537) [-507.076] (-505.300) (-503.559) -- 0:00:50
106000 -- (-502.676) (-503.400) [-502.869] (-503.652) * (-507.305) [-514.034] (-505.034) (-502.157) -- 0:00:50
106500 -- (-505.472) [-502.917] (-502.976) (-504.353) * (-503.314) (-505.395) (-504.328) [-507.149] -- 0:00:50
107000 -- (-507.144) (-504.409) (-505.838) [-510.066] * [-508.243] (-505.446) (-503.721) (-503.259) -- 0:00:50
107500 -- (-504.394) (-504.687) [-507.016] (-510.183) * (-503.846) [-505.440] (-505.983) (-506.586) -- 0:00:49
108000 -- [-503.746] (-504.589) (-504.531) (-508.824) * (-504.085) [-506.017] (-507.173) (-508.300) -- 0:00:49
108500 -- (-505.034) (-503.124) (-506.225) [-505.959] * [-504.407] (-507.074) (-503.009) (-504.153) -- 0:00:49
109000 -- [-503.555] (-503.903) (-505.663) (-504.384) * (-505.407) [-502.770] (-503.680) (-503.446) -- 0:00:49
109500 -- (-502.971) (-502.632) (-503.226) [-503.307] * (-504.148) [-503.056] (-502.934) (-502.426) -- 0:00:48
110000 -- (-503.986) (-504.085) (-506.678) [-502.692] * (-505.800) (-503.277) [-504.649] (-503.148) -- 0:00:48
Average standard deviation of split frequencies: 0.019473
110500 -- (-504.119) [-504.471] (-503.713) (-504.925) * (-505.957) (-504.140) [-506.005] (-503.346) -- 0:00:48
111000 -- (-505.973) (-502.893) (-505.590) [-503.704] * (-508.487) (-504.259) (-503.932) [-505.462] -- 0:00:48
111500 -- [-505.055] (-503.336) (-503.348) (-512.324) * [-503.268] (-508.506) (-504.412) (-507.612) -- 0:00:47
112000 -- [-505.620] (-503.411) (-502.144) (-504.204) * (-503.475) (-504.170) (-503.235) [-502.744] -- 0:00:47
112500 -- (-505.766) (-503.212) [-502.691] (-503.632) * (-505.265) (-502.247) (-503.100) [-503.435] -- 0:00:47
113000 -- (-503.511) (-504.198) [-504.367] (-505.862) * [-509.311] (-502.311) (-505.980) (-502.465) -- 0:00:47
113500 -- (-505.513) [-504.378] (-502.246) (-507.307) * (-513.762) (-504.192) [-502.269] (-507.000) -- 0:00:46
114000 -- (-507.174) (-507.813) (-502.229) [-502.782] * (-505.112) [-502.428] (-503.400) (-508.333) -- 0:00:46
114500 -- (-504.168) (-506.277) (-503.745) [-502.831] * (-505.204) (-503.111) (-506.569) [-506.234] -- 0:00:54
115000 -- (-503.553) (-505.396) [-506.987] (-503.406) * [-503.354] (-504.106) (-502.764) (-506.829) -- 0:00:53
Average standard deviation of split frequencies: 0.016683
115500 -- (-504.705) [-505.429] (-504.275) (-505.261) * [-503.094] (-503.120) (-503.718) (-505.051) -- 0:00:53
116000 -- (-505.135) (-505.813) (-503.404) [-504.135] * (-506.549) [-502.773] (-504.053) (-503.940) -- 0:00:53
116500 -- (-505.116) (-507.575) [-502.655] (-504.802) * [-504.898] (-504.361) (-503.755) (-503.600) -- 0:00:53
117000 -- (-504.523) (-504.366) [-506.192] (-504.693) * (-505.377) (-504.050) [-506.087] (-502.615) -- 0:00:52
117500 -- [-502.999] (-505.459) (-504.299) (-503.812) * (-503.396) [-505.317] (-505.211) (-504.061) -- 0:00:52
118000 -- (-503.603) [-504.283] (-507.051) (-502.794) * (-503.599) (-512.024) (-504.879) [-503.981] -- 0:00:52
118500 -- [-503.738] (-508.934) (-504.571) (-503.010) * (-502.216) (-504.697) (-506.334) [-504.511] -- 0:00:52
119000 -- (-503.175) (-505.234) [-507.064] (-502.376) * (-504.454) (-507.414) (-506.818) [-503.033] -- 0:00:51
119500 -- (-508.635) (-502.234) (-502.953) [-503.319] * (-503.016) [-507.452] (-503.011) (-503.570) -- 0:00:51
120000 -- [-503.644] (-505.070) (-503.479) (-504.728) * [-504.127] (-507.556) (-503.957) (-504.077) -- 0:00:51
Average standard deviation of split frequencies: 0.015010
120500 -- (-504.784) (-503.512) [-504.790] (-505.035) * (-502.467) (-508.702) (-504.918) [-503.819] -- 0:00:51
121000 -- [-503.242] (-504.567) (-504.600) (-505.656) * [-502.066] (-509.442) (-507.191) (-503.238) -- 0:00:50
121500 -- (-502.477) [-504.468] (-502.268) (-505.945) * (-503.339) (-505.211) [-504.888] (-504.946) -- 0:00:50
122000 -- (-504.658) [-504.381] (-503.856) (-503.251) * (-504.278) (-505.139) (-502.666) [-502.496] -- 0:00:50
122500 -- [-504.119] (-503.633) (-504.732) (-502.796) * [-505.176] (-503.357) (-503.212) (-503.382) -- 0:00:50
123000 -- (-504.187) (-507.789) (-504.925) [-502.826] * (-506.313) [-506.865] (-503.505) (-504.475) -- 0:00:49
123500 -- [-507.375] (-505.290) (-502.742) (-504.446) * (-507.996) (-504.360) [-502.644] (-503.630) -- 0:00:49
124000 -- (-504.608) (-503.206) (-506.409) [-510.461] * (-505.233) (-504.413) [-503.962] (-504.406) -- 0:00:49
124500 -- [-503.681] (-503.553) (-506.543) (-509.828) * (-503.022) (-504.822) [-503.094] (-504.168) -- 0:00:49
125000 -- (-504.109) [-503.542] (-507.243) (-502.733) * (-505.825) (-503.638) [-502.659] (-505.207) -- 0:00:49
Average standard deviation of split frequencies: 0.014965
125500 -- (-507.273) (-504.300) [-502.432] (-502.481) * [-504.372] (-504.354) (-505.553) (-504.077) -- 0:00:48
126000 -- (-504.309) (-504.711) [-504.071] (-503.523) * (-505.686) (-504.506) [-504.469] (-503.061) -- 0:00:48
126500 -- [-504.415] (-504.964) (-506.066) (-502.516) * (-502.983) [-503.799] (-504.520) (-502.659) -- 0:00:48
127000 -- [-502.097] (-502.317) (-509.527) (-505.243) * [-506.482] (-503.745) (-502.557) (-504.439) -- 0:00:48
127500 -- (-504.128) (-504.362) (-502.264) [-506.374] * [-503.554] (-505.944) (-503.024) (-506.694) -- 0:00:47
128000 -- [-504.238] (-508.822) (-503.456) (-503.166) * (-503.755) (-505.008) [-505.369] (-503.116) -- 0:00:47
128500 -- (-502.741) (-502.348) [-502.372] (-506.963) * [-503.381] (-503.225) (-505.576) (-502.318) -- 0:00:47
129000 -- (-503.206) (-505.075) [-503.903] (-504.665) * (-505.860) (-503.423) (-503.223) [-505.461] -- 0:00:47
129500 -- (-504.509) (-503.377) [-504.049] (-504.326) * (-506.134) (-510.573) [-505.061] (-506.226) -- 0:00:47
130000 -- (-502.366) [-507.435] (-503.563) (-505.936) * [-505.364] (-505.982) (-503.170) (-510.483) -- 0:00:46
Average standard deviation of split frequencies: 0.014811
130500 -- (-503.563) (-506.157) (-503.232) [-504.609] * (-504.786) (-504.596) (-506.374) [-508.631] -- 0:00:46
131000 -- (-504.332) (-503.123) [-503.010] (-507.087) * (-503.974) (-505.803) (-507.956) [-504.855] -- 0:00:53
131500 -- (-507.265) (-506.295) [-503.803] (-506.228) * (-508.121) (-505.399) (-505.608) [-502.182] -- 0:00:52
132000 -- (-502.396) (-502.701) [-503.973] (-505.443) * [-506.168] (-504.398) (-505.781) (-505.667) -- 0:00:52
132500 -- (-502.856) (-504.765) [-502.686] (-505.125) * (-503.929) (-504.405) (-504.404) [-506.173] -- 0:00:52
133000 -- [-503.041] (-505.219) (-502.608) (-505.621) * (-504.898) (-505.341) [-505.453] (-503.204) -- 0:00:52
133500 -- [-503.332] (-510.480) (-504.934) (-507.989) * (-506.748) [-504.342] (-505.722) (-505.281) -- 0:00:51
134000 -- (-504.276) (-506.355) [-503.431] (-503.678) * (-506.152) (-502.990) [-503.876] (-503.844) -- 0:00:51
134500 -- (-506.445) (-507.189) [-505.097] (-504.224) * (-505.184) [-506.768] (-505.188) (-504.357) -- 0:00:51
135000 -- (-502.894) [-503.500] (-503.629) (-503.192) * (-504.105) (-506.572) [-505.424] (-506.168) -- 0:00:51
Average standard deviation of split frequencies: 0.014047
135500 -- (-504.116) (-505.597) [-505.520] (-503.842) * (-505.680) [-507.927] (-502.961) (-502.324) -- 0:00:51
136000 -- [-502.749] (-506.135) (-506.108) (-503.331) * [-509.494] (-503.372) (-503.510) (-507.747) -- 0:00:50
136500 -- (-506.931) [-504.969] (-504.324) (-504.614) * (-504.395) [-503.090] (-503.192) (-506.318) -- 0:00:50
137000 -- (-504.019) [-503.744] (-506.852) (-504.534) * [-505.105] (-503.043) (-504.206) (-504.151) -- 0:00:50
137500 -- [-504.270] (-504.394) (-504.639) (-504.161) * [-506.750] (-502.194) (-503.596) (-504.376) -- 0:00:50
138000 -- (-502.847) (-505.090) (-508.575) [-505.342] * (-504.342) (-503.558) [-503.295] (-503.662) -- 0:00:49
138500 -- [-503.593] (-506.852) (-505.257) (-504.564) * [-504.777] (-504.513) (-502.829) (-504.131) -- 0:00:49
139000 -- (-503.218) (-509.493) [-506.338] (-503.657) * [-504.553] (-504.142) (-507.175) (-506.111) -- 0:00:49
139500 -- (-505.004) [-506.461] (-507.754) (-504.899) * (-506.513) [-505.599] (-505.547) (-504.814) -- 0:00:49
140000 -- [-505.286] (-504.727) (-506.053) (-504.436) * (-502.668) (-503.997) (-504.943) [-506.119] -- 0:00:49
Average standard deviation of split frequencies: 0.013777
140500 -- (-506.986) (-504.049) (-504.459) [-509.222] * (-506.319) (-505.013) [-503.537] (-505.085) -- 0:00:48
141000 -- (-504.235) [-503.713] (-502.369) (-509.504) * [-505.259] (-503.432) (-508.448) (-503.915) -- 0:00:48
141500 -- (-503.163) [-503.387] (-505.042) (-504.779) * (-506.122) [-504.292] (-504.463) (-505.426) -- 0:00:48
142000 -- [-503.310] (-504.253) (-503.092) (-504.444) * (-504.777) (-505.742) [-501.992] (-503.588) -- 0:00:48
142500 -- (-504.694) (-503.930) (-506.235) [-502.939] * (-505.401) [-505.376] (-504.884) (-503.137) -- 0:00:48
143000 -- (-503.951) (-503.840) (-506.570) [-502.640] * (-503.325) (-502.986) [-502.608] (-504.580) -- 0:00:47
143500 -- (-504.928) (-504.195) (-510.478) [-504.565] * (-502.956) (-505.086) (-502.721) [-503.616] -- 0:00:47
144000 -- (-505.307) (-506.151) (-506.523) [-504.950] * (-507.123) (-504.092) (-504.789) [-503.301] -- 0:00:47
144500 -- (-508.855) [-505.469] (-506.988) (-502.792) * [-506.541] (-502.906) (-503.919) (-504.597) -- 0:00:47
145000 -- (-503.419) (-503.016) [-504.476] (-508.844) * (-502.665) (-505.715) [-503.939] (-502.881) -- 0:00:47
Average standard deviation of split frequencies: 0.014275
145500 -- (-507.151) (-503.500) [-503.346] (-504.014) * (-505.606) [-502.798] (-505.627) (-503.205) -- 0:00:46
146000 -- (-508.907) (-508.355) (-504.504) [-504.372] * (-505.196) [-504.584] (-503.290) (-502.715) -- 0:00:46
146500 -- [-507.932] (-509.592) (-502.297) (-506.142) * (-509.958) [-503.803] (-505.538) (-505.701) -- 0:00:46
147000 -- (-505.691) (-504.960) (-506.036) [-504.285] * (-509.520) (-506.744) (-504.384) [-504.342] -- 0:00:46
147500 -- [-503.645] (-505.659) (-509.159) (-503.289) * (-506.414) (-505.351) (-505.362) [-503.426] -- 0:00:52
148000 -- (-504.577) [-503.533] (-507.387) (-502.511) * (-502.742) (-505.500) (-504.180) [-503.925] -- 0:00:51
148500 -- [-505.175] (-503.698) (-504.211) (-504.107) * (-503.598) (-505.597) (-503.914) [-503.875] -- 0:00:51
149000 -- [-503.634] (-503.770) (-504.780) (-504.135) * (-505.908) (-506.011) [-503.246] (-502.374) -- 0:00:51
149500 -- (-503.936) [-506.030] (-504.064) (-509.285) * (-503.891) [-503.617] (-506.968) (-504.955) -- 0:00:51
150000 -- (-503.615) (-503.258) [-503.033] (-504.436) * (-506.693) [-504.847] (-510.432) (-502.919) -- 0:00:51
Average standard deviation of split frequencies: 0.015479
150500 -- (-503.468) (-504.924) [-504.810] (-502.468) * (-508.250) (-508.125) (-506.396) [-504.007] -- 0:00:50
151000 -- [-502.611] (-502.808) (-504.952) (-506.504) * [-503.328] (-505.080) (-506.103) (-505.145) -- 0:00:50
151500 -- (-503.380) (-506.321) [-503.005] (-505.779) * (-503.214) [-504.204] (-504.075) (-504.349) -- 0:00:50
152000 -- [-505.907] (-504.126) (-504.446) (-502.763) * (-503.378) (-507.126) (-502.911) [-507.277] -- 0:00:50
152500 -- (-504.877) (-507.619) [-504.840] (-504.656) * (-503.791) [-503.957] (-503.828) (-508.241) -- 0:00:50
153000 -- [-505.000] (-507.550) (-508.247) (-502.082) * (-504.955) (-503.020) [-505.142] (-505.835) -- 0:00:49
153500 -- [-503.454] (-504.596) (-504.719) (-506.068) * (-504.199) [-503.720] (-505.814) (-503.540) -- 0:00:49
154000 -- [-506.561] (-503.082) (-506.288) (-503.805) * (-502.753) (-502.487) [-502.947] (-507.560) -- 0:00:49
154500 -- (-504.236) (-504.179) (-506.307) [-508.361] * (-503.210) (-502.971) (-503.202) [-505.830] -- 0:00:49
155000 -- (-505.005) [-505.831] (-507.027) (-503.051) * (-503.686) (-505.063) [-503.565] (-505.621) -- 0:00:49
Average standard deviation of split frequencies: 0.015781
155500 -- (-502.982) (-503.881) (-506.433) [-503.252] * (-504.066) (-503.798) (-502.909) [-510.916] -- 0:00:48
156000 -- (-509.125) (-504.173) [-503.617] (-503.821) * (-505.309) [-505.556] (-506.025) (-507.807) -- 0:00:48
156500 -- (-503.853) (-505.483) [-505.390] (-505.546) * (-507.424) (-504.650) (-506.172) [-504.341] -- 0:00:48
157000 -- (-505.414) [-503.953] (-508.204) (-507.834) * [-507.777] (-502.733) (-506.271) (-506.460) -- 0:00:48
157500 -- (-505.465) (-503.391) [-504.591] (-506.808) * (-506.858) [-502.922] (-503.399) (-507.827) -- 0:00:48
158000 -- [-505.197] (-510.794) (-507.193) (-504.745) * (-506.793) [-502.804] (-503.399) (-503.777) -- 0:00:47
158500 -- (-504.139) (-508.509) [-508.295] (-511.006) * (-503.977) [-502.797] (-502.698) (-504.378) -- 0:00:47
159000 -- [-504.079] (-506.257) (-508.876) (-502.413) * (-503.749) (-504.730) (-507.881) [-504.316] -- 0:00:47
159500 -- [-504.594] (-505.834) (-505.994) (-504.655) * [-506.381] (-506.378) (-506.030) (-504.432) -- 0:00:47
160000 -- (-505.551) (-505.909) [-506.749] (-504.696) * (-504.461) [-506.536] (-503.206) (-503.008) -- 0:00:47
Average standard deviation of split frequencies: 0.013529
160500 -- [-505.473] (-503.721) (-504.279) (-503.027) * (-503.953) (-504.052) [-504.661] (-502.533) -- 0:00:47
161000 -- [-506.851] (-505.028) (-503.880) (-502.701) * (-505.665) (-508.100) [-502.337] (-507.673) -- 0:00:46
161500 -- (-508.291) (-504.191) [-504.933] (-503.545) * (-504.592) [-504.220] (-505.048) (-508.661) -- 0:00:46
162000 -- (-503.969) (-506.504) [-503.502] (-504.511) * (-505.371) (-503.239) [-504.251] (-505.786) -- 0:00:46
162500 -- (-506.624) [-504.139] (-503.970) (-504.900) * (-507.358) (-507.167) (-502.394) [-503.860] -- 0:00:46
163000 -- [-504.893] (-503.212) (-506.830) (-504.092) * (-506.043) (-503.259) (-504.152) [-503.135] -- 0:00:46
163500 -- [-503.473] (-503.814) (-504.679) (-503.518) * (-503.737) (-504.896) (-506.530) [-507.329] -- 0:00:46
164000 -- (-503.589) (-504.393) [-504.004] (-502.612) * (-504.491) (-503.201) (-503.368) [-505.622] -- 0:00:50
164500 -- [-506.666] (-505.074) (-508.685) (-503.841) * (-509.105) [-502.812] (-502.956) (-507.792) -- 0:00:50
165000 -- [-504.913] (-507.396) (-504.260) (-507.551) * (-505.270) (-505.497) (-505.244) [-503.632] -- 0:00:50
Average standard deviation of split frequencies: 0.014357
165500 -- (-504.363) [-504.575] (-503.632) (-504.688) * [-505.715] (-505.956) (-506.825) (-507.292) -- 0:00:50
166000 -- (-503.211) (-503.322) [-504.154] (-505.209) * (-502.405) (-505.434) [-504.724] (-509.324) -- 0:00:50
166500 -- (-503.091) (-506.625) (-504.202) [-503.085] * [-502.616] (-505.279) (-503.629) (-506.129) -- 0:00:50
167000 -- (-505.649) (-503.440) [-504.342] (-503.229) * (-505.785) [-507.529] (-505.486) (-503.390) -- 0:00:49
167500 -- (-509.326) (-504.753) [-509.183] (-503.538) * (-502.559) (-506.633) [-502.287] (-502.625) -- 0:00:49
168000 -- (-502.423) [-503.124] (-504.318) (-504.038) * (-503.234) (-509.268) (-503.532) [-503.155] -- 0:00:49
168500 -- (-505.667) [-504.586] (-504.179) (-504.848) * (-504.175) (-505.503) [-501.996] (-502.823) -- 0:00:49
169000 -- [-504.428] (-503.779) (-508.567) (-507.800) * (-503.649) [-504.006] (-504.240) (-506.062) -- 0:00:49
169500 -- (-504.874) [-503.482] (-503.866) (-508.475) * [-504.527] (-505.387) (-502.878) (-503.971) -- 0:00:48
170000 -- (-503.155) (-502.968) (-506.271) [-505.140] * (-502.892) [-504.772] (-506.596) (-502.677) -- 0:00:48
Average standard deviation of split frequencies: 0.015192
170500 -- (-502.642) [-503.239] (-506.972) (-508.017) * (-503.015) [-506.968] (-506.440) (-503.379) -- 0:00:48
171000 -- (-505.004) (-502.649) (-504.715) [-505.247] * [-506.046] (-504.837) (-503.332) (-505.293) -- 0:00:48
171500 -- [-504.119] (-506.454) (-503.957) (-506.945) * (-512.420) [-502.866] (-503.075) (-505.039) -- 0:00:48
172000 -- [-503.107] (-506.815) (-505.055) (-502.880) * (-502.802) [-503.158] (-503.613) (-503.594) -- 0:00:48
172500 -- [-507.582] (-505.442) (-504.033) (-503.683) * [-503.761] (-510.137) (-508.790) (-504.092) -- 0:00:47
173000 -- [-505.180] (-503.212) (-502.127) (-505.299) * [-502.719] (-511.354) (-504.296) (-503.287) -- 0:00:47
173500 -- (-503.697) [-503.909] (-503.859) (-505.016) * (-504.025) (-507.328) [-504.940] (-505.523) -- 0:00:47
174000 -- (-504.286) (-505.175) (-503.727) [-504.769] * (-508.507) (-503.147) (-504.326) [-503.591] -- 0:00:47
174500 -- (-507.321) (-503.813) (-503.288) [-507.373] * (-503.318) [-504.347] (-505.065) (-506.301) -- 0:00:47
175000 -- [-506.375] (-505.046) (-503.518) (-505.918) * [-505.456] (-506.364) (-504.092) (-504.293) -- 0:00:47
Average standard deviation of split frequencies: 0.013550
175500 -- (-508.889) (-504.354) (-504.266) [-504.441] * (-503.330) [-503.270] (-503.400) (-502.824) -- 0:00:46
176000 -- (-507.624) (-504.857) [-502.557] (-507.589) * (-503.800) (-502.739) [-503.689] (-506.334) -- 0:00:46
176500 -- (-509.790) [-502.743] (-505.892) (-503.788) * [-504.928] (-503.167) (-503.524) (-505.767) -- 0:00:46
177000 -- (-508.144) [-504.621] (-502.699) (-505.014) * (-505.901) (-505.562) (-504.884) [-502.319] -- 0:00:46
177500 -- (-511.223) (-504.082) (-503.178) [-504.657] * (-505.938) (-505.932) [-504.006] (-502.810) -- 0:00:46
178000 -- (-506.014) [-506.286] (-504.670) (-504.539) * (-502.889) (-503.387) [-502.154] (-503.041) -- 0:00:46
178500 -- [-507.010] (-507.423) (-504.335) (-503.885) * (-502.741) (-503.080) [-503.527] (-502.695) -- 0:00:46
179000 -- (-505.355) (-505.690) (-504.108) [-506.114] * (-503.490) (-503.583) (-505.168) [-502.639] -- 0:00:45
179500 -- (-503.329) (-509.664) [-503.614] (-506.421) * (-503.584) (-504.823) [-505.217] (-502.560) -- 0:00:45
180000 -- (-504.712) (-503.790) (-506.689) [-504.737] * (-504.176) [-503.032] (-502.832) (-503.807) -- 0:00:45
Average standard deviation of split frequencies: 0.015166
180500 -- (-507.943) [-505.384] (-502.543) (-505.217) * (-503.407) (-504.865) (-503.669) [-502.702] -- 0:00:45
181000 -- [-503.663] (-505.912) (-503.083) (-503.544) * (-503.514) (-506.574) [-503.303] (-502.407) -- 0:00:49
181500 -- (-502.930) [-505.754] (-504.085) (-503.236) * (-504.287) (-508.911) [-505.714] (-502.378) -- 0:00:49
182000 -- (-504.365) (-504.694) (-504.121) [-505.327] * [-504.270] (-507.498) (-504.348) (-503.925) -- 0:00:49
182500 -- (-503.804) (-505.310) [-506.085] (-505.392) * [-502.622] (-505.760) (-503.459) (-504.985) -- 0:00:49
183000 -- (-503.529) (-503.557) (-505.129) [-503.582] * (-502.725) [-503.137] (-506.514) (-506.784) -- 0:00:49
183500 -- (-504.043) (-504.603) (-506.377) [-508.224] * (-502.679) [-503.386] (-511.272) (-505.270) -- 0:00:48
184000 -- (-513.120) (-506.394) [-506.278] (-505.664) * [-502.679] (-509.628) (-504.600) (-502.851) -- 0:00:48
184500 -- (-507.113) [-505.500] (-504.852) (-501.867) * (-504.105) (-502.803) (-506.315) [-502.228] -- 0:00:48
185000 -- (-506.061) [-503.400] (-504.935) (-501.949) * (-503.134) (-507.779) [-505.145] (-503.697) -- 0:00:48
Average standard deviation of split frequencies: 0.015066
185500 -- [-503.338] (-504.492) (-502.660) (-504.380) * [-503.689] (-506.618) (-504.182) (-505.578) -- 0:00:48
186000 -- (-504.884) [-505.317] (-503.418) (-505.063) * [-505.950] (-507.870) (-505.521) (-503.244) -- 0:00:48
186500 -- [-505.067] (-506.808) (-506.962) (-504.201) * (-508.730) (-506.044) (-503.635) [-503.591] -- 0:00:47
187000 -- (-505.184) (-505.776) (-503.177) [-503.303] * (-504.187) [-504.321] (-505.987) (-503.998) -- 0:00:47
187500 -- [-505.951] (-506.559) (-505.388) (-508.350) * (-503.265) (-502.034) (-506.967) [-503.701] -- 0:00:47
188000 -- (-503.022) (-508.444) [-503.225] (-507.823) * [-503.421] (-502.141) (-506.982) (-504.016) -- 0:00:47
188500 -- [-505.222] (-503.648) (-502.845) (-505.116) * (-503.920) (-504.957) (-510.498) [-504.696] -- 0:00:47
189000 -- (-506.258) (-506.796) (-504.483) [-504.823] * (-505.152) [-505.435] (-507.161) (-504.239) -- 0:00:47
189500 -- (-504.518) (-505.269) (-503.768) [-502.560] * (-509.849) [-504.726] (-503.264) (-502.919) -- 0:00:47
190000 -- (-504.875) (-502.742) (-504.588) [-508.242] * (-508.760) [-502.553] (-504.857) (-504.420) -- 0:00:46
Average standard deviation of split frequencies: 0.016434
190500 -- [-506.790] (-504.392) (-507.577) (-504.864) * (-507.293) (-505.850) [-506.161] (-503.001) -- 0:00:46
191000 -- (-507.744) (-506.000) (-503.159) [-503.647] * [-506.513] (-511.197) (-505.181) (-503.811) -- 0:00:46
191500 -- (-509.558) (-503.093) [-504.138] (-506.498) * (-505.758) (-508.234) [-504.167] (-505.382) -- 0:00:46
192000 -- [-506.154] (-503.174) (-502.920) (-504.960) * (-505.910) [-503.673] (-502.891) (-503.472) -- 0:00:46
192500 -- (-504.686) (-505.094) [-502.705] (-502.967) * (-503.942) (-505.103) (-504.278) [-503.003] -- 0:00:46
193000 -- (-504.642) [-504.774] (-503.943) (-503.974) * [-502.663] (-503.175) (-503.913) (-504.565) -- 0:00:45
193500 -- (-504.177) (-504.775) (-507.859) [-502.898] * (-504.728) [-503.570] (-503.213) (-506.752) -- 0:00:45
194000 -- [-502.960] (-506.202) (-508.302) (-502.156) * (-503.250) (-505.530) [-505.362] (-507.387) -- 0:00:45
194500 -- (-504.412) [-503.683] (-506.652) (-502.690) * [-503.232] (-508.962) (-506.740) (-504.084) -- 0:00:45
195000 -- [-507.094] (-503.530) (-505.470) (-502.275) * (-505.798) (-504.826) (-507.135) [-505.561] -- 0:00:45
Average standard deviation of split frequencies: 0.016034
195500 -- [-504.625] (-508.783) (-503.795) (-503.055) * [-505.164] (-502.867) (-503.887) (-505.451) -- 0:00:45
196000 -- (-503.480) (-510.003) [-506.898] (-504.100) * (-504.740) (-502.026) [-506.212] (-505.974) -- 0:00:45
196500 -- [-502.827] (-508.796) (-503.257) (-502.417) * (-504.519) [-503.158] (-508.864) (-502.919) -- 0:00:44
197000 -- (-503.227) [-503.153] (-504.638) (-503.581) * (-502.689) (-505.153) (-506.159) [-503.585] -- 0:00:44
197500 -- (-503.830) [-502.815] (-503.918) (-506.010) * [-504.078] (-503.420) (-504.148) (-506.521) -- 0:00:48
198000 -- [-502.265] (-504.000) (-503.818) (-506.175) * (-505.658) [-503.310] (-505.090) (-502.858) -- 0:00:48
198500 -- (-503.467) [-503.713] (-502.671) (-503.684) * [-504.326] (-504.343) (-506.773) (-503.782) -- 0:00:48
199000 -- [-505.253] (-504.931) (-502.435) (-505.629) * (-503.690) (-504.956) [-504.625] (-502.731) -- 0:00:48
199500 -- (-502.810) (-504.407) [-505.133] (-507.172) * (-505.031) [-504.771] (-509.099) (-507.271) -- 0:00:48
200000 -- (-504.012) (-509.730) [-503.595] (-503.471) * (-506.293) (-504.178) (-506.148) [-503.971] -- 0:00:48
Average standard deviation of split frequencies: 0.015710
200500 -- (-508.362) (-505.055) (-502.421) [-502.958] * (-503.032) [-505.963] (-511.358) (-503.393) -- 0:00:47
201000 -- [-506.290] (-503.730) (-507.254) (-504.540) * [-503.788] (-506.911) (-506.322) (-503.253) -- 0:00:47
201500 -- (-504.169) [-502.561] (-506.165) (-502.808) * (-504.753) (-504.288) (-502.985) [-505.270] -- 0:00:47
202000 -- (-502.989) [-507.021] (-505.887) (-505.945) * [-506.673] (-507.745) (-506.260) (-504.278) -- 0:00:47
202500 -- [-503.696] (-505.560) (-504.581) (-506.158) * [-506.934] (-505.568) (-508.552) (-505.907) -- 0:00:47
203000 -- (-507.331) (-504.280) [-506.646] (-503.740) * [-505.767] (-504.310) (-505.015) (-504.984) -- 0:00:47
203500 -- [-505.286] (-504.951) (-503.585) (-503.375) * (-503.112) (-507.057) [-504.007] (-507.557) -- 0:00:46
204000 -- (-502.275) [-506.829] (-502.730) (-503.668) * (-503.208) (-505.987) (-503.081) [-506.711] -- 0:00:46
204500 -- (-503.613) (-505.921) (-507.069) [-502.261] * (-505.673) (-505.427) [-503.033] (-503.436) -- 0:00:46
205000 -- (-502.437) [-504.314] (-503.698) (-506.260) * (-504.445) (-504.607) (-503.946) [-503.654] -- 0:00:46
Average standard deviation of split frequencies: 0.013984
205500 -- (-507.512) [-507.097] (-506.841) (-504.025) * (-504.083) (-507.660) [-505.473] (-503.998) -- 0:00:46
206000 -- (-503.895) (-503.953) (-503.262) [-504.219] * (-504.370) (-505.276) [-504.156] (-503.000) -- 0:00:46
206500 -- [-504.272] (-504.265) (-508.574) (-503.325) * (-503.708) (-503.637) [-505.829] (-502.865) -- 0:00:46
207000 -- (-502.603) (-503.381) [-506.209] (-502.880) * (-505.900) (-504.790) (-503.925) [-504.221] -- 0:00:45
207500 -- (-505.988) [-503.708] (-505.842) (-503.798) * (-504.328) [-503.913] (-504.886) (-503.867) -- 0:00:45
208000 -- [-503.371] (-504.594) (-503.550) (-507.164) * [-503.104] (-503.434) (-506.374) (-502.342) -- 0:00:45
208500 -- (-502.266) [-505.309] (-505.066) (-504.226) * (-504.177) [-505.130] (-508.901) (-507.013) -- 0:00:45
209000 -- [-503.412] (-504.548) (-503.458) (-505.157) * (-502.734) (-503.899) (-502.474) [-502.267] -- 0:00:45
209500 -- (-502.110) [-503.111] (-503.227) (-507.038) * (-503.763) (-503.332) [-502.380] (-505.051) -- 0:00:45
210000 -- (-505.967) (-503.152) (-505.818) [-502.331] * (-504.196) (-508.521) (-502.135) [-503.161] -- 0:00:45
Average standard deviation of split frequencies: 0.014084
210500 -- (-504.044) (-503.038) [-504.492] (-504.880) * [-504.653] (-504.346) (-504.132) (-503.435) -- 0:00:45
211000 -- (-507.713) (-503.433) [-504.617] (-507.380) * (-505.793) (-504.268) (-504.773) [-503.283] -- 0:00:44
211500 -- (-505.029) [-505.339] (-505.104) (-503.436) * (-507.532) (-505.543) [-502.522] (-509.030) -- 0:00:48
212000 -- [-504.754] (-504.292) (-506.665) (-505.408) * (-504.636) [-504.605] (-503.707) (-505.307) -- 0:00:48
212500 -- (-504.968) (-504.352) [-505.217] (-509.091) * (-505.711) [-503.391] (-506.308) (-505.162) -- 0:00:48
213000 -- [-506.230] (-507.131) (-506.927) (-506.358) * [-501.998] (-502.927) (-503.311) (-503.677) -- 0:00:48
213500 -- [-504.238] (-502.848) (-503.808) (-503.730) * [-502.866] (-502.525) (-504.252) (-504.078) -- 0:00:47
214000 -- (-502.658) [-503.103] (-503.980) (-502.770) * (-503.087) [-502.591] (-503.616) (-507.640) -- 0:00:47
214500 -- (-504.060) [-503.083] (-504.990) (-503.573) * (-504.131) (-503.836) [-503.449] (-504.940) -- 0:00:47
215000 -- (-504.473) (-502.257) (-504.546) [-503.570] * [-504.741] (-503.626) (-508.493) (-502.955) -- 0:00:47
Average standard deviation of split frequencies: 0.013736
215500 -- (-502.392) (-503.864) (-507.779) [-502.589] * [-504.830] (-505.444) (-505.180) (-502.340) -- 0:00:47
216000 -- [-502.520] (-504.452) (-505.421) (-502.948) * (-503.962) (-508.317) [-503.653] (-503.974) -- 0:00:47
216500 -- (-505.474) [-507.699] (-505.486) (-506.854) * [-505.288] (-503.878) (-502.501) (-505.127) -- 0:00:47
217000 -- (-502.155) (-506.734) [-504.075] (-506.633) * (-504.434) [-504.182] (-503.316) (-504.368) -- 0:00:46
217500 -- (-503.680) (-506.770) [-504.860] (-506.247) * (-503.147) [-505.907] (-505.356) (-507.551) -- 0:00:46
218000 -- (-503.292) [-505.401] (-503.214) (-504.940) * (-503.746) [-512.656] (-506.283) (-502.307) -- 0:00:46
218500 -- (-504.947) (-503.258) (-504.419) [-504.967] * (-507.250) (-504.397) [-503.196] (-502.909) -- 0:00:46
219000 -- (-503.278) [-502.755] (-506.135) (-503.061) * (-512.764) [-505.035] (-504.724) (-502.951) -- 0:00:46
219500 -- [-503.714] (-502.775) (-505.254) (-503.639) * (-503.986) (-505.224) (-502.386) [-503.841] -- 0:00:46
220000 -- (-503.631) (-504.467) (-504.074) [-503.732] * (-505.063) (-503.543) [-502.599] (-508.853) -- 0:00:46
Average standard deviation of split frequencies: 0.014669
220500 -- (-505.558) (-503.494) [-502.783] (-504.963) * (-507.063) [-503.157] (-503.597) (-503.755) -- 0:00:45
221000 -- [-504.236] (-506.284) (-504.721) (-506.403) * (-504.917) [-504.678] (-505.065) (-502.119) -- 0:00:45
221500 -- (-504.491) [-503.813] (-503.921) (-503.442) * (-504.289) (-503.813) [-505.537] (-502.495) -- 0:00:45
222000 -- (-505.712) [-502.563] (-503.035) (-505.561) * (-505.520) (-509.170) [-502.036] (-503.093) -- 0:00:45
222500 -- (-502.601) (-504.300) (-502.760) [-505.842] * (-502.168) (-503.307) [-505.155] (-507.840) -- 0:00:45
223000 -- (-503.604) (-504.990) [-502.361] (-502.859) * (-502.593) [-503.752] (-504.218) (-503.924) -- 0:00:45
223500 -- (-502.700) (-503.654) (-510.040) [-503.773] * [-502.893] (-505.849) (-513.173) (-507.256) -- 0:00:45
224000 -- (-503.096) [-504.056] (-504.134) (-502.362) * [-502.395] (-503.224) (-505.378) (-508.220) -- 0:00:45
224500 -- (-506.971) [-506.358] (-504.516) (-505.512) * (-505.791) (-505.835) [-503.771] (-507.583) -- 0:00:44
225000 -- (-507.690) [-504.394] (-509.584) (-504.669) * (-503.028) (-502.761) (-506.434) [-504.074] -- 0:00:44
Average standard deviation of split frequencies: 0.013442
225500 -- (-503.647) [-509.432] (-503.079) (-504.172) * (-506.189) [-502.971] (-505.857) (-507.027) -- 0:00:44
226000 -- (-504.184) (-503.733) (-506.486) [-502.676] * (-503.104) (-503.993) (-505.079) [-502.472] -- 0:00:44
226500 -- (-504.154) (-503.834) [-511.889] (-504.542) * (-503.063) (-504.881) (-503.846) [-502.914] -- 0:00:47
227000 -- (-508.155) [-506.940] (-508.431) (-505.670) * [-503.965] (-506.889) (-503.817) (-505.725) -- 0:00:47
227500 -- (-504.799) (-504.888) [-504.424] (-513.251) * [-504.496] (-506.442) (-503.695) (-502.904) -- 0:00:47
228000 -- (-504.720) (-507.849) (-505.030) [-505.505] * (-503.884) [-509.323] (-502.392) (-504.190) -- 0:00:47
228500 -- (-506.052) (-506.968) [-503.834] (-508.546) * (-503.755) [-505.550] (-503.653) (-503.218) -- 0:00:47
229000 -- (-503.995) (-504.102) [-503.034] (-503.446) * (-511.094) (-504.304) (-502.549) [-502.706] -- 0:00:47
229500 -- (-507.892) (-502.739) [-502.700] (-503.340) * (-508.870) (-502.592) [-502.926] (-507.007) -- 0:00:47
230000 -- (-505.620) (-504.268) (-502.245) [-503.038] * (-503.883) (-504.231) [-502.912] (-503.577) -- 0:00:46
Average standard deviation of split frequencies: 0.011694
230500 -- [-504.262] (-507.760) (-502.560) (-502.394) * [-503.648] (-506.787) (-504.421) (-504.800) -- 0:00:46
231000 -- [-503.498] (-505.726) (-503.094) (-504.122) * (-503.198) (-504.708) (-502.581) [-508.740] -- 0:00:46
231500 -- [-503.254] (-508.770) (-502.894) (-504.642) * (-502.455) (-505.601) [-502.002] (-509.752) -- 0:00:46
232000 -- (-504.769) [-507.890] (-506.343) (-503.674) * (-505.458) (-505.519) (-504.429) [-505.617] -- 0:00:46
232500 -- (-505.228) (-503.812) [-503.081] (-505.572) * [-506.257] (-503.786) (-508.139) (-502.227) -- 0:00:46
233000 -- (-503.053) (-506.214) (-507.485) [-504.116] * (-502.515) (-502.395) (-508.830) [-503.078] -- 0:00:46
233500 -- [-506.003] (-503.770) (-504.928) (-505.454) * (-505.503) [-503.646] (-506.751) (-503.916) -- 0:00:45
234000 -- (-503.332) (-503.066) [-503.283] (-504.711) * (-503.335) (-503.489) [-503.799] (-503.801) -- 0:00:45
234500 -- [-503.158] (-503.847) (-502.832) (-503.325) * (-504.332) (-505.771) [-502.135] (-504.434) -- 0:00:45
235000 -- (-502.867) (-502.948) [-503.093] (-508.049) * (-502.756) [-506.021] (-502.879) (-504.328) -- 0:00:45
Average standard deviation of split frequencies: 0.012102
235500 -- (-506.759) (-503.877) [-503.604] (-504.528) * [-503.451] (-505.619) (-503.455) (-504.421) -- 0:00:45
236000 -- (-502.315) [-502.956] (-503.096) (-502.705) * (-502.880) (-506.328) (-505.287) [-505.200] -- 0:00:45
236500 -- [-506.952] (-502.690) (-503.122) (-504.256) * (-503.719) [-505.735] (-502.968) (-503.089) -- 0:00:45
237000 -- (-506.552) [-504.678] (-502.939) (-503.490) * [-504.583] (-504.155) (-503.998) (-502.731) -- 0:00:45
237500 -- (-504.528) (-504.057) [-503.607] (-510.011) * [-503.320] (-503.941) (-508.211) (-503.629) -- 0:00:44
238000 -- (-504.140) [-504.654] (-507.261) (-503.494) * (-503.839) (-503.472) [-506.512] (-505.147) -- 0:00:44
238500 -- (-502.724) [-501.979] (-505.022) (-503.709) * (-504.438) (-503.186) [-504.715] (-504.454) -- 0:00:44
239000 -- (-505.950) [-504.085] (-508.422) (-502.751) * [-505.794] (-504.847) (-504.194) (-510.716) -- 0:00:44
239500 -- [-503.006] (-505.007) (-505.195) (-502.195) * (-504.359) (-508.062) (-503.971) [-507.536] -- 0:00:44
240000 -- (-503.636) (-504.721) [-504.836] (-505.939) * (-503.437) (-505.081) (-502.737) [-502.238] -- 0:00:44
Average standard deviation of split frequencies: 0.011535
240500 -- (-502.818) (-504.115) [-506.907] (-509.486) * (-503.515) [-506.495] (-503.233) (-502.512) -- 0:00:44
241000 -- (-505.872) [-502.492] (-505.713) (-504.089) * (-504.161) (-504.198) (-504.802) [-505.559] -- 0:00:44
241500 -- (-504.839) (-505.710) (-510.893) [-505.526] * (-504.943) (-503.745) (-503.962) [-503.781] -- 0:00:43
242000 -- (-504.069) (-504.969) [-505.022] (-506.913) * (-504.220) (-503.149) (-510.836) [-503.195] -- 0:00:43
242500 -- (-508.529) [-502.498] (-503.723) (-504.900) * (-504.598) (-508.224) [-502.866] (-505.285) -- 0:00:43
243000 -- (-508.053) [-506.520] (-503.150) (-505.751) * (-507.862) (-508.717) [-504.202] (-503.860) -- 0:00:43
243500 -- [-503.464] (-506.084) (-507.652) (-505.190) * (-503.369) (-506.892) (-504.691) [-506.793] -- 0:00:46
244000 -- [-503.880] (-502.509) (-504.977) (-503.342) * (-505.510) (-502.278) [-504.278] (-505.457) -- 0:00:46
244500 -- (-504.374) (-503.237) [-502.477] (-502.752) * (-504.200) (-505.179) (-505.600) [-502.299] -- 0:00:46
245000 -- (-505.630) [-502.471] (-505.056) (-502.311) * (-504.947) [-502.799] (-502.453) (-503.101) -- 0:00:46
Average standard deviation of split frequencies: 0.011817
245500 -- (-504.205) (-503.784) (-505.298) [-502.041] * [-502.547] (-510.196) (-502.716) (-508.229) -- 0:00:46
246000 -- [-503.682] (-506.680) (-509.571) (-504.118) * [-505.781] (-503.129) (-504.840) (-505.399) -- 0:00:45
246500 -- (-507.690) (-503.512) [-506.973] (-504.065) * (-509.529) (-502.630) [-503.644] (-505.734) -- 0:00:45
247000 -- (-504.803) [-502.753] (-503.492) (-506.786) * (-506.676) (-504.185) (-503.678) [-505.782] -- 0:00:45
247500 -- (-504.685) (-505.418) (-505.661) [-502.941] * (-504.452) (-505.098) [-508.010] (-503.889) -- 0:00:45
248000 -- (-504.634) (-506.757) [-505.587] (-504.618) * (-502.115) (-503.369) [-504.420] (-503.446) -- 0:00:45
248500 -- (-504.101) (-503.949) [-504.944] (-503.035) * (-502.262) [-502.675] (-505.592) (-504.774) -- 0:00:45
249000 -- (-505.046) (-504.234) [-506.142] (-502.669) * (-502.107) (-504.844) [-502.290] (-505.519) -- 0:00:45
249500 -- (-503.045) (-504.196) (-505.656) [-504.661] * (-506.120) (-503.420) [-502.245] (-508.025) -- 0:00:45
250000 -- (-503.361) [-504.288] (-503.500) (-505.448) * (-509.954) (-503.402) [-504.313] (-503.925) -- 0:00:45
Average standard deviation of split frequencies: 0.013461
250500 -- [-509.125] (-502.626) (-506.616) (-505.360) * (-503.731) (-505.105) [-503.018] (-505.582) -- 0:00:44
251000 -- (-508.087) (-506.025) (-504.250) [-507.104] * (-505.235) (-504.472) (-505.564) [-504.997] -- 0:00:44
251500 -- [-504.320] (-503.615) (-504.610) (-507.550) * (-502.578) (-503.010) [-512.376] (-504.422) -- 0:00:44
252000 -- (-504.513) (-510.129) (-505.986) [-502.577] * (-503.249) [-504.528] (-507.241) (-505.364) -- 0:00:44
252500 -- [-506.556] (-507.824) (-507.789) (-503.701) * [-504.654] (-504.602) (-505.947) (-506.192) -- 0:00:44
253000 -- (-504.999) (-502.444) (-506.282) [-504.991] * [-502.943] (-505.003) (-509.650) (-504.364) -- 0:00:44
253500 -- [-505.013] (-504.255) (-506.831) (-503.378) * (-506.083) (-505.074) [-506.043] (-503.357) -- 0:00:44
254000 -- (-503.213) (-508.553) (-506.656) [-503.997] * (-508.998) [-505.625] (-503.768) (-503.179) -- 0:00:44
254500 -- [-503.798] (-504.362) (-506.509) (-508.136) * (-508.286) [-503.620] (-507.918) (-502.761) -- 0:00:43
255000 -- [-502.845] (-507.239) (-504.744) (-506.809) * (-508.685) [-504.402] (-503.162) (-504.798) -- 0:00:43
Average standard deviation of split frequencies: 0.012890
255500 -- [-505.263] (-505.721) (-505.390) (-505.678) * (-504.601) [-503.614] (-506.124) (-506.963) -- 0:00:43
256000 -- (-503.558) (-503.755) [-507.405] (-506.310) * (-502.794) [-506.679] (-505.454) (-504.641) -- 0:00:43
256500 -- (-503.345) (-503.239) (-506.296) [-503.403] * (-502.222) (-503.512) [-504.958] (-504.627) -- 0:00:43
257000 -- (-503.260) (-503.847) (-503.142) [-503.404] * (-506.832) (-504.811) [-503.876] (-504.231) -- 0:00:43
257500 -- (-503.787) (-504.494) (-507.992) [-504.719] * (-506.992) [-503.400] (-507.482) (-504.230) -- 0:00:43
258000 -- [-503.123] (-504.475) (-504.129) (-504.208) * (-505.223) (-505.052) (-503.314) [-503.593] -- 0:00:43
258500 -- (-503.649) (-503.042) (-506.035) [-503.798] * (-503.502) [-503.202] (-502.873) (-504.104) -- 0:00:43
259000 -- (-506.646) (-504.362) (-503.723) [-505.070] * (-502.801) (-502.238) (-503.400) [-504.308] -- 0:00:42
259500 -- (-504.543) (-503.169) [-504.078] (-509.269) * (-502.469) [-502.595] (-507.643) (-504.983) -- 0:00:42
260000 -- [-504.596] (-502.848) (-504.507) (-509.738) * (-503.627) (-502.334) (-506.740) [-504.311] -- 0:00:45
Average standard deviation of split frequencies: 0.011554
260500 -- [-503.970] (-504.755) (-505.247) (-506.317) * (-502.683) (-505.228) [-506.576] (-503.562) -- 0:00:45
261000 -- (-504.902) (-503.300) (-505.117) [-504.425] * (-503.777) (-505.582) (-506.483) [-503.830] -- 0:00:45
261500 -- (-503.255) (-502.879) (-505.013) [-503.270] * (-503.094) (-507.184) [-504.384] (-505.356) -- 0:00:45
262000 -- (-506.723) (-507.554) [-504.013] (-503.673) * (-502.844) [-504.403] (-503.759) (-506.187) -- 0:00:45
262500 -- (-502.989) (-504.090) [-505.341] (-504.058) * (-505.393) (-503.908) [-502.435] (-503.201) -- 0:00:44
263000 -- (-502.472) (-506.605) [-504.030] (-503.034) * (-508.808) [-504.555] (-505.360) (-502.614) -- 0:00:44
263500 -- (-503.722) (-504.630) [-503.542] (-505.101) * [-503.340] (-503.555) (-507.390) (-503.040) -- 0:00:44
264000 -- (-503.300) (-507.741) (-505.169) [-504.040] * [-510.542] (-503.422) (-505.450) (-503.837) -- 0:00:44
264500 -- [-507.469] (-507.278) (-503.239) (-504.150) * (-507.844) [-502.316] (-504.560) (-503.648) -- 0:00:44
265000 -- (-503.546) (-503.592) [-502.568] (-505.947) * (-502.688) [-503.035] (-503.720) (-502.385) -- 0:00:44
Average standard deviation of split frequencies: 0.012110
265500 -- (-504.951) (-506.367) (-505.272) [-503.860] * [-502.955] (-502.184) (-502.808) (-506.879) -- 0:00:44
266000 -- (-504.556) (-506.174) (-504.566) [-502.761] * (-505.795) [-504.231] (-502.886) (-512.012) -- 0:00:44
266500 -- (-505.933) (-504.411) [-508.685] (-506.165) * (-504.658) (-502.871) (-504.739) [-505.253] -- 0:00:44
267000 -- (-505.166) (-507.014) (-513.196) [-504.113] * [-505.348] (-502.984) (-504.964) (-504.017) -- 0:00:43
267500 -- (-504.246) (-504.247) [-503.772] (-504.800) * (-504.294) (-503.320) [-504.224] (-502.795) -- 0:00:43
268000 -- (-502.315) (-503.718) (-502.652) [-503.896] * (-502.388) [-502.338] (-505.562) (-502.784) -- 0:00:43
268500 -- (-505.074) [-503.963] (-504.415) (-505.671) * (-505.877) [-504.278] (-504.517) (-504.244) -- 0:00:43
269000 -- (-505.534) (-502.341) (-504.616) [-503.704] * (-504.256) [-505.750] (-505.992) (-505.196) -- 0:00:43
269500 -- (-502.731) (-508.418) (-505.626) [-504.147] * (-504.638) [-505.300] (-503.394) (-504.381) -- 0:00:43
270000 -- (-504.218) [-505.951] (-504.194) (-503.230) * [-503.314] (-503.711) (-502.466) (-504.478) -- 0:00:43
Average standard deviation of split frequencies: 0.011708
270500 -- (-503.749) [-503.577] (-506.733) (-505.875) * [-505.463] (-502.947) (-502.114) (-510.012) -- 0:00:43
271000 -- [-504.945] (-510.244) (-502.953) (-505.573) * (-502.871) (-503.680) [-502.529] (-502.415) -- 0:00:43
271500 -- (-503.743) (-507.722) (-505.281) [-505.744] * (-504.564) [-505.304] (-502.844) (-504.642) -- 0:00:42
272000 -- (-504.776) (-504.610) [-502.916] (-503.162) * [-506.807] (-502.525) (-502.825) (-504.322) -- 0:00:42
272500 -- (-506.312) (-506.259) (-502.741) [-503.080] * (-504.410) (-504.857) (-503.308) [-502.486] -- 0:00:42
273000 -- (-506.209) (-506.754) [-503.708] (-505.913) * [-503.454] (-505.225) (-503.047) (-503.379) -- 0:00:42
273500 -- (-505.098) (-504.405) (-504.058) [-502.998] * (-502.065) (-507.778) (-507.849) [-503.307] -- 0:00:42
274000 -- (-503.608) (-503.543) [-502.638] (-503.991) * [-502.354] (-508.058) (-508.522) (-502.637) -- 0:00:42
274500 -- (-505.009) (-505.022) (-505.567) [-502.188] * [-502.624] (-504.760) (-507.421) (-503.508) -- 0:00:42
275000 -- (-502.872) [-504.121] (-504.463) (-503.474) * (-504.700) (-504.090) (-503.014) [-503.136] -- 0:00:42
Average standard deviation of split frequencies: 0.011007
275500 -- (-504.602) [-505.078] (-502.909) (-505.213) * (-503.348) [-502.616] (-504.066) (-504.434) -- 0:00:42
276000 -- (-506.288) [-509.586] (-504.569) (-503.286) * [-502.387] (-504.380) (-502.991) (-503.509) -- 0:00:41
276500 -- [-505.957] (-504.695) (-506.136) (-504.759) * (-503.249) [-502.920] (-504.285) (-503.476) -- 0:00:41
277000 -- (-505.339) (-502.990) [-503.352] (-505.477) * [-503.720] (-504.897) (-504.117) (-506.874) -- 0:00:44
277500 -- [-503.327] (-503.508) (-505.981) (-503.704) * (-502.445) [-502.864] (-503.539) (-506.151) -- 0:00:44
278000 -- (-504.864) [-502.818] (-508.413) (-507.028) * (-503.957) (-502.279) (-503.475) [-504.147] -- 0:00:44
278500 -- (-506.355) (-502.948) (-503.665) [-505.083] * (-505.732) (-503.212) [-504.736] (-505.516) -- 0:00:44
279000 -- [-505.367] (-510.541) (-504.607) (-502.443) * (-504.826) (-503.507) [-505.053] (-506.467) -- 0:00:43
279500 -- (-505.189) [-505.970] (-506.212) (-505.774) * (-504.810) (-506.957) [-502.470] (-504.386) -- 0:00:43
280000 -- [-505.440] (-503.458) (-506.230) (-502.554) * (-503.197) (-503.125) (-502.829) [-506.441] -- 0:00:43
Average standard deviation of split frequencies: 0.010264
280500 -- (-513.136) (-502.296) [-508.842] (-509.370) * (-510.393) [-503.045] (-504.519) (-507.417) -- 0:00:43
281000 -- (-505.218) (-504.017) (-504.988) [-503.652] * (-510.090) (-502.805) [-503.688] (-503.109) -- 0:00:43
281500 -- [-503.850] (-504.673) (-505.854) (-505.804) * [-504.391] (-508.871) (-511.989) (-502.974) -- 0:00:43
282000 -- (-503.735) (-502.328) [-505.009] (-502.643) * [-507.752] (-505.786) (-507.310) (-504.243) -- 0:00:43
282500 -- (-505.839) [-502.666] (-504.169) (-502.249) * [-504.819] (-503.449) (-507.044) (-503.160) -- 0:00:43
283000 -- (-502.708) (-502.736) (-501.990) [-504.460] * (-507.520) [-502.750] (-504.688) (-507.616) -- 0:00:43
283500 -- (-503.404) [-508.148] (-505.731) (-504.312) * (-502.319) [-502.701] (-505.411) (-509.101) -- 0:00:42
284000 -- [-502.537] (-504.946) (-505.971) (-503.276) * (-503.121) [-504.165] (-504.485) (-503.695) -- 0:00:42
284500 -- (-503.464) (-508.927) [-502.924] (-503.723) * (-504.956) [-502.929] (-502.503) (-505.115) -- 0:00:42
285000 -- [-504.265] (-504.329) (-504.534) (-504.239) * (-505.547) (-502.481) [-503.347] (-506.066) -- 0:00:42
Average standard deviation of split frequencies: 0.009706
285500 -- (-504.229) (-502.313) [-508.116] (-507.409) * [-503.402] (-504.297) (-504.874) (-502.399) -- 0:00:42
286000 -- (-507.511) (-503.465) [-507.848] (-503.739) * (-505.248) (-503.781) [-507.078] (-502.218) -- 0:00:42
286500 -- (-505.533) (-502.923) (-509.122) [-505.052] * (-506.588) (-504.133) [-505.003] (-507.538) -- 0:00:42
287000 -- [-503.558] (-506.684) (-503.786) (-505.949) * (-502.590) (-504.301) (-505.506) [-507.829] -- 0:00:42
287500 -- (-503.687) [-504.090] (-507.034) (-505.391) * (-503.048) (-504.879) (-504.776) [-504.859] -- 0:00:42
288000 -- (-503.429) (-502.604) (-506.690) [-503.694] * (-504.251) (-504.054) (-505.543) [-505.436] -- 0:00:42
288500 -- [-503.589] (-506.603) (-506.798) (-502.535) * [-503.169] (-504.173) (-508.243) (-505.495) -- 0:00:41
289000 -- (-503.946) (-503.423) (-508.640) [-504.841] * (-502.363) (-504.692) [-509.751] (-506.931) -- 0:00:41
289500 -- (-503.762) (-506.366) (-502.874) [-504.841] * (-503.993) (-507.163) (-507.327) [-503.555] -- 0:00:41
290000 -- (-507.264) (-506.959) [-507.099] (-504.149) * (-503.351) (-506.819) (-505.563) [-503.115] -- 0:00:41
Average standard deviation of split frequencies: 0.008289
290500 -- (-506.942) [-502.980] (-508.198) (-505.777) * (-502.940) [-504.098] (-505.115) (-504.872) -- 0:00:41
291000 -- (-504.161) (-505.712) (-507.037) [-507.128] * (-504.030) (-503.780) (-505.234) [-502.769] -- 0:00:41
291500 -- (-506.802) [-502.756] (-504.097) (-504.837) * (-504.475) (-506.113) (-502.543) [-503.303] -- 0:00:41
292000 -- (-506.093) [-504.055] (-511.899) (-503.972) * [-502.577] (-503.148) (-504.782) (-505.928) -- 0:00:41
292500 -- [-505.961] (-505.932) (-504.409) (-504.102) * (-508.848) (-506.682) [-504.481] (-507.531) -- 0:00:41
293000 -- (-504.041) (-505.775) (-505.770) [-505.416] * (-505.233) [-504.059] (-506.776) (-502.681) -- 0:00:41
293500 -- (-503.492) [-504.522] (-505.484) (-509.043) * (-503.799) (-504.847) [-508.892] (-504.268) -- 0:00:43
294000 -- (-502.689) [-503.799] (-507.055) (-505.048) * [-502.482] (-506.565) (-502.726) (-503.562) -- 0:00:43
294500 -- [-503.994] (-504.257) (-503.076) (-502.437) * (-504.490) [-504.798] (-506.854) (-504.134) -- 0:00:43
295000 -- (-504.148) (-504.967) (-502.651) [-508.005] * (-505.535) (-504.545) [-503.749] (-508.759) -- 0:00:43
Average standard deviation of split frequencies: 0.009237
295500 -- (-503.145) [-507.089] (-502.778) (-504.279) * (-507.280) [-503.136] (-505.313) (-505.568) -- 0:00:42
296000 -- (-503.266) (-505.900) [-503.726] (-503.101) * (-505.615) (-508.739) (-504.269) [-503.237] -- 0:00:42
296500 -- [-502.955] (-503.721) (-505.986) (-503.473) * (-505.225) (-504.119) [-505.128] (-503.562) -- 0:00:42
297000 -- [-504.301] (-503.895) (-506.682) (-507.360) * [-507.309] (-504.564) (-502.408) (-506.926) -- 0:00:42
297500 -- (-506.382) [-502.927] (-508.107) (-505.293) * (-502.937) [-504.030] (-502.577) (-504.382) -- 0:00:42
298000 -- (-503.892) (-506.874) (-503.900) [-503.402] * [-504.014] (-505.127) (-508.608) (-503.251) -- 0:00:42
298500 -- [-502.100] (-508.162) (-503.265) (-506.666) * [-503.802] (-504.403) (-507.292) (-504.329) -- 0:00:42
299000 -- (-503.694) (-508.963) (-503.816) [-503.577] * (-503.874) [-505.462] (-502.570) (-503.042) -- 0:00:42
299500 -- (-502.107) (-504.787) [-502.232] (-504.295) * (-508.626) (-505.458) [-504.841] (-505.481) -- 0:00:42
300000 -- (-502.338) (-503.949) [-503.491] (-505.455) * (-503.427) [-505.901] (-504.860) (-503.592) -- 0:00:42
Average standard deviation of split frequencies: 0.007230
300500 -- [-502.338] (-503.944) (-505.189) (-502.523) * [-504.014] (-502.193) (-503.883) (-507.048) -- 0:00:41
301000 -- [-502.631] (-504.519) (-505.878) (-502.506) * [-502.611] (-505.235) (-505.980) (-503.823) -- 0:00:41
301500 -- (-502.689) (-505.032) (-503.316) [-505.685] * (-504.663) (-503.838) [-504.643] (-503.694) -- 0:00:41
302000 -- [-504.677] (-504.962) (-510.731) (-504.240) * (-507.370) [-505.158] (-509.099) (-503.354) -- 0:00:41
302500 -- (-505.241) (-507.271) [-504.536] (-504.980) * (-503.340) (-509.533) [-504.104] (-506.560) -- 0:00:41
303000 -- (-504.687) [-511.265] (-505.354) (-503.040) * (-506.992) (-503.327) [-502.214] (-503.511) -- 0:00:41
303500 -- (-503.255) (-504.357) (-506.248) [-503.789] * (-507.680) [-502.852] (-504.482) (-510.029) -- 0:00:41
304000 -- (-504.677) (-502.980) [-503.724] (-503.826) * [-504.221] (-505.892) (-502.908) (-503.634) -- 0:00:41
304500 -- (-506.723) (-503.663) [-504.733] (-502.406) * (-503.737) (-504.224) (-504.250) [-504.379] -- 0:00:41
305000 -- (-508.451) (-502.475) (-506.550) [-503.181] * [-503.604] (-506.039) (-506.984) (-503.269) -- 0:00:41
Average standard deviation of split frequencies: 0.007018
305500 -- (-506.078) [-505.679] (-505.393) (-502.849) * (-504.162) (-507.672) (-504.800) [-504.706] -- 0:00:40
306000 -- (-509.383) [-505.565] (-508.873) (-503.592) * (-504.851) (-503.110) (-503.752) [-502.936] -- 0:00:40
306500 -- [-504.899] (-507.118) (-503.460) (-504.591) * (-503.988) [-503.763] (-503.678) (-504.834) -- 0:00:40
307000 -- (-506.101) (-503.916) [-502.747] (-503.329) * (-503.066) (-509.382) [-503.843] (-505.270) -- 0:00:40
307500 -- (-504.594) (-503.252) [-502.463] (-503.556) * [-504.037] (-505.179) (-507.845) (-508.117) -- 0:00:40
308000 -- (-508.590) (-503.928) (-503.679) [-505.687] * (-504.803) (-502.314) [-505.716] (-508.456) -- 0:00:40
308500 -- (-507.476) (-506.360) [-504.162] (-503.777) * [-503.253] (-503.743) (-505.607) (-504.692) -- 0:00:40
309000 -- (-505.411) (-505.494) (-505.219) [-505.731] * [-502.750] (-508.380) (-502.256) (-503.203) -- 0:00:40
309500 -- [-503.917] (-504.188) (-506.592) (-502.393) * (-503.930) (-502.800) [-502.607] (-504.517) -- 0:00:40
310000 -- (-505.923) [-503.264] (-512.603) (-510.916) * [-508.187] (-504.993) (-503.912) (-506.807) -- 0:00:40
Average standard deviation of split frequencies: 0.006605
310500 -- (-503.789) (-507.145) [-509.340] (-503.781) * (-504.796) (-508.617) (-503.795) [-503.919] -- 0:00:42
311000 -- (-504.263) (-506.837) (-503.094) [-504.974] * (-503.076) (-508.872) [-507.967] (-503.236) -- 0:00:42
311500 -- (-502.840) (-506.416) [-503.094] (-503.163) * (-504.814) [-507.220] (-503.044) (-505.916) -- 0:00:41
312000 -- (-504.864) (-502.767) (-505.222) [-503.646] * (-504.839) (-503.886) (-502.495) [-504.669] -- 0:00:41
312500 -- [-503.051] (-502.607) (-504.949) (-504.049) * (-506.218) [-504.070] (-502.316) (-507.625) -- 0:00:41
313000 -- (-510.184) [-504.087] (-503.358) (-505.576) * (-504.086) (-503.604) [-506.793] (-503.565) -- 0:00:41
313500 -- [-504.576] (-504.706) (-504.806) (-502.808) * [-504.761] (-503.567) (-504.788) (-502.931) -- 0:00:41
314000 -- (-506.958) (-502.746) (-504.257) [-502.498] * [-504.403] (-502.448) (-503.558) (-508.832) -- 0:00:41
314500 -- (-502.403) [-503.267] (-503.211) (-502.045) * (-502.719) [-503.310] (-503.926) (-503.339) -- 0:00:41
315000 -- (-502.394) (-505.012) (-503.775) [-503.862] * (-503.587) (-502.928) (-505.792) [-506.175] -- 0:00:41
Average standard deviation of split frequencies: 0.007293
315500 -- (-503.386) (-506.750) [-504.588] (-503.815) * [-506.541] (-503.159) (-502.200) (-503.062) -- 0:00:41
316000 -- (-502.363) (-503.666) [-505.192] (-503.131) * [-505.083] (-505.061) (-504.596) (-504.329) -- 0:00:41
316500 -- (-504.834) (-504.028) [-505.094] (-503.263) * (-502.756) [-502.185] (-502.981) (-503.281) -- 0:00:41
317000 -- (-506.827) (-507.802) [-505.201] (-503.460) * (-503.064) [-505.196] (-503.753) (-502.491) -- 0:00:40
317500 -- (-502.465) (-503.414) [-509.667] (-504.368) * [-502.362] (-510.721) (-505.642) (-505.418) -- 0:00:40
318000 -- (-503.670) (-504.531) [-509.040] (-506.512) * (-502.865) [-504.717] (-503.218) (-504.404) -- 0:00:40
318500 -- (-505.707) (-505.202) [-505.536] (-505.423) * (-507.448) [-502.577] (-505.236) (-502.632) -- 0:00:40
319000 -- (-503.497) (-510.061) (-510.523) [-505.298] * (-504.440) [-502.666] (-507.230) (-506.871) -- 0:00:40
319500 -- (-506.601) [-505.990] (-505.997) (-510.178) * (-504.058) [-503.199] (-510.111) (-504.653) -- 0:00:40
320000 -- (-502.238) (-505.117) [-503.038] (-503.378) * [-504.275] (-506.680) (-505.053) (-505.282) -- 0:00:40
Average standard deviation of split frequencies: 0.006659
320500 -- (-506.270) [-503.443] (-505.472) (-502.494) * (-503.151) (-503.512) [-505.373] (-504.968) -- 0:00:40
321000 -- (-503.653) (-510.776) (-503.834) [-503.936] * (-503.447) [-502.644] (-502.631) (-504.869) -- 0:00:40
321500 -- (-504.049) (-509.769) [-503.711] (-505.907) * (-502.287) (-502.695) [-503.043] (-503.068) -- 0:00:40
322000 -- (-502.692) [-504.087] (-505.981) (-502.344) * (-502.771) [-503.380] (-503.118) (-505.377) -- 0:00:40
322500 -- (-504.611) [-504.263] (-505.383) (-503.078) * (-502.589) [-504.107] (-503.006) (-504.087) -- 0:00:39
323000 -- (-503.334) (-503.964) (-505.637) [-504.932] * [-502.714] (-506.086) (-505.834) (-503.742) -- 0:00:39
323500 -- (-502.795) [-505.577] (-503.946) (-502.482) * (-503.566) (-505.039) [-505.378] (-504.296) -- 0:00:39
324000 -- (-509.923) (-504.426) [-504.359] (-503.244) * (-505.942) (-504.386) (-504.212) [-505.077] -- 0:00:39
324500 -- [-506.330] (-504.094) (-506.278) (-503.822) * (-504.196) [-504.262] (-506.018) (-505.140) -- 0:00:39
325000 -- (-503.480) (-503.621) (-503.826) [-502.320] * (-504.484) (-507.735) [-504.433] (-503.722) -- 0:00:39
Average standard deviation of split frequencies: 0.006668
325500 -- [-503.673] (-504.785) (-504.443) (-505.153) * (-502.908) (-506.295) [-502.460] (-504.361) -- 0:00:39
326000 -- (-502.536) [-502.809] (-504.647) (-506.217) * (-502.515) (-507.713) [-502.906] (-504.492) -- 0:00:39
326500 -- (-506.847) (-503.154) (-505.175) [-503.167] * (-506.795) (-504.290) [-506.631] (-504.952) -- 0:00:39
327000 -- (-505.042) [-502.471] (-505.891) (-505.184) * (-505.849) [-504.207] (-505.972) (-504.753) -- 0:00:41
327500 -- (-504.918) (-505.297) [-509.641] (-504.109) * (-504.190) (-503.072) (-507.100) [-503.508] -- 0:00:41
328000 -- (-505.335) (-505.711) (-508.607) [-504.089] * (-501.970) [-505.492] (-503.594) (-505.671) -- 0:00:40
328500 -- (-508.020) (-503.263) (-502.271) [-503.830] * [-502.171] (-502.531) (-508.350) (-509.622) -- 0:00:40
329000 -- [-503.458] (-502.696) (-503.107) (-505.532) * [-505.587] (-503.576) (-509.766) (-505.074) -- 0:00:40
329500 -- (-504.761) [-504.641] (-505.794) (-502.400) * (-502.632) [-508.680] (-510.502) (-504.529) -- 0:00:40
330000 -- (-506.380) [-503.640] (-505.039) (-503.416) * (-503.456) (-506.919) [-505.866] (-503.962) -- 0:00:40
Average standard deviation of split frequencies: 0.007049
330500 -- [-502.143] (-505.894) (-505.945) (-502.872) * (-503.107) (-503.883) (-503.867) [-504.339] -- 0:00:40
331000 -- (-501.951) [-504.018] (-506.164) (-505.866) * (-506.905) [-503.884] (-502.879) (-503.299) -- 0:00:40
331500 -- (-504.313) [-504.990] (-504.145) (-505.148) * [-504.213] (-506.731) (-502.364) (-503.774) -- 0:00:40
332000 -- (-504.469) (-504.193) [-505.134] (-503.995) * (-503.950) (-505.236) [-503.473] (-504.250) -- 0:00:40
332500 -- (-502.395) (-503.823) (-507.086) [-502.726] * [-502.811] (-506.198) (-503.715) (-502.191) -- 0:00:40
333000 -- (-502.540) (-503.398) [-502.608] (-503.784) * (-502.371) (-506.494) [-503.279] (-504.569) -- 0:00:40
333500 -- (-503.381) (-503.112) [-503.254] (-502.608) * [-502.274] (-509.246) (-505.423) (-505.563) -- 0:00:39
334000 -- (-505.672) (-507.871) (-504.323) [-504.081] * [-502.152] (-502.147) (-503.561) (-504.721) -- 0:00:39
334500 -- (-508.417) (-504.779) (-503.373) [-503.248] * (-504.877) (-502.750) [-503.307] (-505.291) -- 0:00:39
335000 -- [-505.484] (-503.632) (-506.780) (-505.496) * (-503.098) [-503.671] (-512.835) (-507.994) -- 0:00:39
Average standard deviation of split frequencies: 0.006313
335500 -- (-504.240) (-503.284) (-504.896) [-513.911] * [-504.013] (-506.592) (-506.668) (-503.215) -- 0:00:39
336000 -- (-503.614) [-504.630] (-505.529) (-506.397) * (-506.342) (-503.436) (-502.891) [-505.165] -- 0:00:39
336500 -- (-503.145) (-504.955) (-502.751) [-502.593] * (-503.851) (-503.998) [-503.525] (-505.383) -- 0:00:39
337000 -- (-502.491) [-503.138] (-504.759) (-506.382) * [-504.897] (-503.894) (-502.942) (-505.830) -- 0:00:39
337500 -- (-506.211) [-504.251] (-506.327) (-503.917) * (-503.937) [-504.005] (-505.020) (-504.859) -- 0:00:39
338000 -- (-502.693) (-505.598) (-506.770) [-502.536] * (-505.050) [-505.053] (-502.931) (-503.538) -- 0:00:39
338500 -- [-504.879] (-503.974) (-507.009) (-502.516) * (-504.568) (-504.644) (-505.550) [-506.499] -- 0:00:39
339000 -- (-505.400) (-505.420) [-502.978] (-502.442) * (-508.139) (-503.378) [-502.473] (-503.715) -- 0:00:38
339500 -- (-506.430) (-505.872) (-502.273) [-505.089] * (-506.841) (-504.047) (-506.713) [-503.292] -- 0:00:38
340000 -- (-504.166) [-502.524] (-510.096) (-503.766) * (-508.387) [-502.383] (-504.331) (-505.023) -- 0:00:38
Average standard deviation of split frequencies: 0.005861
340500 -- [-502.077] (-507.042) (-509.105) (-504.329) * (-503.560) (-505.679) [-504.565] (-507.312) -- 0:00:38
341000 -- (-503.214) (-503.918) [-503.566] (-502.732) * (-508.490) (-503.463) (-507.447) [-503.717] -- 0:00:38
341500 -- (-505.709) (-505.666) (-502.445) [-504.986] * (-506.307) (-503.425) [-503.408] (-503.261) -- 0:00:38
342000 -- (-502.363) (-502.218) [-503.885] (-508.076) * [-504.000] (-502.570) (-502.496) (-502.842) -- 0:00:38
342500 -- [-504.485] (-504.160) (-503.410) (-506.038) * (-503.759) (-503.682) [-503.508] (-502.977) -- 0:00:38
343000 -- (-502.738) (-505.691) [-502.447] (-503.987) * (-505.575) (-505.386) [-504.926] (-502.706) -- 0:00:40
343500 -- (-504.902) (-504.415) [-504.748] (-504.064) * (-502.430) (-507.288) [-504.992] (-511.555) -- 0:00:40
344000 -- (-505.532) [-503.826] (-507.000) (-502.847) * [-503.501] (-504.340) (-502.478) (-503.543) -- 0:00:40
344500 -- (-510.919) (-504.131) (-505.858) [-506.319] * (-504.688) [-503.738] (-504.016) (-502.956) -- 0:00:39
345000 -- (-505.186) [-507.988] (-502.526) (-504.500) * [-502.591] (-506.320) (-503.619) (-503.169) -- 0:00:39
Average standard deviation of split frequencies: 0.006492
345500 -- (-502.871) [-507.536] (-503.698) (-503.576) * (-503.591) (-503.141) (-505.480) [-504.001] -- 0:00:39
346000 -- (-502.971) (-510.463) (-503.810) [-502.915] * (-505.441) [-502.571] (-502.579) (-504.294) -- 0:00:39
346500 -- [-503.205] (-503.184) (-503.410) (-503.532) * (-503.479) (-503.354) (-502.175) [-507.684] -- 0:00:39
347000 -- (-503.778) (-503.602) [-504.843] (-506.427) * [-503.708] (-502.691) (-503.990) (-504.368) -- 0:00:39
347500 -- (-505.510) [-503.321] (-507.454) (-503.664) * (-503.207) (-506.708) [-502.168] (-503.482) -- 0:00:39
348000 -- (-504.223) (-502.630) [-503.554] (-504.597) * (-504.192) [-506.020] (-503.234) (-503.780) -- 0:00:39
348500 -- (-505.473) (-503.618) (-503.230) [-503.488] * (-503.291) (-504.820) [-503.897] (-503.147) -- 0:00:39
349000 -- (-504.290) [-503.475] (-503.257) (-508.065) * (-509.306) (-505.178) (-504.024) [-503.657] -- 0:00:39
349500 -- (-505.471) (-503.355) [-502.748] (-504.496) * (-505.028) (-503.555) [-504.345] (-502.321) -- 0:00:39
350000 -- [-504.851] (-504.068) (-503.779) (-503.980) * (-503.768) (-503.412) [-508.549] (-504.668) -- 0:00:39
Average standard deviation of split frequencies: 0.008278
350500 -- (-504.996) (-503.532) (-504.923) [-503.161] * (-504.128) [-504.020] (-504.605) (-503.283) -- 0:00:38
351000 -- [-502.708] (-504.140) (-503.947) (-502.430) * (-506.139) (-504.837) [-505.772] (-507.527) -- 0:00:38
351500 -- (-504.505) [-507.118] (-502.504) (-504.989) * (-503.265) [-504.470] (-506.990) (-503.484) -- 0:00:38
352000 -- (-506.051) [-504.691] (-506.903) (-503.198) * (-504.410) [-503.980] (-504.952) (-502.639) -- 0:00:38
352500 -- (-506.378) [-502.672] (-504.854) (-503.287) * [-507.084] (-502.349) (-503.893) (-503.746) -- 0:00:38
353000 -- (-505.123) [-502.982] (-504.329) (-503.277) * [-503.333] (-502.014) (-503.850) (-504.812) -- 0:00:38
353500 -- [-502.568] (-502.831) (-509.274) (-502.224) * [-508.740] (-503.839) (-506.205) (-504.512) -- 0:00:38
354000 -- (-506.520) [-504.036] (-505.203) (-504.691) * [-506.650] (-503.264) (-504.275) (-503.512) -- 0:00:38
354500 -- [-502.797] (-508.226) (-506.864) (-507.817) * (-502.776) (-503.773) [-504.780] (-503.184) -- 0:00:38
355000 -- (-502.982) [-505.100] (-506.638) (-506.731) * (-503.927) (-506.961) (-504.736) [-504.322] -- 0:00:38
Average standard deviation of split frequencies: 0.008534
355500 -- (-503.096) [-502.913] (-504.560) (-506.454) * (-506.004) (-505.544) (-508.397) [-503.136] -- 0:00:38
356000 -- [-503.112] (-502.744) (-503.219) (-503.438) * [-506.122] (-505.118) (-503.588) (-505.047) -- 0:00:37
356500 -- (-504.592) (-503.002) [-504.470] (-505.684) * (-508.672) [-502.827] (-510.496) (-506.840) -- 0:00:37
357000 -- (-503.580) [-501.936] (-504.340) (-506.366) * (-506.239) (-502.258) (-504.378) [-506.913] -- 0:00:37
357500 -- [-509.611] (-502.256) (-507.164) (-504.962) * (-506.678) (-502.719) [-503.956] (-505.861) -- 0:00:37
358000 -- (-507.277) (-503.327) (-508.056) [-505.908] * (-506.451) (-504.001) [-503.493] (-505.106) -- 0:00:39
358500 -- (-504.073) (-503.894) (-502.350) [-505.581] * (-505.727) (-506.407) [-503.017] (-505.541) -- 0:00:39
359000 -- (-506.411) (-505.301) [-505.681] (-502.549) * (-504.523) (-504.498) [-503.132] (-504.159) -- 0:00:39
359500 -- (-507.323) (-504.490) [-503.858] (-502.585) * (-502.353) (-505.286) [-504.321] (-503.832) -- 0:00:39
360000 -- (-505.145) (-504.304) (-506.737) [-504.586] * (-507.947) (-503.872) [-508.319] (-506.495) -- 0:00:39
Average standard deviation of split frequencies: 0.007842
360500 -- [-502.734] (-503.340) (-505.964) (-511.332) * (-505.124) (-507.305) [-502.796] (-503.692) -- 0:00:39
361000 -- (-502.988) (-503.999) [-502.352] (-502.942) * (-504.678) (-503.574) (-503.292) [-504.960] -- 0:00:38
361500 -- (-503.185) (-504.598) (-504.565) [-503.391] * [-508.142] (-506.019) (-503.123) (-505.660) -- 0:00:38
362000 -- (-504.308) [-504.047] (-503.794) (-507.444) * [-502.640] (-506.781) (-504.390) (-505.995) -- 0:00:38
362500 -- (-504.479) (-503.518) [-502.755] (-504.499) * [-509.636] (-503.156) (-503.725) (-506.335) -- 0:00:38
363000 -- (-507.084) (-503.647) (-503.943) [-503.041] * (-503.671) [-502.779] (-504.262) (-503.206) -- 0:00:38
363500 -- [-505.645] (-509.551) (-504.879) (-503.692) * (-503.711) (-502.971) (-502.849) [-503.693] -- 0:00:38
364000 -- [-502.996] (-504.330) (-506.136) (-504.656) * (-505.019) [-505.427] (-503.304) (-502.944) -- 0:00:38
364500 -- (-503.412) [-503.761] (-505.129) (-504.164) * (-504.526) (-507.819) (-505.557) [-504.022] -- 0:00:38
365000 -- (-503.903) [-502.970] (-505.916) (-507.534) * (-505.045) (-502.989) (-510.811) [-503.760] -- 0:00:38
Average standard deviation of split frequencies: 0.008229
365500 -- [-504.269] (-508.355) (-507.903) (-503.613) * [-505.369] (-503.067) (-504.372) (-506.274) -- 0:00:38
366000 -- (-503.994) [-503.475] (-503.609) (-505.171) * (-504.496) (-505.198) (-503.899) [-504.341] -- 0:00:38
366500 -- (-503.849) [-504.596] (-506.251) (-503.765) * (-503.992) (-502.530) (-508.473) [-505.411] -- 0:00:38
367000 -- (-503.225) (-505.799) (-505.283) [-506.043] * [-505.505] (-504.024) (-502.832) (-503.309) -- 0:00:37
367500 -- (-504.896) (-504.783) [-505.444] (-504.050) * (-504.641) (-502.950) [-502.370] (-506.393) -- 0:00:37
368000 -- [-507.328] (-504.195) (-504.971) (-503.106) * (-503.251) [-503.261] (-504.643) (-505.545) -- 0:00:37
368500 -- (-502.089) (-505.214) [-504.424] (-504.446) * (-504.461) [-504.056] (-508.650) (-503.615) -- 0:00:37
369000 -- (-503.963) (-505.282) [-503.110] (-504.868) * (-503.791) [-504.249] (-506.012) (-503.122) -- 0:00:37
369500 -- (-507.111) (-504.672) (-504.435) [-505.378] * (-507.629) (-502.722) [-503.547] (-508.654) -- 0:00:37
370000 -- [-503.083] (-503.018) (-505.333) (-507.491) * (-509.613) (-503.613) (-503.386) [-504.800] -- 0:00:37
Average standard deviation of split frequencies: 0.007556
370500 -- (-505.727) (-502.966) (-503.631) [-505.126] * (-504.710) (-502.104) [-502.339] (-506.573) -- 0:00:37
371000 -- (-502.695) (-506.734) (-505.363) [-503.649] * (-505.064) (-503.337) [-503.027] (-503.896) -- 0:00:37
371500 -- (-503.306) (-504.183) [-505.179] (-503.586) * (-510.937) (-503.453) [-502.832] (-503.867) -- 0:00:37
372000 -- (-503.968) [-505.946] (-503.940) (-502.505) * (-507.520) [-505.352] (-504.680) (-503.886) -- 0:00:38
372500 -- (-504.217) (-505.591) (-504.047) [-502.155] * (-502.869) [-504.719] (-503.346) (-503.931) -- 0:00:38
373000 -- (-504.571) (-509.452) (-507.257) [-504.005] * (-509.039) [-502.855] (-502.494) (-502.502) -- 0:00:38
373500 -- [-502.784] (-504.504) (-503.201) (-511.244) * (-505.218) (-506.564) [-502.561] (-504.034) -- 0:00:38
374000 -- (-503.966) (-509.033) (-503.318) [-506.141] * [-506.487] (-506.392) (-502.351) (-506.154) -- 0:00:38
374500 -- (-503.206) (-504.885) [-503.690] (-505.599) * [-502.400] (-503.864) (-502.178) (-502.682) -- 0:00:38
375000 -- (-502.501) [-505.116] (-507.432) (-505.335) * [-502.949] (-505.672) (-505.213) (-503.463) -- 0:00:38
Average standard deviation of split frequencies: 0.008407
375500 -- [-503.000] (-503.024) (-506.077) (-507.642) * [-503.063] (-503.055) (-502.934) (-502.619) -- 0:00:38
376000 -- (-503.480) [-506.447] (-502.523) (-507.095) * [-505.464] (-507.407) (-503.912) (-503.879) -- 0:00:38
376500 -- (-504.949) (-507.616) (-506.452) [-502.962] * (-506.359) (-503.622) (-506.487) [-503.587] -- 0:00:38
377000 -- (-504.747) (-503.424) (-505.045) [-502.303] * (-503.623) [-503.610] (-505.955) (-503.564) -- 0:00:38
377500 -- [-503.101] (-502.771) (-504.186) (-502.499) * (-505.552) (-503.619) [-508.161] (-506.675) -- 0:00:37
378000 -- [-502.726] (-508.054) (-504.047) (-503.180) * (-505.412) (-504.432) (-505.471) [-503.134] -- 0:00:37
378500 -- [-506.346] (-505.810) (-504.359) (-503.171) * (-505.260) (-502.736) (-506.838) [-503.628] -- 0:00:37
379000 -- (-502.056) (-504.165) (-502.667) [-506.726] * [-502.704] (-504.305) (-506.306) (-505.668) -- 0:00:37
379500 -- (-504.319) [-507.234] (-502.715) (-503.893) * (-504.388) (-506.143) [-502.565] (-504.655) -- 0:00:37
380000 -- (-503.553) (-503.629) [-502.129] (-506.812) * (-506.557) [-504.324] (-504.222) (-504.434) -- 0:00:37
Average standard deviation of split frequencies: 0.008669
380500 -- [-505.108] (-505.272) (-503.705) (-505.041) * [-505.013] (-503.092) (-504.633) (-504.757) -- 0:00:37
381000 -- (-505.942) (-503.060) [-503.940] (-508.798) * (-507.003) [-503.001] (-503.432) (-505.402) -- 0:00:37
381500 -- (-503.636) (-504.594) [-503.822] (-506.743) * (-503.388) (-503.971) (-507.234) [-506.965] -- 0:00:37
382000 -- [-503.277] (-505.310) (-505.925) (-503.283) * (-504.272) (-503.995) (-503.798) [-503.646] -- 0:00:37
382500 -- [-505.458] (-503.320) (-505.446) (-503.836) * (-504.101) (-504.058) (-503.921) [-503.408] -- 0:00:37
383000 -- (-505.702) (-504.505) [-502.448] (-502.159) * [-503.977] (-503.657) (-502.230) (-503.267) -- 0:00:37
383500 -- [-502.315] (-503.307) (-505.599) (-503.449) * (-504.021) (-503.607) [-503.366] (-503.847) -- 0:00:36
384000 -- (-502.494) [-503.087] (-505.168) (-507.505) * (-504.866) (-508.946) (-502.918) [-502.858] -- 0:00:36
384500 -- (-504.738) (-504.960) (-504.181) [-506.178] * (-503.031) (-511.623) [-503.292] (-505.678) -- 0:00:36
385000 -- (-506.892) (-503.947) (-504.464) [-503.149] * (-503.898) (-503.797) (-502.967) [-503.213] -- 0:00:36
Average standard deviation of split frequencies: 0.008684
385500 -- (-505.155) (-513.827) (-503.521) [-503.223] * [-504.268] (-503.325) (-503.267) (-510.016) -- 0:00:36
386000 -- (-504.621) (-503.594) [-506.658] (-505.364) * [-504.003] (-503.758) (-504.559) (-507.687) -- 0:00:36
386500 -- (-505.324) [-505.223] (-504.337) (-504.735) * (-505.208) (-505.246) [-504.001] (-504.140) -- 0:00:36
387000 -- (-502.708) (-504.180) [-505.075] (-506.180) * (-504.813) (-508.818) [-504.176] (-503.788) -- 0:00:38
387500 -- (-502.876) (-503.276) (-505.302) [-505.878] * (-504.916) (-508.927) [-506.303] (-506.200) -- 0:00:37
388000 -- (-502.920) (-504.386) [-506.512] (-502.988) * (-506.617) (-503.647) (-505.549) [-502.557] -- 0:00:37
388500 -- (-507.300) [-506.556] (-503.907) (-504.681) * (-505.132) (-505.341) [-504.721] (-503.753) -- 0:00:37
389000 -- (-504.835) (-506.122) (-503.137) [-503.315] * (-504.150) [-504.873] (-503.702) (-506.656) -- 0:00:37
389500 -- (-502.144) (-502.669) [-503.616] (-504.925) * (-503.259) (-503.230) [-504.663] (-503.943) -- 0:00:37
390000 -- (-503.945) (-508.545) (-504.606) [-503.155] * (-504.346) (-502.475) [-503.728] (-503.375) -- 0:00:37
Average standard deviation of split frequencies: 0.007910
390500 -- (-504.493) (-502.921) [-507.054] (-506.703) * [-505.135] (-503.527) (-503.208) (-504.410) -- 0:00:37
391000 -- (-504.931) (-506.210) [-505.029] (-505.569) * [-505.388] (-504.307) (-503.245) (-503.293) -- 0:00:37
391500 -- [-503.750] (-506.356) (-502.961) (-505.294) * [-511.025] (-504.033) (-502.089) (-502.750) -- 0:00:37
392000 -- (-504.844) (-503.083) (-503.426) [-502.480] * (-503.340) (-506.773) [-502.812] (-503.687) -- 0:00:37
392500 -- [-505.848] (-503.362) (-504.922) (-505.394) * [-504.783] (-505.102) (-502.042) (-503.979) -- 0:00:37
393000 -- [-505.937] (-509.762) (-503.697) (-509.558) * [-503.825] (-505.372) (-503.476) (-502.575) -- 0:00:37
393500 -- (-504.283) [-504.057] (-504.131) (-505.825) * (-503.658) (-503.829) (-502.607) [-502.585] -- 0:00:36
394000 -- (-511.180) (-504.868) (-503.155) [-506.979] * (-503.843) (-503.401) (-504.987) [-503.049] -- 0:00:36
394500 -- (-506.370) (-506.137) (-508.383) [-503.335] * (-505.767) (-503.753) [-504.956] (-503.738) -- 0:00:36
395000 -- (-505.108) [-503.284] (-502.297) (-505.095) * (-502.475) [-503.926] (-503.145) (-503.048) -- 0:00:36
Average standard deviation of split frequencies: 0.007804
395500 -- (-504.417) (-503.134) [-502.677] (-504.997) * (-502.441) (-506.958) (-504.421) [-505.896] -- 0:00:36
396000 -- (-504.974) (-505.842) (-502.246) [-503.663] * (-505.966) (-505.911) (-504.391) [-502.738] -- 0:00:36
396500 -- (-505.684) (-506.093) [-502.246] (-502.400) * (-509.532) [-502.880] (-504.407) (-502.445) -- 0:00:36
397000 -- [-507.216] (-509.060) (-503.553) (-506.250) * (-503.749) [-503.723] (-504.008) (-505.624) -- 0:00:36
397500 -- (-502.540) (-504.471) [-504.307] (-504.164) * [-505.733] (-502.181) (-502.914) (-503.433) -- 0:00:36
398000 -- [-507.245] (-504.193) (-503.098) (-502.481) * (-509.470) [-505.187] (-502.258) (-507.983) -- 0:00:36
398500 -- (-511.629) [-504.060] (-502.158) (-507.371) * (-504.043) (-502.572) [-504.541] (-505.493) -- 0:00:36
399000 -- [-504.666] (-505.256) (-505.902) (-506.120) * (-502.901) (-505.644) [-506.577] (-503.119) -- 0:00:36
399500 -- (-505.786) (-503.244) [-505.850] (-502.674) * [-502.616] (-505.199) (-503.532) (-507.165) -- 0:00:36
400000 -- (-502.282) (-505.485) [-507.069] (-504.045) * (-502.984) (-503.522) [-503.948] (-507.817) -- 0:00:36
Average standard deviation of split frequencies: 0.007974
400500 -- [-506.495] (-507.028) (-504.893) (-507.808) * (-502.586) (-504.221) [-503.578] (-507.584) -- 0:00:35
401000 -- (-505.402) (-506.757) [-503.258] (-503.408) * [-503.874] (-502.623) (-505.740) (-503.919) -- 0:00:35
401500 -- (-502.725) (-502.956) (-504.188) [-503.518] * (-504.688) [-502.621] (-506.720) (-504.700) -- 0:00:37
402000 -- [-504.610] (-507.851) (-511.559) (-503.297) * [-503.083] (-506.264) (-505.811) (-503.365) -- 0:00:37
402500 -- (-504.297) (-507.630) [-503.501] (-504.438) * (-502.709) (-517.344) [-506.045] (-502.936) -- 0:00:37
403000 -- [-503.297] (-507.832) (-505.429) (-502.671) * (-507.138) (-513.565) [-502.615] (-502.770) -- 0:00:37
403500 -- (-508.537) (-504.850) [-502.226] (-502.354) * (-514.526) (-507.114) (-506.022) [-503.308] -- 0:00:36
404000 -- (-505.024) (-505.651) [-503.873] (-504.996) * [-505.397] (-509.671) (-503.642) (-504.067) -- 0:00:36
404500 -- [-502.621] (-503.258) (-503.826) (-503.036) * (-504.027) (-506.358) (-503.322) [-504.406] -- 0:00:36
405000 -- (-502.367) [-504.280] (-507.274) (-503.526) * (-511.121) (-508.547) (-508.804) [-502.792] -- 0:00:36
Average standard deviation of split frequencies: 0.008861
405500 -- (-503.416) [-503.781] (-510.591) (-505.598) * [-502.513] (-510.122) (-506.347) (-507.204) -- 0:00:36
406000 -- (-502.036) (-504.110) [-509.039] (-506.384) * (-506.355) [-504.404] (-504.405) (-506.828) -- 0:00:36
406500 -- [-504.038] (-503.134) (-503.876) (-508.722) * [-503.276] (-503.906) (-506.806) (-505.364) -- 0:00:36
407000 -- (-504.936) (-505.541) [-503.767] (-504.041) * (-503.883) (-504.557) [-505.365] (-504.283) -- 0:00:36
407500 -- [-502.898] (-502.722) (-505.011) (-502.090) * (-505.306) [-502.924] (-507.186) (-505.613) -- 0:00:36
408000 -- (-503.016) (-503.427) (-502.338) [-503.172] * [-502.632] (-504.039) (-502.457) (-503.723) -- 0:00:36
408500 -- (-508.928) (-503.883) [-505.057] (-503.960) * [-502.374] (-504.662) (-504.180) (-504.577) -- 0:00:36
409000 -- (-510.118) (-502.680) (-504.619) [-506.036] * (-502.912) (-506.742) [-503.851] (-502.853) -- 0:00:36
409500 -- (-505.851) (-502.967) (-503.608) [-506.310] * [-503.807] (-504.174) (-505.098) (-503.175) -- 0:00:36
410000 -- (-505.095) (-503.395) (-505.491) [-503.079] * (-502.615) (-508.186) (-502.969) [-502.408] -- 0:00:35
Average standard deviation of split frequencies: 0.008458
410500 -- (-508.356) (-502.617) (-502.384) [-503.901] * [-504.202] (-504.487) (-502.619) (-504.685) -- 0:00:35
411000 -- [-502.583] (-504.021) (-507.539) (-504.140) * (-504.155) (-506.875) [-503.604] (-502.777) -- 0:00:35
411500 -- (-504.504) (-503.736) [-504.707] (-504.785) * (-505.081) (-507.667) [-503.255] (-506.096) -- 0:00:35
412000 -- (-505.168) (-505.746) (-505.140) [-505.711] * (-503.912) [-502.639] (-505.445) (-506.175) -- 0:00:35
412500 -- (-504.177) [-502.739] (-506.625) (-503.038) * (-504.518) (-503.445) [-509.169] (-504.814) -- 0:00:35
413000 -- (-506.377) (-503.167) (-504.940) [-503.266] * (-505.222) [-505.107] (-506.515) (-504.601) -- 0:00:35
413500 -- (-502.174) (-503.660) (-506.299) [-504.267] * (-506.066) [-503.623] (-502.333) (-505.890) -- 0:00:35
414000 -- (-502.871) [-503.204] (-504.518) (-503.765) * (-504.096) (-503.709) [-502.535] (-510.183) -- 0:00:35
414500 -- (-505.016) [-504.543] (-505.098) (-514.923) * [-504.715] (-503.791) (-504.135) (-504.682) -- 0:00:35
415000 -- (-508.707) (-508.013) (-508.719) [-506.956] * (-502.695) [-507.044] (-503.248) (-502.223) -- 0:00:35
Average standard deviation of split frequencies: 0.008121
415500 -- (-505.166) (-504.196) (-503.336) [-502.740] * (-504.173) [-504.522] (-504.274) (-503.390) -- 0:00:35
416000 -- [-504.107] (-505.310) (-505.940) (-502.457) * [-505.042] (-505.710) (-505.866) (-504.165) -- 0:00:35
416500 -- [-503.620] (-503.114) (-505.289) (-503.926) * (-505.512) (-504.808) (-502.685) [-506.278] -- 0:00:35
417000 -- [-505.349] (-508.526) (-507.875) (-505.571) * (-503.564) [-504.484] (-503.326) (-502.982) -- 0:00:34
417500 -- (-505.634) (-508.573) [-504.806] (-509.534) * (-505.256) (-502.930) [-502.843] (-506.071) -- 0:00:36
418000 -- (-502.870) (-512.804) [-504.473] (-503.285) * (-505.109) (-503.958) (-504.149) [-504.938] -- 0:00:36
418500 -- (-506.532) (-503.009) (-505.540) [-505.570] * (-503.738) [-503.202] (-506.644) (-502.914) -- 0:00:36
419000 -- [-504.774] (-505.308) (-509.375) (-505.469) * [-503.232] (-503.323) (-506.333) (-503.744) -- 0:00:36
419500 -- (-506.451) (-504.810) [-503.527] (-504.021) * (-504.603) [-503.336] (-507.096) (-506.010) -- 0:00:35
420000 -- (-504.213) [-503.186] (-503.982) (-505.007) * [-504.982] (-506.134) (-504.762) (-505.741) -- 0:00:35
Average standard deviation of split frequencies: 0.008280
420500 -- (-507.345) (-503.180) [-504.666] (-504.526) * [-502.734] (-504.337) (-506.067) (-503.707) -- 0:00:35
421000 -- [-505.316] (-503.622) (-505.034) (-502.286) * (-503.125) [-503.420] (-504.391) (-504.279) -- 0:00:35
421500 -- (-504.226) [-505.897] (-501.973) (-502.594) * (-504.230) (-504.576) (-505.534) [-503.660] -- 0:00:35
422000 -- (-503.243) [-505.655] (-507.100) (-506.767) * (-504.488) [-504.614] (-504.180) (-504.397) -- 0:00:35
422500 -- (-503.240) (-505.137) (-502.934) [-509.148] * (-503.327) [-502.527] (-504.557) (-503.216) -- 0:00:35
423000 -- (-502.924) [-508.890] (-504.841) (-513.243) * [-505.902] (-504.614) (-510.045) (-502.743) -- 0:00:35
423500 -- (-502.739) (-504.259) [-502.718] (-509.946) * (-508.120) (-504.648) [-506.467] (-505.124) -- 0:00:35
424000 -- (-503.308) [-505.038] (-506.500) (-509.417) * (-507.001) (-503.930) (-506.009) [-504.101] -- 0:00:35
424500 -- (-507.290) (-504.163) [-505.469] (-507.230) * (-503.448) (-503.738) (-503.524) [-504.288] -- 0:00:35
425000 -- (-504.466) [-505.596] (-503.583) (-506.810) * (-503.384) (-505.397) [-506.511] (-506.284) -- 0:00:35
Average standard deviation of split frequencies: 0.008053
425500 -- (-504.779) [-502.604] (-509.653) (-503.613) * (-502.344) (-504.558) (-508.479) [-503.375] -- 0:00:35
426000 -- (-505.345) (-507.536) [-502.392] (-507.062) * [-502.743] (-503.232) (-505.817) (-503.110) -- 0:00:35
426500 -- (-506.430) (-505.511) [-503.728] (-504.374) * (-503.442) [-504.646] (-504.259) (-503.645) -- 0:00:34
427000 -- (-504.924) (-508.287) [-504.372] (-504.281) * (-503.220) (-505.721) [-503.035] (-503.269) -- 0:00:34
427500 -- (-502.186) [-503.370] (-503.520) (-504.459) * (-503.993) (-506.802) (-503.315) [-502.180] -- 0:00:34
428000 -- (-507.593) (-503.465) [-505.136] (-504.564) * (-503.274) (-507.001) [-502.871] (-502.053) -- 0:00:34
428500 -- (-506.756) (-508.264) (-504.805) [-504.936] * (-504.863) (-503.179) [-503.571] (-503.209) -- 0:00:34
429000 -- (-505.803) [-504.143] (-503.948) (-503.760) * [-501.950] (-503.473) (-502.769) (-503.474) -- 0:00:34
429500 -- (-505.231) (-503.856) (-505.134) [-501.919] * [-502.000] (-502.196) (-506.266) (-507.096) -- 0:00:34
430000 -- [-504.053] (-503.511) (-504.241) (-504.114) * (-504.073) (-503.781) [-506.520] (-503.601) -- 0:00:34
Average standard deviation of split frequencies: 0.007966
430500 -- (-503.664) (-504.901) [-503.804] (-502.318) * (-502.972) (-503.840) [-508.454] (-503.480) -- 0:00:34
431000 -- (-502.966) (-505.151) (-502.649) [-502.767] * (-504.494) [-503.885] (-504.088) (-511.266) -- 0:00:34
431500 -- [-505.758] (-507.270) (-503.498) (-503.593) * (-503.026) (-506.253) (-503.517) [-504.860] -- 0:00:34
432000 -- [-505.160] (-506.129) (-503.147) (-503.203) * (-504.737) (-503.357) [-505.338] (-505.102) -- 0:00:34
432500 -- [-503.471] (-503.261) (-505.527) (-502.688) * [-507.018] (-505.196) (-504.003) (-503.597) -- 0:00:34
433000 -- [-504.378] (-503.089) (-505.613) (-505.905) * (-505.309) (-506.528) (-505.365) [-502.753] -- 0:00:34
433500 -- (-504.552) [-503.946] (-503.520) (-505.053) * (-509.331) (-502.880) (-505.922) [-503.078] -- 0:00:35
434000 -- [-503.634] (-503.003) (-505.637) (-505.092) * (-504.687) [-503.775] (-503.555) (-502.596) -- 0:00:35
434500 -- (-505.873) (-506.822) (-504.570) [-501.956] * [-502.931] (-504.279) (-503.778) (-502.719) -- 0:00:35
435000 -- (-503.679) (-504.591) (-510.787) [-503.904] * (-504.942) (-506.216) (-506.883) [-502.228] -- 0:00:35
Average standard deviation of split frequencies: 0.007689
435500 -- (-503.859) [-506.024] (-504.303) (-506.229) * (-502.735) (-503.167) [-504.134] (-504.074) -- 0:00:34
436000 -- (-503.944) (-508.191) [-503.264] (-504.447) * [-502.900] (-504.068) (-504.608) (-502.672) -- 0:00:34
436500 -- (-502.618) (-503.560) (-504.155) [-503.494] * [-505.800] (-503.816) (-506.282) (-504.523) -- 0:00:34
437000 -- (-502.826) [-503.496] (-504.831) (-503.691) * (-504.865) [-505.059] (-508.547) (-504.531) -- 0:00:34
437500 -- (-502.310) [-502.553] (-503.611) (-503.476) * (-503.050) (-505.243) (-502.354) [-504.434] -- 0:00:34
438000 -- (-502.729) [-503.975] (-505.066) (-502.476) * [-505.155] (-505.287) (-503.681) (-507.209) -- 0:00:34
438500 -- (-504.998) (-508.638) [-503.326] (-503.100) * (-503.125) (-507.454) [-503.160] (-507.004) -- 0:00:34
439000 -- (-505.049) [-504.684] (-502.958) (-502.312) * (-502.325) [-505.263] (-505.864) (-505.479) -- 0:00:34
439500 -- [-502.936] (-505.627) (-502.488) (-504.451) * [-503.202] (-507.243) (-505.228) (-502.452) -- 0:00:34
440000 -- [-502.664] (-505.454) (-503.403) (-503.381) * (-503.775) (-502.571) (-503.806) [-503.746] -- 0:00:34
Average standard deviation of split frequencies: 0.007904
440500 -- (-504.496) (-504.039) (-504.629) [-502.862] * [-507.503] (-503.677) (-507.166) (-502.868) -- 0:00:34
441000 -- (-503.144) (-505.111) (-509.360) [-502.666] * (-503.144) [-503.429] (-506.730) (-507.630) -- 0:00:34
441500 -- (-507.003) [-504.900] (-502.901) (-508.484) * (-505.270) (-504.957) (-504.394) [-506.346] -- 0:00:34
442000 -- [-503.910] (-508.997) (-506.858) (-505.670) * (-505.703) (-502.045) [-507.828] (-507.482) -- 0:00:34
442500 -- (-505.145) (-502.969) [-503.171] (-502.889) * (-506.236) [-504.608] (-504.500) (-504.492) -- 0:00:34
443000 -- (-508.732) (-504.866) [-506.916] (-503.431) * [-504.489] (-503.806) (-506.100) (-503.928) -- 0:00:33
443500 -- (-507.885) (-503.796) [-503.675] (-503.108) * (-503.085) (-504.071) (-506.807) [-502.604] -- 0:00:33
444000 -- [-504.316] (-504.290) (-503.051) (-503.667) * [-503.318] (-502.181) (-503.915) (-502.224) -- 0:00:33
444500 -- (-508.824) [-503.214] (-504.714) (-503.287) * [-503.667] (-503.173) (-506.937) (-506.423) -- 0:00:33
445000 -- (-506.338) [-503.248] (-505.270) (-507.775) * (-515.173) [-502.901] (-506.856) (-505.124) -- 0:00:33
Average standard deviation of split frequencies: 0.007868
445500 -- [-504.586] (-504.010) (-504.292) (-502.877) * [-505.238] (-504.015) (-508.557) (-507.862) -- 0:00:33
446000 -- (-509.190) [-502.147] (-504.057) (-502.787) * (-503.721) (-505.371) (-505.115) [-505.297] -- 0:00:33
446500 -- (-506.442) (-503.024) (-507.726) [-504.414] * (-504.292) [-503.025] (-508.013) (-505.315) -- 0:00:33
447000 -- [-505.421] (-505.388) (-508.817) (-504.970) * (-505.626) [-502.730] (-504.663) (-504.417) -- 0:00:33
447500 -- (-502.639) [-502.877] (-503.031) (-504.092) * (-503.399) (-503.318) [-503.669] (-504.268) -- 0:00:33
448000 -- (-506.337) [-503.560] (-502.587) (-506.322) * (-503.220) [-503.641] (-503.351) (-504.291) -- 0:00:33
448500 -- (-503.560) (-508.360) [-504.640] (-505.296) * [-504.728] (-502.392) (-503.107) (-503.909) -- 0:00:33
449000 -- (-503.219) (-503.763) [-504.329] (-504.435) * (-504.346) (-503.024) (-504.905) [-503.246] -- 0:00:33
449500 -- (-506.849) [-505.617] (-502.247) (-503.447) * (-506.520) (-502.499) [-502.489] (-502.872) -- 0:00:33
450000 -- [-504.136] (-502.717) (-504.153) (-503.109) * (-506.305) (-505.644) (-507.049) [-503.570] -- 0:00:34
Average standard deviation of split frequencies: 0.007496
450500 -- (-502.701) (-503.508) [-505.110] (-502.394) * (-503.310) [-503.085] (-503.696) (-503.601) -- 0:00:34
451000 -- (-504.456) (-508.183) [-505.814] (-504.678) * [-503.829] (-506.651) (-502.774) (-503.880) -- 0:00:34
451500 -- (-503.340) (-506.717) (-510.313) [-503.197] * (-504.552) (-503.959) (-503.204) [-504.159] -- 0:00:34
452000 -- (-505.573) (-504.613) (-504.302) [-502.859] * (-509.412) [-503.336] (-506.252) (-506.052) -- 0:00:33
452500 -- (-505.379) (-504.725) [-504.644] (-503.016) * (-505.936) (-508.885) (-505.941) [-507.401] -- 0:00:33
453000 -- [-503.468] (-503.974) (-507.276) (-504.702) * [-503.497] (-505.989) (-503.174) (-506.200) -- 0:00:33
453500 -- (-508.073) (-505.138) (-504.481) [-503.086] * (-503.253) (-504.616) [-510.214] (-505.949) -- 0:00:33
454000 -- (-505.917) [-503.397] (-507.449) (-504.075) * [-505.618] (-504.594) (-506.852) (-503.946) -- 0:00:33
454500 -- (-505.035) (-510.441) [-504.036] (-502.914) * (-503.791) (-507.642) [-503.264] (-502.609) -- 0:00:33
455000 -- [-505.605] (-507.832) (-503.766) (-504.429) * (-505.716) (-504.940) [-507.422] (-506.254) -- 0:00:33
Average standard deviation of split frequencies: 0.008141
455500 -- (-503.535) [-502.943] (-503.081) (-503.441) * [-503.798] (-504.291) (-503.929) (-503.591) -- 0:00:33
456000 -- (-504.687) [-503.388] (-505.256) (-505.926) * [-502.737] (-505.562) (-504.829) (-503.212) -- 0:00:33
456500 -- (-503.042) (-505.407) [-504.286] (-505.828) * (-506.182) (-505.162) [-504.641] (-503.043) -- 0:00:33
457000 -- [-505.370] (-505.004) (-502.806) (-503.898) * (-504.135) (-504.499) [-503.117] (-504.966) -- 0:00:33
457500 -- (-502.966) (-502.326) (-503.338) [-503.681] * [-506.112] (-502.612) (-503.861) (-504.519) -- 0:00:33
458000 -- (-506.018) [-505.621] (-505.892) (-503.799) * (-506.741) (-503.128) (-504.110) [-503.782] -- 0:00:33
458500 -- (-507.426) (-506.182) (-506.032) [-508.483] * (-511.402) [-504.841] (-502.503) (-503.527) -- 0:00:33
459000 -- (-505.405) [-505.173] (-508.115) (-506.026) * (-504.251) (-505.485) [-502.610] (-503.258) -- 0:00:33
459500 -- (-506.153) (-503.177) (-502.848) [-505.773] * [-504.420] (-506.735) (-504.680) (-503.645) -- 0:00:32
460000 -- [-505.205] (-502.353) (-506.809) (-505.716) * (-502.921) [-502.578] (-503.446) (-503.858) -- 0:00:32
Average standard deviation of split frequencies: 0.008728
460500 -- (-504.029) (-503.915) (-502.293) [-502.918] * (-503.923) (-504.080) [-503.927] (-505.372) -- 0:00:32
461000 -- (-504.123) (-503.404) [-504.962] (-503.666) * (-503.162) [-506.691] (-504.132) (-505.908) -- 0:00:32
461500 -- [-502.889] (-502.976) (-505.391) (-503.318) * (-505.350) [-504.022] (-504.154) (-505.327) -- 0:00:32
462000 -- (-504.340) (-503.100) (-504.409) [-502.017] * (-503.412) (-506.148) (-503.563) [-506.730] -- 0:00:32
462500 -- (-506.044) (-505.568) [-508.056] (-503.151) * (-503.210) (-507.704) (-503.578) [-506.258] -- 0:00:32
463000 -- (-503.008) (-505.900) (-504.640) [-505.235] * (-505.202) [-503.184] (-503.158) (-508.399) -- 0:00:32
463500 -- (-502.999) (-505.392) (-506.462) [-503.949] * (-504.220) (-502.844) [-505.759] (-505.354) -- 0:00:32
464000 -- (-505.601) [-503.852] (-507.087) (-504.776) * (-503.412) (-504.656) (-504.924) [-502.456] -- 0:00:32
464500 -- (-506.122) [-506.368] (-504.618) (-504.648) * (-504.845) (-504.516) (-508.427) [-506.671] -- 0:00:32
465000 -- (-505.442) (-510.971) (-504.740) [-504.393] * (-511.314) (-502.782) (-503.164) [-502.865] -- 0:00:32
Average standard deviation of split frequencies: 0.009045
465500 -- (-502.803) (-505.021) (-504.429) [-503.989] * (-503.438) (-501.862) [-504.508] (-503.116) -- 0:00:32
466000 -- [-503.958] (-503.567) (-504.590) (-503.186) * (-505.902) (-503.677) [-505.005] (-504.054) -- 0:00:32
466500 -- [-503.021] (-507.035) (-504.908) (-503.090) * (-503.245) (-505.041) [-503.705] (-504.797) -- 0:00:33
467000 -- (-510.242) (-502.704) (-503.643) [-508.431] * (-502.665) (-503.117) (-507.883) [-502.975] -- 0:00:33
467500 -- (-510.050) (-502.504) [-503.964] (-507.525) * (-505.268) (-505.753) [-502.841] (-504.514) -- 0:00:33
468000 -- [-508.071] (-504.804) (-507.080) (-503.672) * (-504.689) (-506.100) (-503.998) [-502.548] -- 0:00:32
468500 -- (-503.410) (-505.674) [-502.839] (-510.503) * (-502.505) (-504.674) (-506.184) [-503.503] -- 0:00:32
469000 -- [-502.889] (-507.905) (-505.553) (-503.710) * (-503.818) (-504.210) (-508.300) [-502.164] -- 0:00:32
469500 -- (-504.377) [-508.389] (-508.849) (-505.123) * (-503.412) [-503.148] (-508.741) (-504.313) -- 0:00:32
470000 -- (-503.712) [-504.738] (-502.594) (-503.572) * (-503.493) (-506.835) [-506.415] (-506.086) -- 0:00:32
Average standard deviation of split frequencies: 0.008248
470500 -- (-504.010) [-504.028] (-504.465) (-502.737) * (-503.897) (-503.722) (-506.008) [-505.088] -- 0:00:32
471000 -- (-504.962) (-505.798) [-504.222] (-503.653) * (-503.756) (-506.022) (-505.637) [-504.398] -- 0:00:32
471500 -- [-504.909] (-504.264) (-503.191) (-506.319) * [-502.337] (-507.690) (-504.566) (-506.301) -- 0:00:32
472000 -- [-502.722] (-502.380) (-504.723) (-503.775) * [-503.033] (-505.282) (-506.332) (-506.548) -- 0:00:32
472500 -- (-504.960) (-503.050) [-503.936] (-505.059) * [-504.554] (-503.614) (-503.246) (-505.139) -- 0:00:32
473000 -- [-503.300] (-503.922) (-503.811) (-502.424) * (-503.658) (-504.905) (-503.859) [-504.576] -- 0:00:32
473500 -- (-505.327) [-503.748] (-503.630) (-505.674) * (-502.890) [-505.592] (-504.982) (-503.066) -- 0:00:32
474000 -- [-504.012] (-506.469) (-503.526) (-505.781) * [-508.520] (-502.905) (-503.981) (-504.316) -- 0:00:32
474500 -- (-504.761) (-503.925) [-502.193] (-505.795) * (-506.034) (-502.691) (-507.442) [-508.941] -- 0:00:32
475000 -- (-504.689) (-504.404) [-502.277] (-505.316) * [-504.199] (-504.358) (-503.927) (-503.622) -- 0:00:32
Average standard deviation of split frequencies: 0.008108
475500 -- [-505.686] (-503.358) (-508.637) (-506.602) * (-503.047) (-502.816) [-504.089] (-503.598) -- 0:00:31
476000 -- (-504.242) (-504.111) (-502.997) [-505.193] * (-502.860) [-505.101] (-508.563) (-506.978) -- 0:00:31
476500 -- (-507.874) (-502.967) (-503.066) [-505.356] * (-505.540) (-505.644) (-506.888) [-505.087] -- 0:00:31
477000 -- (-507.201) (-505.975) [-502.929] (-505.122) * [-505.310] (-504.178) (-503.563) (-508.034) -- 0:00:31
477500 -- (-506.131) (-503.527) [-504.207] (-502.689) * [-503.535] (-504.393) (-506.013) (-505.141) -- 0:00:31
478000 -- [-505.951] (-504.315) (-504.791) (-508.219) * (-508.810) (-503.144) [-504.600] (-504.020) -- 0:00:31
478500 -- (-503.331) [-503.826] (-505.384) (-504.797) * (-505.191) (-504.028) (-504.275) [-504.708] -- 0:00:31
479000 -- (-505.197) [-503.446] (-504.194) (-503.237) * (-505.673) (-502.261) (-506.322) [-504.053] -- 0:00:31
479500 -- (-504.399) [-502.806] (-504.022) (-503.328) * (-501.943) [-502.741] (-505.005) (-504.531) -- 0:00:31
480000 -- [-502.444] (-502.489) (-503.939) (-506.602) * [-502.159] (-503.958) (-508.836) (-502.668) -- 0:00:31
Average standard deviation of split frequencies: 0.008581
480500 -- (-506.759) [-502.329] (-503.573) (-505.299) * [-503.413] (-502.311) (-510.645) (-507.672) -- 0:00:31
481000 -- (-508.058) (-503.752) [-504.232] (-502.767) * (-504.467) [-504.377] (-504.883) (-506.291) -- 0:00:31
481500 -- (-504.017) (-503.491) [-504.517] (-503.954) * (-502.283) (-504.198) [-504.041] (-505.995) -- 0:00:31
482000 -- (-502.920) [-502.356] (-504.477) (-502.596) * (-506.482) (-504.877) (-504.872) [-503.369] -- 0:00:31
482500 -- [-502.793] (-503.246) (-504.144) (-502.605) * [-504.200] (-502.907) (-504.598) (-503.429) -- 0:00:31
483000 -- (-505.034) [-504.697] (-503.079) (-502.605) * (-505.160) (-502.589) [-505.431] (-504.381) -- 0:00:32
483500 -- (-504.470) (-503.410) [-503.112] (-506.541) * (-503.217) (-504.130) (-506.353) [-504.269] -- 0:00:32
484000 -- [-503.576] (-505.738) (-504.114) (-505.127) * (-507.230) (-502.666) [-504.126] (-505.916) -- 0:00:31
484500 -- (-503.456) (-503.360) [-506.082] (-503.465) * (-502.678) (-506.607) [-503.338] (-503.865) -- 0:00:31
485000 -- (-507.118) (-505.308) (-507.448) [-503.849] * (-505.575) (-505.497) [-503.955] (-503.507) -- 0:00:31
Average standard deviation of split frequencies: 0.008501
485500 -- (-507.929) (-503.614) [-505.647] (-502.673) * (-503.669) [-506.905] (-503.551) (-504.290) -- 0:00:31
486000 -- [-502.356] (-507.083) (-502.501) (-505.314) * (-503.519) [-504.762] (-504.531) (-503.605) -- 0:00:31
486500 -- (-503.762) (-506.074) (-503.067) [-503.251] * (-503.042) [-503.293] (-506.073) (-502.893) -- 0:00:31
487000 -- [-502.219] (-504.563) (-506.004) (-504.318) * [-502.949] (-504.327) (-505.552) (-504.658) -- 0:00:31
487500 -- (-507.019) (-504.039) (-503.372) [-504.613] * [-502.862] (-505.136) (-502.904) (-502.624) -- 0:00:31
488000 -- [-504.687] (-503.258) (-503.312) (-506.332) * (-503.716) (-505.609) [-503.571] (-504.307) -- 0:00:31
488500 -- (-505.268) [-503.524] (-507.948) (-502.966) * (-505.687) (-505.038) [-503.345] (-505.701) -- 0:00:31
489000 -- [-503.788] (-507.261) (-507.051) (-504.919) * (-507.156) [-510.399] (-502.784) (-504.949) -- 0:00:31
489500 -- (-504.011) [-502.275] (-507.128) (-503.396) * (-504.862) [-504.096] (-502.439) (-505.248) -- 0:00:31
490000 -- (-506.863) (-505.274) (-503.712) [-507.882] * [-504.268] (-505.105) (-502.329) (-506.062) -- 0:00:31
Average standard deviation of split frequencies: 0.008308
490500 -- (-503.514) (-504.232) (-503.284) [-502.891] * (-504.726) (-502.727) [-503.804] (-502.916) -- 0:00:31
491000 -- (-503.469) (-503.631) [-506.638] (-502.450) * (-504.556) (-508.496) (-503.576) [-503.845] -- 0:00:31
491500 -- (-507.116) (-505.078) (-503.465) [-506.076] * (-504.473) (-503.668) (-506.131) [-503.697] -- 0:00:31
492000 -- [-507.015] (-503.686) (-504.924) (-505.075) * (-503.681) [-505.940] (-507.920) (-503.561) -- 0:00:30
492500 -- (-506.108) [-506.641] (-504.958) (-506.060) * [-506.098] (-507.696) (-505.689) (-508.902) -- 0:00:30
493000 -- (-503.388) [-507.210] (-503.537) (-504.607) * (-504.381) [-504.397] (-507.860) (-511.615) -- 0:00:30
493500 -- (-503.852) [-505.889] (-508.115) (-506.678) * (-502.594) [-503.844] (-505.897) (-505.167) -- 0:00:30
494000 -- [-504.232] (-506.924) (-504.338) (-504.525) * (-505.547) (-505.007) [-503.179] (-503.296) -- 0:00:30
494500 -- (-502.943) [-507.655] (-508.198) (-503.616) * (-504.787) (-503.972) (-503.831) [-506.715] -- 0:00:30
495000 -- (-503.250) [-502.354] (-502.256) (-504.816) * (-504.585) (-505.867) (-506.427) [-505.835] -- 0:00:30
Average standard deviation of split frequencies: 0.009385
495500 -- (-503.651) [-502.703] (-503.603) (-503.139) * [-505.151] (-506.443) (-504.726) (-504.697) -- 0:00:30
496000 -- (-504.705) [-503.687] (-505.729) (-506.564) * (-504.165) (-504.608) [-504.276] (-506.095) -- 0:00:30
496500 -- (-504.102) (-503.295) (-505.355) [-505.218] * (-502.758) (-504.384) [-505.234] (-505.449) -- 0:00:30
497000 -- (-504.470) (-507.448) [-504.857] (-503.849) * [-504.194] (-503.319) (-502.963) (-503.934) -- 0:00:30
497500 -- (-504.045) [-505.029] (-508.088) (-505.252) * (-505.716) (-502.295) (-502.917) [-504.627] -- 0:00:30
498000 -- (-504.023) (-504.528) [-503.830] (-504.130) * [-504.391] (-508.728) (-504.027) (-502.973) -- 0:00:30
498500 -- (-508.937) [-503.075] (-507.325) (-504.830) * (-504.087) (-505.435) [-506.059] (-502.044) -- 0:00:30
499000 -- (-504.073) [-502.726] (-502.747) (-505.080) * (-510.798) (-505.009) [-506.158] (-504.352) -- 0:00:31
499500 -- (-504.521) [-504.123] (-502.784) (-514.088) * [-504.616] (-503.836) (-504.657) (-503.401) -- 0:00:31
500000 -- (-506.409) (-504.147) [-502.950] (-505.612) * (-504.302) (-506.215) [-502.382] (-503.017) -- 0:00:31
Average standard deviation of split frequencies: 0.008529
500500 -- (-505.533) [-504.928] (-502.780) (-505.129) * (-502.925) (-506.393) [-503.521] (-503.219) -- 0:00:30
501000 -- (-506.019) [-506.391] (-507.291) (-503.078) * (-505.369) (-504.791) [-503.542] (-504.562) -- 0:00:30
501500 -- [-503.831] (-505.868) (-505.427) (-505.415) * (-503.566) (-503.730) (-502.069) [-504.075] -- 0:00:30
502000 -- (-504.315) [-503.749] (-502.607) (-506.945) * (-504.679) (-503.002) [-505.394] (-504.668) -- 0:00:30
502500 -- (-508.788) (-505.493) [-502.001] (-503.632) * [-503.942] (-503.392) (-505.310) (-503.142) -- 0:00:30
503000 -- [-504.413] (-504.236) (-503.720) (-502.426) * [-503.444] (-502.935) (-505.229) (-505.355) -- 0:00:30
503500 -- (-503.334) (-506.261) [-503.502] (-502.857) * (-504.243) (-503.115) (-506.644) [-503.593] -- 0:00:30
504000 -- (-502.811) (-505.761) [-504.324] (-503.016) * (-507.015) (-505.455) (-508.679) [-503.728] -- 0:00:30
504500 -- [-504.568] (-502.491) (-504.721) (-508.489) * (-503.705) (-505.520) [-507.401] (-505.041) -- 0:00:30
505000 -- (-502.981) (-503.268) [-503.584] (-502.559) * (-504.034) (-506.413) (-506.071) [-505.337] -- 0:00:30
Average standard deviation of split frequencies: 0.008165
505500 -- (-503.079) (-506.041) (-504.323) [-502.683] * (-504.564) (-503.388) [-503.131] (-503.015) -- 0:00:30
506000 -- [-502.545] (-505.906) (-504.062) (-503.392) * [-506.447] (-507.101) (-503.223) (-503.085) -- 0:00:30
506500 -- [-504.516] (-504.439) (-505.770) (-506.748) * (-504.669) (-505.531) (-502.943) [-503.773] -- 0:00:30
507000 -- (-505.822) (-503.673) (-505.633) [-504.058] * [-502.942] (-503.175) (-505.411) (-504.577) -- 0:00:30
507500 -- (-502.349) [-505.877] (-504.537) (-503.733) * (-503.197) (-502.943) (-502.898) [-504.835] -- 0:00:30
508000 -- (-502.203) (-504.265) [-505.282] (-503.601) * (-503.387) [-503.538] (-504.937) (-505.260) -- 0:00:30
508500 -- [-503.773] (-505.752) (-509.404) (-503.061) * (-504.579) [-502.349] (-505.882) (-505.357) -- 0:00:29
509000 -- [-502.276] (-504.921) (-502.945) (-508.299) * [-503.205] (-503.003) (-503.611) (-504.467) -- 0:00:29
509500 -- [-503.404] (-502.890) (-504.210) (-508.416) * [-502.085] (-503.802) (-505.044) (-504.064) -- 0:00:29
510000 -- (-503.802) (-503.407) (-504.609) [-502.600] * (-504.196) [-504.065] (-505.062) (-505.738) -- 0:00:29
Average standard deviation of split frequencies: 0.008205
510500 -- [-502.740] (-506.250) (-503.864) (-507.805) * (-509.218) (-506.478) [-503.991] (-504.621) -- 0:00:29
511000 -- (-505.708) (-506.655) (-504.189) [-504.237] * (-504.209) (-503.479) [-503.424] (-506.731) -- 0:00:29
511500 -- (-503.076) (-507.516) [-506.476] (-502.282) * (-502.747) (-504.553) [-503.697] (-504.632) -- 0:00:29
512000 -- [-507.977] (-508.334) (-503.150) (-502.146) * (-508.165) (-504.140) [-505.176] (-506.867) -- 0:00:29
512500 -- (-502.410) (-506.476) [-503.726] (-504.193) * (-505.313) [-505.606] (-504.996) (-504.220) -- 0:00:29
513000 -- (-503.533) (-505.865) (-502.869) [-503.782] * [-505.576] (-504.447) (-503.691) (-505.438) -- 0:00:29
513500 -- [-511.308] (-504.101) (-503.204) (-504.377) * (-504.787) (-503.757) (-504.859) [-504.220] -- 0:00:30
514000 -- [-504.161] (-502.466) (-503.261) (-502.072) * [-503.001] (-505.715) (-503.930) (-502.682) -- 0:00:30
514500 -- (-506.724) (-504.245) (-505.454) [-506.204] * (-502.731) (-503.438) (-505.099) [-504.299] -- 0:00:30
515000 -- (-504.833) (-506.168) [-503.844] (-504.730) * (-503.939) [-502.554] (-503.564) (-502.910) -- 0:00:30
Average standard deviation of split frequencies: 0.008425
515500 -- (-504.859) (-511.324) [-504.829] (-503.944) * (-509.552) (-503.426) (-503.965) [-505.961] -- 0:00:30
516000 -- [-504.106] (-508.480) (-503.670) (-504.062) * (-503.988) (-503.168) [-503.729] (-504.264) -- 0:00:30
516500 -- (-503.884) [-506.357] (-507.988) (-503.308) * (-508.412) [-503.328] (-502.813) (-506.389) -- 0:00:29
517000 -- (-503.228) [-503.651] (-504.690) (-503.575) * (-505.423) (-506.487) (-503.323) [-503.865] -- 0:00:29
517500 -- (-506.110) [-502.769] (-504.332) (-506.636) * (-502.179) [-506.130] (-503.751) (-502.580) -- 0:00:29
518000 -- [-503.859] (-507.911) (-505.844) (-503.287) * (-502.725) (-509.660) (-504.276) [-505.865] -- 0:00:29
518500 -- (-504.929) (-506.115) [-503.814] (-504.692) * (-502.826) [-503.693] (-503.054) (-503.019) -- 0:00:29
519000 -- [-505.717] (-509.636) (-506.424) (-503.383) * (-505.793) [-503.426] (-503.121) (-504.529) -- 0:00:29
519500 -- (-502.443) [-505.270] (-504.871) (-505.585) * (-505.375) [-503.741] (-503.313) (-503.189) -- 0:00:29
520000 -- [-503.860] (-506.563) (-507.619) (-503.968) * (-511.539) (-503.227) (-503.344) [-504.828] -- 0:00:29
Average standard deviation of split frequencies: 0.007669
520500 -- (-507.075) (-505.219) (-503.470) [-503.320] * [-504.434] (-503.670) (-503.251) (-503.808) -- 0:00:29
521000 -- [-508.399] (-502.828) (-505.300) (-504.063) * [-502.582] (-503.481) (-503.296) (-503.398) -- 0:00:29
521500 -- (-505.043) (-505.316) (-505.570) [-503.030] * (-502.885) (-503.107) (-502.404) [-503.818] -- 0:00:29
522000 -- (-509.713) [-503.289] (-502.889) (-503.768) * (-504.634) [-506.108] (-503.275) (-503.640) -- 0:00:29
522500 -- (-506.218) (-503.783) (-507.025) [-504.421] * (-507.651) (-508.243) (-505.344) [-504.932] -- 0:00:29
523000 -- (-505.652) (-504.513) [-503.247] (-503.378) * (-507.438) (-505.282) [-504.211] (-507.322) -- 0:00:29
523500 -- (-505.469) (-503.570) (-504.630) [-505.783] * (-504.367) (-507.544) [-502.555] (-507.135) -- 0:00:29
524000 -- (-509.475) (-503.519) [-503.813] (-505.651) * (-503.624) [-508.761] (-504.733) (-504.286) -- 0:00:29
524500 -- (-506.304) (-507.925) [-506.197] (-503.113) * (-503.657) (-504.528) [-503.839] (-504.290) -- 0:00:29
525000 -- (-504.115) [-505.905] (-508.634) (-501.957) * (-506.028) [-506.106] (-510.596) (-502.279) -- 0:00:28
Average standard deviation of split frequencies: 0.007960
525500 -- (-504.488) (-502.165) [-507.461] (-503.246) * (-510.006) [-503.258] (-506.396) (-502.080) -- 0:00:28
526000 -- (-502.880) (-507.149) [-505.822] (-507.460) * (-507.432) (-504.089) (-505.701) [-502.951] -- 0:00:28
526500 -- (-505.816) (-508.730) (-505.380) [-503.296] * (-506.221) (-503.243) [-504.294] (-508.768) -- 0:00:28
527000 -- (-513.894) (-503.123) [-505.366] (-502.845) * (-503.367) [-501.986] (-506.124) (-503.324) -- 0:00:28
527500 -- (-504.191) (-505.016) (-505.195) [-503.356] * (-502.503) (-511.725) (-507.746) [-502.825] -- 0:00:28
528000 -- (-505.689) (-506.297) [-503.583] (-504.421) * (-502.928) [-502.748] (-505.203) (-505.082) -- 0:00:28
528500 -- (-510.760) (-506.558) (-508.705) [-507.577] * (-503.277) (-503.482) (-504.567) [-507.206] -- 0:00:28
529000 -- (-504.073) (-505.023) (-503.207) [-505.255] * (-506.731) [-503.468] (-502.920) (-504.449) -- 0:00:29
529500 -- (-505.927) [-506.386] (-505.407) (-507.226) * (-508.130) (-505.422) [-502.854] (-505.950) -- 0:00:29
530000 -- (-506.107) (-504.478) [-506.651] (-506.294) * [-506.399] (-504.620) (-505.817) (-505.239) -- 0:00:29
Average standard deviation of split frequencies: 0.008570
530500 -- (-506.212) [-505.584] (-508.227) (-504.325) * (-508.195) (-504.613) (-505.044) [-505.463] -- 0:00:29
531000 -- (-504.769) (-503.148) (-505.539) [-506.717] * (-504.760) (-504.600) (-506.348) [-504.352] -- 0:00:29
531500 -- (-504.411) (-504.554) (-508.122) [-504.398] * (-503.759) [-503.555] (-508.800) (-506.277) -- 0:00:29
532000 -- (-505.768) [-503.416] (-505.656) (-504.860) * (-502.892) (-502.872) (-508.813) [-503.445] -- 0:00:29
532500 -- (-503.458) [-502.215] (-503.849) (-506.101) * [-503.845] (-506.622) (-504.924) (-504.583) -- 0:00:28
533000 -- (-503.670) (-503.533) [-503.692] (-503.231) * (-503.391) (-506.452) [-503.919] (-504.189) -- 0:00:28
533500 -- (-504.725) (-506.190) [-502.107] (-503.805) * [-502.640] (-505.032) (-502.811) (-503.962) -- 0:00:28
534000 -- (-505.174) (-505.663) [-504.893] (-505.076) * (-502.554) (-507.205) (-503.823) [-503.476] -- 0:00:28
534500 -- (-505.221) (-505.935) (-502.771) [-506.919] * (-503.595) (-504.943) [-503.291] (-502.579) -- 0:00:28
535000 -- [-504.498] (-506.979) (-503.408) (-505.092) * (-502.663) (-504.263) (-503.671) [-503.864] -- 0:00:28
Average standard deviation of split frequencies: 0.008847
535500 -- (-507.315) (-502.959) [-505.463] (-503.890) * [-503.140] (-504.036) (-506.511) (-505.471) -- 0:00:28
536000 -- (-502.311) (-503.764) [-503.416] (-507.734) * (-503.315) [-504.391] (-505.336) (-504.331) -- 0:00:28
536500 -- (-503.575) (-502.879) (-510.519) [-502.729] * (-505.284) (-504.483) (-509.206) [-503.176] -- 0:00:28
537000 -- (-503.343) (-503.811) [-504.364] (-505.747) * (-504.748) (-505.507) [-504.284] (-504.512) -- 0:00:28
537500 -- (-502.992) (-504.392) [-503.950] (-502.273) * (-505.007) (-505.023) (-506.431) [-502.288] -- 0:00:28
538000 -- (-506.871) (-506.681) [-503.095] (-503.982) * (-504.359) (-506.658) (-503.767) [-502.152] -- 0:00:28
538500 -- (-506.710) (-502.641) [-504.564] (-504.488) * (-505.105) (-503.024) [-503.176] (-503.071) -- 0:00:28
539000 -- (-506.652) (-504.657) [-503.801] (-503.151) * (-507.002) (-510.639) [-505.187] (-502.762) -- 0:00:28
539500 -- (-504.545) (-504.311) [-506.748] (-507.631) * (-505.912) [-503.174] (-506.058) (-504.386) -- 0:00:28
540000 -- (-504.185) (-503.747) [-504.288] (-502.543) * [-505.570] (-505.985) (-502.475) (-509.235) -- 0:00:28
Average standard deviation of split frequencies: 0.008873
540500 -- (-506.952) (-504.445) [-506.021] (-504.918) * [-503.021] (-504.558) (-505.245) (-504.226) -- 0:00:28
541000 -- (-505.660) (-502.386) [-503.542] (-505.044) * (-504.605) [-503.874] (-506.363) (-506.055) -- 0:00:27
541500 -- [-509.446] (-503.093) (-504.741) (-504.076) * (-508.154) [-505.347] (-504.878) (-506.435) -- 0:00:27
542000 -- (-507.167) (-507.362) [-505.626] (-503.502) * [-502.270] (-508.143) (-503.896) (-506.942) -- 0:00:27
542500 -- (-507.379) [-503.986] (-503.856) (-505.880) * (-509.208) (-504.258) (-502.985) [-503.618] -- 0:00:27
543000 -- (-506.304) (-507.993) [-505.307] (-504.635) * (-510.145) [-504.732] (-503.693) (-507.392) -- 0:00:27
543500 -- (-503.066) (-507.042) (-502.478) [-504.676] * (-503.697) (-503.481) (-503.947) [-503.846] -- 0:00:27
544000 -- (-503.972) [-504.966] (-503.121) (-502.624) * (-504.951) (-505.002) (-502.844) [-503.666] -- 0:00:27
544500 -- (-504.157) (-506.463) [-504.025] (-503.700) * [-503.532] (-505.378) (-503.709) (-504.673) -- 0:00:27
545000 -- (-513.211) [-505.149] (-502.538) (-508.093) * (-507.185) (-503.165) [-503.236] (-506.583) -- 0:00:27
Average standard deviation of split frequencies: 0.009142
545500 -- [-503.008] (-504.137) (-504.077) (-504.163) * [-502.991] (-508.377) (-504.681) (-503.887) -- 0:00:28
546000 -- [-503.118] (-504.664) (-504.833) (-503.545) * (-505.035) (-504.559) [-502.883] (-507.749) -- 0:00:28
546500 -- (-504.566) (-502.714) (-507.495) [-504.717] * (-504.398) (-504.758) [-507.907] (-504.694) -- 0:00:28
547000 -- (-504.541) (-502.392) (-505.505) [-502.854] * (-502.323) [-506.074] (-503.316) (-505.714) -- 0:00:28
547500 -- (-506.246) (-504.033) [-502.610] (-502.816) * (-508.953) [-505.200] (-506.218) (-503.572) -- 0:00:28
548000 -- [-505.738] (-502.705) (-502.132) (-505.062) * (-506.082) (-502.808) (-503.808) [-503.716] -- 0:00:28
548500 -- (-505.895) [-503.592] (-502.677) (-506.001) * (-504.124) [-504.206] (-507.998) (-503.752) -- 0:00:27
549000 -- [-505.444] (-503.465) (-503.981) (-504.807) * (-502.875) (-502.773) (-513.966) [-505.626] -- 0:00:27
549500 -- (-505.513) (-503.712) (-507.219) [-505.646] * (-504.814) [-502.658] (-503.479) (-506.500) -- 0:00:27
550000 -- (-506.171) (-506.964) (-504.913) [-505.275] * (-503.179) (-503.991) (-503.657) [-505.596] -- 0:00:27
Average standard deviation of split frequencies: 0.009417
550500 -- (-510.373) (-503.642) (-503.279) [-503.143] * [-502.383] (-503.530) (-504.869) (-509.252) -- 0:00:27
551000 -- [-506.244] (-503.876) (-502.469) (-502.324) * (-507.417) [-504.122] (-507.296) (-502.980) -- 0:00:27
551500 -- (-503.666) [-504.442] (-503.882) (-503.031) * [-504.688] (-503.556) (-506.459) (-505.357) -- 0:00:27
552000 -- [-503.659] (-501.996) (-503.995) (-508.956) * [-506.102] (-505.777) (-505.057) (-508.439) -- 0:00:27
552500 -- (-503.340) (-501.991) [-505.706] (-506.667) * [-504.778] (-503.269) (-503.138) (-505.160) -- 0:00:27
553000 -- [-502.666] (-503.055) (-502.871) (-503.424) * (-504.480) [-505.872] (-503.677) (-503.778) -- 0:00:27
553500 -- (-511.552) [-503.926] (-506.990) (-503.924) * [-502.516] (-503.432) (-506.764) (-503.679) -- 0:00:27
554000 -- (-502.773) (-505.830) [-504.079] (-504.755) * (-502.386) (-507.318) (-504.009) [-503.396] -- 0:00:27
554500 -- [-503.162] (-502.513) (-503.092) (-503.794) * (-503.062) (-505.723) (-504.798) [-502.786] -- 0:00:27
555000 -- [-507.099] (-506.553) (-502.638) (-502.933) * (-502.894) [-503.276] (-505.707) (-505.143) -- 0:00:27
Average standard deviation of split frequencies: 0.008778
555500 -- (-504.724) [-504.903] (-504.527) (-503.218) * (-503.051) (-503.347) [-503.676] (-503.145) -- 0:00:27
556000 -- [-504.211] (-504.383) (-503.728) (-509.431) * (-505.597) (-502.471) (-504.690) [-504.051] -- 0:00:27
556500 -- [-503.725] (-504.489) (-504.057) (-505.276) * (-506.994) [-502.465] (-504.129) (-504.403) -- 0:00:27
557000 -- (-502.640) (-506.153) [-503.466] (-507.805) * (-507.173) [-506.646] (-505.630) (-502.632) -- 0:00:27
557500 -- (-503.188) (-505.878) (-503.949) [-506.204] * (-505.098) [-506.367] (-507.550) (-504.015) -- 0:00:26
558000 -- (-502.744) (-505.406) (-508.293) [-506.163] * (-505.352) [-503.763] (-508.020) (-505.762) -- 0:00:26
558500 -- (-503.473) (-506.418) [-503.590] (-503.390) * (-504.047) [-506.428] (-505.717) (-504.386) -- 0:00:26
559000 -- (-503.931) (-503.938) [-503.942] (-506.459) * (-504.198) (-505.348) [-502.930] (-503.989) -- 0:00:26
559500 -- (-505.779) (-504.154) (-503.791) [-505.609] * (-507.097) (-503.011) (-505.079) [-508.784] -- 0:00:26
560000 -- (-509.548) [-506.493] (-506.194) (-503.738) * (-505.376) (-504.892) [-502.843] (-504.736) -- 0:00:26
Average standard deviation of split frequencies: 0.008903
560500 -- [-505.486] (-502.778) (-508.125) (-506.056) * (-502.635) (-510.584) [-503.447] (-505.798) -- 0:00:26
561000 -- (-506.111) [-503.225] (-503.854) (-502.937) * [-503.197] (-508.653) (-504.636) (-503.665) -- 0:00:26
561500 -- (-505.373) (-503.724) (-506.812) [-503.053] * (-502.803) [-503.174] (-512.862) (-503.699) -- 0:00:26
562000 -- (-502.022) (-506.354) [-504.469] (-503.489) * (-505.503) (-506.870) [-503.723] (-504.562) -- 0:00:27
562500 -- (-504.082) [-505.947] (-504.972) (-503.619) * (-504.256) (-507.729) (-503.196) [-503.617] -- 0:00:27
563000 -- (-504.815) (-502.731) (-503.151) [-502.627] * (-504.221) [-508.401] (-508.541) (-503.468) -- 0:00:27
563500 -- [-503.197] (-503.359) (-503.315) (-503.258) * [-506.879] (-505.194) (-504.912) (-505.028) -- 0:00:27
564000 -- (-506.759) (-507.180) [-505.832] (-503.911) * (-509.325) (-504.577) [-503.436] (-505.199) -- 0:00:27
564500 -- (-502.249) [-505.893] (-502.865) (-504.062) * [-507.420] (-506.215) (-506.787) (-502.225) -- 0:00:27
565000 -- (-503.324) (-505.946) [-504.049] (-503.584) * [-503.360] (-504.275) (-503.369) (-503.123) -- 0:00:26
Average standard deviation of split frequencies: 0.008672
565500 -- [-505.226] (-505.573) (-504.409) (-503.649) * (-503.908) [-503.306] (-504.108) (-504.065) -- 0:00:26
566000 -- (-503.833) (-506.441) (-506.243) [-502.877] * [-503.717] (-505.090) (-505.781) (-503.153) -- 0:00:26
566500 -- (-506.394) (-509.524) (-506.691) [-502.964] * (-503.017) (-505.546) (-506.231) [-504.235] -- 0:00:26
567000 -- (-505.202) [-503.151] (-505.443) (-504.510) * (-502.570) (-505.144) [-504.580] (-503.623) -- 0:00:26
567500 -- [-508.785] (-501.927) (-507.766) (-504.171) * [-505.562] (-506.663) (-508.393) (-503.243) -- 0:00:26
568000 -- [-503.132] (-506.647) (-504.578) (-503.012) * (-503.194) (-506.026) (-504.050) [-503.425] -- 0:00:26
568500 -- (-504.871) [-503.618] (-509.370) (-507.896) * (-503.940) (-502.815) [-502.501] (-502.809) -- 0:00:26
569000 -- (-503.125) (-504.355) [-504.968] (-504.077) * (-503.177) [-502.870] (-503.062) (-502.900) -- 0:00:26
569500 -- [-502.826] (-503.144) (-503.052) (-503.286) * (-505.195) [-502.888] (-506.850) (-502.995) -- 0:00:26
570000 -- (-503.822) [-504.694] (-506.098) (-505.238) * (-507.029) [-502.890] (-503.313) (-503.757) -- 0:00:26
Average standard deviation of split frequencies: 0.009087
570500 -- (-508.249) [-502.184] (-504.339) (-504.190) * (-504.419) [-504.096] (-503.381) (-504.972) -- 0:00:26
571000 -- (-508.112) (-502.413) (-502.997) [-502.290] * [-506.798] (-502.894) (-507.527) (-503.430) -- 0:00:26
571500 -- (-506.277) (-503.161) (-502.542) [-503.671] * (-505.888) (-505.178) [-504.136] (-503.042) -- 0:00:26
572000 -- (-505.226) (-503.919) (-503.754) [-503.209] * (-503.276) [-502.590] (-503.849) (-502.508) -- 0:00:26
572500 -- (-504.084) (-504.365) (-503.781) [-502.516] * (-506.073) (-503.936) (-505.408) [-503.342] -- 0:00:26
573000 -- (-504.645) (-502.385) (-503.909) [-503.026] * (-504.309) [-504.636] (-503.356) (-504.058) -- 0:00:26
573500 -- [-504.002] (-503.444) (-505.643) (-502.408) * [-502.946] (-504.180) (-504.276) (-503.432) -- 0:00:26
574000 -- [-511.113] (-506.033) (-504.613) (-507.861) * (-506.641) (-504.719) (-505.337) [-503.065] -- 0:00:25
574500 -- [-504.433] (-505.073) (-505.667) (-504.089) * (-502.812) (-504.872) [-503.443] (-502.851) -- 0:00:25
575000 -- (-503.924) [-503.475] (-506.187) (-504.447) * [-502.764] (-503.015) (-502.753) (-505.695) -- 0:00:25
Average standard deviation of split frequencies: 0.008088
575500 -- (-505.867) (-502.995) [-503.078] (-504.939) * (-507.890) (-504.636) (-506.638) [-505.398] -- 0:00:25
576000 -- (-504.180) (-502.625) (-505.106) [-508.251] * [-504.194] (-504.102) (-505.297) (-505.124) -- 0:00:25
576500 -- [-504.095] (-503.089) (-502.745) (-506.826) * (-505.535) [-503.982] (-505.358) (-503.239) -- 0:00:25
577000 -- (-502.946) (-506.635) [-503.074] (-507.522) * (-502.705) (-505.746) (-505.694) [-502.791] -- 0:00:25
577500 -- (-502.200) (-504.308) (-507.637) [-506.663] * (-504.783) (-505.491) (-503.183) [-505.210] -- 0:00:26
578000 -- (-504.260) (-504.464) [-503.763] (-504.710) * (-506.894) (-505.332) (-505.943) [-504.049] -- 0:00:26
578500 -- (-509.644) (-504.399) [-505.083] (-502.488) * (-502.634) (-502.692) [-505.860] (-503.064) -- 0:00:26
579000 -- (-505.710) (-505.955) (-503.282) [-505.006] * (-505.281) [-505.145] (-507.450) (-503.624) -- 0:00:26
579500 -- (-504.202) (-504.901) [-508.361] (-510.565) * (-503.195) (-503.688) [-507.701] (-505.587) -- 0:00:26
580000 -- (-503.302) (-502.969) [-503.614] (-509.954) * (-505.407) (-506.696) (-504.103) [-505.844] -- 0:00:26
Average standard deviation of split frequencies: 0.008524
580500 -- [-505.621] (-502.910) (-502.158) (-507.336) * (-504.944) (-505.626) (-502.632) [-506.085] -- 0:00:26
581000 -- (-506.008) (-503.481) [-503.891] (-508.144) * (-504.179) (-504.858) (-504.075) [-506.381] -- 0:00:25
581500 -- (-507.234) (-503.405) (-507.229) [-503.785] * (-506.101) (-506.500) [-503.160] (-505.597) -- 0:00:25
582000 -- (-506.201) (-503.675) (-503.252) [-503.117] * [-507.093] (-504.115) (-503.329) (-503.050) -- 0:00:25
582500 -- (-503.348) (-505.563) [-503.994] (-503.380) * (-504.757) (-506.325) [-504.631] (-506.610) -- 0:00:25
583000 -- (-505.761) (-506.610) (-505.664) [-503.167] * (-502.807) (-504.558) (-502.540) [-504.292] -- 0:00:25
583500 -- (-503.604) [-503.154] (-506.171) (-507.486) * [-506.951] (-502.242) (-507.201) (-502.913) -- 0:00:25
584000 -- [-505.812] (-504.248) (-506.952) (-505.292) * (-505.863) [-503.825] (-510.429) (-502.905) -- 0:00:25
584500 -- (-503.609) (-504.969) (-505.726) [-503.828] * (-507.236) (-505.332) (-505.647) [-503.157] -- 0:00:25
585000 -- (-502.806) (-506.836) (-504.205) [-504.612] * (-507.128) (-502.968) [-502.209] (-504.199) -- 0:00:25
Average standard deviation of split frequencies: 0.008281
585500 -- (-505.318) [-503.174] (-503.821) (-503.444) * (-502.873) (-503.639) [-503.951] (-506.316) -- 0:00:25
586000 -- [-504.786] (-503.615) (-504.959) (-503.165) * (-502.614) (-503.680) [-504.131] (-505.815) -- 0:00:25
586500 -- (-502.533) (-506.784) [-503.193] (-502.177) * [-505.885] (-505.416) (-504.039) (-503.680) -- 0:00:25
587000 -- (-507.602) [-505.006] (-504.151) (-503.327) * (-505.527) (-508.106) [-507.569] (-502.277) -- 0:00:25
587500 -- (-505.193) (-504.702) [-504.178] (-503.021) * (-505.224) [-503.564] (-504.243) (-503.965) -- 0:00:25
588000 -- (-505.166) (-503.649) (-503.884) [-505.007] * (-503.345) [-503.602] (-505.117) (-503.964) -- 0:00:25
588500 -- (-506.986) [-503.123] (-508.161) (-503.299) * [-504.296] (-503.967) (-508.786) (-503.944) -- 0:00:25
589000 -- (-507.013) (-503.122) (-504.683) [-506.966] * [-503.996] (-509.479) (-505.781) (-504.301) -- 0:00:25
589500 -- (-502.777) (-504.603) [-504.552] (-505.716) * (-504.959) (-504.961) [-505.421] (-505.514) -- 0:00:25
590000 -- (-506.706) (-511.640) (-504.891) [-505.001] * (-504.262) (-505.118) (-506.203) [-508.531] -- 0:00:25
Average standard deviation of split frequencies: 0.007934
590500 -- (-505.251) [-504.122] (-505.913) (-509.214) * (-505.546) (-508.545) [-504.991] (-509.962) -- 0:00:24
591000 -- (-503.557) [-504.461] (-503.836) (-504.873) * (-506.915) [-505.937] (-505.159) (-504.799) -- 0:00:24
591500 -- (-502.756) (-506.877) (-503.304) [-503.571] * [-504.726] (-504.355) (-503.307) (-502.610) -- 0:00:24
592000 -- (-504.575) [-503.752] (-503.776) (-502.957) * (-507.372) (-503.562) (-502.075) [-502.828] -- 0:00:24
592500 -- (-503.308) (-506.623) (-505.462) [-502.654] * [-504.517] (-505.476) (-503.946) (-503.445) -- 0:00:24
593000 -- (-502.503) (-502.417) [-503.582] (-507.297) * (-504.201) (-503.840) [-505.971] (-504.995) -- 0:00:24
593500 -- (-504.012) (-502.623) [-507.222] (-502.517) * (-508.196) [-504.834] (-503.226) (-503.469) -- 0:00:24
594000 -- (-504.780) (-503.806) (-502.516) [-503.282] * (-503.098) (-504.029) (-505.921) [-504.137] -- 0:00:25
594500 -- (-504.297) (-505.390) [-502.470] (-503.534) * (-503.038) (-503.863) [-503.262] (-502.020) -- 0:00:25
595000 -- (-504.389) (-503.975) (-505.974) [-503.647] * (-502.235) [-505.881] (-504.933) (-502.392) -- 0:00:25
Average standard deviation of split frequencies: 0.007677
595500 -- (-517.898) (-505.514) (-504.244) [-503.374] * (-502.732) (-503.219) [-503.755] (-505.897) -- 0:00:25
596000 -- (-504.456) (-505.545) (-502.744) [-502.810] * (-503.631) (-504.770) (-502.523) [-504.758] -- 0:00:25
596500 -- [-503.286] (-502.181) (-503.496) (-502.910) * (-507.383) (-503.968) (-504.260) [-504.912] -- 0:00:25
597000 -- (-504.388) [-503.258] (-506.149) (-503.238) * (-504.222) (-504.205) [-503.965] (-505.508) -- 0:00:24
597500 -- (-504.028) [-502.448] (-504.696) (-503.776) * (-503.904) [-505.496] (-507.207) (-502.266) -- 0:00:24
598000 -- [-503.004] (-502.480) (-502.322) (-506.872) * (-503.522) (-506.068) [-504.681] (-502.485) -- 0:00:24
598500 -- (-505.225) (-505.021) (-502.894) [-502.484] * (-507.108) (-504.440) (-507.938) [-502.209] -- 0:00:24
599000 -- (-502.402) (-502.888) [-504.366] (-504.249) * (-505.655) (-506.539) [-506.236] (-503.248) -- 0:00:24
599500 -- (-504.253) (-506.503) (-507.124) [-504.026] * (-503.275) (-503.942) [-503.242] (-506.381) -- 0:00:24
600000 -- [-504.094] (-504.370) (-507.281) (-502.693) * (-505.122) (-504.401) [-504.826] (-502.991) -- 0:00:24
Average standard deviation of split frequencies: 0.007433
600500 -- (-504.259) (-507.252) (-502.458) [-502.076] * (-503.178) [-504.688] (-504.610) (-505.272) -- 0:00:24
601000 -- (-503.429) (-503.859) (-504.348) [-502.391] * (-505.287) (-502.520) [-504.817] (-505.736) -- 0:00:24
601500 -- (-503.653) (-508.076) (-505.096) [-502.684] * (-503.878) (-503.005) (-502.697) [-505.970] -- 0:00:24
602000 -- (-507.200) (-503.878) (-507.490) [-502.401] * (-506.538) [-502.489] (-502.706) (-507.057) -- 0:00:24
602500 -- [-504.025] (-504.006) (-503.409) (-502.967) * [-504.281] (-503.100) (-502.901) (-503.430) -- 0:00:24
603000 -- (-503.454) (-505.034) (-504.989) [-502.299] * (-505.196) (-502.084) [-502.479] (-506.228) -- 0:00:24
603500 -- (-505.050) (-502.940) (-504.307) [-506.183] * [-504.747] (-503.104) (-504.796) (-506.752) -- 0:00:24
604000 -- (-502.765) (-507.391) (-502.869) [-504.810] * (-503.634) (-505.818) [-505.696] (-503.643) -- 0:00:24
604500 -- (-507.595) (-505.625) (-503.068) [-503.247] * (-504.093) (-505.787) (-504.688) [-503.257] -- 0:00:24
605000 -- [-502.304] (-505.533) (-505.920) (-505.104) * [-504.531] (-508.675) (-506.228) (-503.963) -- 0:00:24
Average standard deviation of split frequencies: 0.007459
605500 -- [-502.262] (-504.450) (-502.527) (-503.618) * [-503.223] (-506.014) (-505.958) (-506.014) -- 0:00:24
606000 -- (-503.337) [-503.434] (-502.881) (-502.617) * (-508.400) (-504.750) (-507.981) [-505.431] -- 0:00:24
606500 -- (-503.054) (-503.114) [-503.896] (-503.772) * (-504.111) [-503.510] (-506.804) (-504.275) -- 0:00:24
607000 -- [-503.702] (-506.864) (-504.777) (-506.389) * (-508.759) (-507.898) [-506.854] (-502.612) -- 0:00:23
607500 -- (-504.716) (-505.464) (-504.950) [-506.770] * (-504.412) (-504.768) [-505.517] (-503.559) -- 0:00:23
608000 -- [-504.619] (-505.650) (-505.161) (-503.695) * (-504.839) (-505.447) (-504.763) [-503.455] -- 0:00:23
608500 -- (-504.952) [-505.290] (-507.456) (-503.129) * (-504.795) (-503.500) (-502.837) [-504.412] -- 0:00:23
609000 -- (-504.957) [-502.631] (-508.921) (-503.872) * (-504.418) (-503.074) [-502.315] (-503.881) -- 0:00:23
609500 -- (-507.219) [-506.945] (-508.246) (-503.507) * [-503.715] (-504.714) (-504.625) (-507.240) -- 0:00:23
610000 -- (-504.286) [-503.289] (-504.444) (-504.580) * (-504.870) (-502.930) [-503.729] (-504.150) -- 0:00:23
Average standard deviation of split frequencies: 0.007311
610500 -- (-505.976) [-505.310] (-503.832) (-503.753) * [-504.937] (-503.083) (-507.915) (-502.863) -- 0:00:24
611000 -- (-503.288) (-502.507) (-503.197) [-502.793] * (-505.634) (-503.971) [-503.994] (-502.921) -- 0:00:24
611500 -- [-503.388] (-504.082) (-502.623) (-505.324) * [-503.258] (-503.295) (-503.406) (-503.598) -- 0:00:24
612000 -- (-502.001) [-507.127] (-505.835) (-505.956) * [-502.899] (-505.250) (-504.317) (-503.184) -- 0:00:24
612500 -- [-505.756] (-505.355) (-502.895) (-507.833) * [-504.399] (-505.396) (-508.030) (-504.280) -- 0:00:24
613000 -- (-504.247) (-504.453) (-504.072) [-506.089] * (-507.853) [-506.066] (-504.288) (-503.054) -- 0:00:23
613500 -- (-505.029) [-503.114] (-513.107) (-507.461) * (-503.008) (-507.892) [-504.287] (-506.877) -- 0:00:23
614000 -- (-502.299) [-504.464] (-506.635) (-507.439) * [-502.360] (-506.958) (-506.206) (-503.158) -- 0:00:23
614500 -- [-503.286] (-502.803) (-503.916) (-504.040) * (-502.393) [-506.957] (-504.743) (-504.742) -- 0:00:23
615000 -- [-505.621] (-507.188) (-507.623) (-505.874) * (-503.437) (-509.904) (-505.188) [-503.679] -- 0:00:23
Average standard deviation of split frequencies: 0.007428
615500 -- (-505.054) [-503.641] (-505.116) (-504.719) * (-504.843) (-505.827) (-505.151) [-503.464] -- 0:00:23
616000 -- (-507.374) (-503.816) (-505.820) [-504.938] * (-506.767) [-503.035] (-504.736) (-502.681) -- 0:00:23
616500 -- (-509.712) (-505.795) (-503.193) [-503.420] * (-505.883) (-506.524) (-509.599) [-503.121] -- 0:00:23
617000 -- (-503.725) (-503.600) [-502.870] (-507.883) * (-503.885) (-509.974) (-514.786) [-504.052] -- 0:00:23
617500 -- [-503.168] (-504.105) (-503.716) (-507.801) * (-503.188) (-506.559) [-503.468] (-504.848) -- 0:00:23
618000 -- (-503.828) [-508.982] (-503.994) (-505.948) * (-505.830) [-504.899] (-503.552) (-503.344) -- 0:00:23
618500 -- (-503.652) (-505.509) [-503.064] (-504.683) * [-504.744] (-504.030) (-503.501) (-503.431) -- 0:00:23
619000 -- (-504.861) (-506.562) (-504.233) [-504.758] * [-502.872] (-505.661) (-503.853) (-504.904) -- 0:00:23
619500 -- (-504.610) [-506.214] (-506.238) (-503.749) * (-504.799) [-504.410] (-503.554) (-510.782) -- 0:00:23
620000 -- [-503.385] (-504.161) (-504.216) (-502.669) * (-511.713) [-506.612] (-510.411) (-502.947) -- 0:00:23
Average standard deviation of split frequencies: 0.007014
620500 -- (-504.070) [-503.820] (-502.514) (-503.656) * (-507.015) (-503.200) (-503.797) [-503.338] -- 0:00:23
621000 -- (-504.527) [-507.277] (-506.924) (-507.068) * (-507.173) (-503.915) (-505.177) [-507.507] -- 0:00:23
621500 -- (-504.085) (-505.593) (-503.039) [-504.805] * (-505.821) [-502.884] (-511.213) (-503.852) -- 0:00:23
622000 -- (-505.406) (-504.959) (-503.584) [-503.857] * (-505.948) [-503.733] (-503.217) (-504.963) -- 0:00:23
622500 -- [-506.841] (-505.318) (-504.771) (-502.604) * (-506.157) [-502.277] (-503.879) (-504.203) -- 0:00:23
623000 -- (-507.241) (-505.601) [-504.811] (-504.728) * (-502.819) [-504.646] (-504.922) (-502.208) -- 0:00:22
623500 -- (-506.200) (-503.494) (-505.394) [-506.985] * (-505.235) (-505.578) (-503.980) [-502.840] -- 0:00:22
624000 -- (-505.620) (-503.752) [-503.513] (-504.335) * (-502.934) [-503.656] (-502.785) (-503.207) -- 0:00:22
624500 -- [-503.523] (-506.555) (-502.501) (-505.778) * (-502.858) [-503.256] (-507.907) (-505.531) -- 0:00:22
625000 -- (-503.334) (-502.254) (-506.229) [-502.613] * [-504.600] (-504.702) (-504.454) (-510.364) -- 0:00:22
Average standard deviation of split frequencies: 0.007442
625500 -- [-502.585] (-502.388) (-506.397) (-503.949) * (-503.270) (-503.301) (-504.758) [-502.667] -- 0:00:22
626000 -- (-503.256) (-503.675) (-504.060) [-502.790] * [-502.917] (-503.049) (-506.611) (-503.657) -- 0:00:22
626500 -- (-504.160) (-505.964) [-504.030] (-503.036) * (-505.633) [-503.102] (-507.237) (-507.787) -- 0:00:23
627000 -- (-505.030) [-505.503] (-504.432) (-504.179) * (-509.493) (-503.032) [-509.026] (-503.976) -- 0:00:23
627500 -- (-504.931) (-504.371) [-507.147] (-503.088) * [-504.201] (-503.006) (-510.592) (-506.340) -- 0:00:23
628000 -- (-504.589) (-506.994) [-509.552] (-504.619) * [-502.586] (-503.892) (-503.913) (-503.604) -- 0:00:23
628500 -- [-504.977] (-507.162) (-503.587) (-502.744) * [-503.034] (-503.479) (-511.217) (-506.466) -- 0:00:23
629000 -- (-509.107) [-506.076] (-506.065) (-502.551) * [-504.540] (-505.109) (-505.198) (-506.085) -- 0:00:23
629500 -- (-503.850) [-501.964] (-504.731) (-504.283) * (-507.135) [-504.874] (-503.641) (-504.129) -- 0:00:22
630000 -- (-502.895) (-502.129) (-502.680) [-503.307] * [-506.352] (-507.792) (-506.160) (-507.322) -- 0:00:22
Average standard deviation of split frequencies: 0.007343
630500 -- (-503.751) (-503.703) [-503.163] (-502.276) * (-503.847) [-503.978] (-511.638) (-505.430) -- 0:00:22
631000 -- (-504.333) (-504.847) [-503.373] (-506.068) * (-505.633) (-506.252) [-508.866] (-507.093) -- 0:00:22
631500 -- (-504.276) [-502.118] (-503.112) (-502.579) * (-504.306) (-505.811) (-508.222) [-502.225] -- 0:00:22
632000 -- [-502.777] (-503.933) (-504.637) (-504.825) * (-506.122) (-505.326) (-504.779) [-504.261] -- 0:00:22
632500 -- (-502.427) [-505.132] (-505.196) (-503.044) * (-503.183) (-502.978) (-510.019) [-503.508] -- 0:00:22
633000 -- (-503.979) (-503.886) (-505.020) [-505.299] * (-503.589) (-508.411) [-503.611] (-502.544) -- 0:00:22
633500 -- (-504.053) (-503.556) [-503.535] (-503.936) * (-502.798) (-504.940) (-504.430) [-507.853] -- 0:00:22
634000 -- [-503.817] (-507.600) (-503.737) (-503.017) * [-503.359] (-502.565) (-506.726) (-507.189) -- 0:00:22
634500 -- (-509.031) [-504.325] (-510.524) (-504.534) * [-503.824] (-506.047) (-507.590) (-502.997) -- 0:00:22
635000 -- [-505.934] (-504.588) (-504.014) (-506.683) * (-506.208) (-507.944) (-502.728) [-502.326] -- 0:00:22
Average standard deviation of split frequencies: 0.007935
635500 -- (-505.182) (-504.583) (-504.435) [-504.815] * (-503.211) (-504.842) (-503.882) [-503.782] -- 0:00:22
636000 -- (-507.216) (-504.374) (-504.790) [-503.711] * (-509.239) [-505.715] (-504.127) (-507.129) -- 0:00:22
636500 -- [-503.943] (-504.145) (-504.432) (-506.007) * (-506.376) (-508.331) [-505.259] (-502.138) -- 0:00:22
637000 -- [-503.674] (-503.957) (-503.107) (-502.420) * (-504.153) [-505.959] (-503.739) (-504.060) -- 0:00:22
637500 -- (-504.440) (-503.336) (-503.167) [-502.128] * [-504.021] (-504.855) (-504.615) (-504.250) -- 0:00:22
638000 -- (-503.846) (-506.158) (-503.305) [-504.081] * (-503.264) (-509.190) (-503.153) [-503.657] -- 0:00:22
638500 -- (-505.832) (-504.712) (-506.838) [-503.131] * (-502.576) (-507.134) (-505.944) [-505.034] -- 0:00:22
639000 -- (-504.739) (-505.001) (-506.046) [-503.909] * (-503.485) [-506.668] (-503.838) (-503.350) -- 0:00:22
639500 -- (-502.764) (-504.314) [-503.448] (-507.654) * (-505.043) (-502.984) (-503.660) [-503.222] -- 0:00:21
640000 -- (-502.459) (-508.445) [-503.664] (-505.807) * [-505.245] (-509.133) (-503.831) (-504.474) -- 0:00:21
Average standard deviation of split frequencies: 0.007661
640500 -- (-506.289) (-505.021) (-503.535) [-504.043] * (-503.368) (-507.158) (-502.856) [-507.486] -- 0:00:21
641000 -- (-508.149) (-502.873) [-502.648] (-503.341) * (-503.379) (-506.405) (-504.624) [-503.279] -- 0:00:21
641500 -- (-506.462) (-504.687) [-503.635] (-503.155) * [-503.787] (-505.884) (-505.827) (-502.495) -- 0:00:21
642000 -- [-507.351] (-503.031) (-505.247) (-504.840) * (-502.856) [-505.012] (-507.921) (-504.166) -- 0:00:21
642500 -- (-505.015) [-505.861] (-504.819) (-504.881) * [-505.663] (-503.813) (-507.443) (-502.999) -- 0:00:22
643000 -- (-504.015) [-507.397] (-504.670) (-506.915) * [-502.940] (-507.078) (-509.062) (-503.123) -- 0:00:22
643500 -- (-504.743) (-507.957) (-505.092) [-505.955] * (-503.116) (-503.680) (-506.327) [-503.762] -- 0:00:22
644000 -- (-507.801) (-504.976) [-504.771] (-503.948) * (-505.076) (-507.794) (-503.409) [-504.078] -- 0:00:22
644500 -- (-502.214) [-504.140] (-504.446) (-504.179) * (-504.856) (-507.720) (-503.333) [-503.226] -- 0:00:22
645000 -- (-504.479) (-507.014) (-505.323) [-503.719] * (-508.717) [-507.988] (-504.095) (-502.705) -- 0:00:22
Average standard deviation of split frequencies: 0.007898
645500 -- [-502.721] (-509.647) (-504.849) (-509.016) * (-502.911) (-509.265) (-505.475) [-503.105] -- 0:00:21
646000 -- (-503.811) [-502.394] (-502.630) (-511.513) * [-502.858] (-503.050) (-505.066) (-506.745) -- 0:00:21
646500 -- (-501.955) (-508.766) [-503.875] (-505.968) * [-503.328] (-504.881) (-505.132) (-506.043) -- 0:00:21
647000 -- (-505.747) [-504.471] (-504.731) (-505.912) * [-504.331] (-507.747) (-506.775) (-504.027) -- 0:00:21
647500 -- (-503.140) [-503.184] (-507.365) (-506.872) * (-504.500) [-507.131] (-504.060) (-504.471) -- 0:00:21
648000 -- (-506.848) (-505.744) (-504.705) [-503.659] * (-505.649) (-502.463) (-502.815) [-502.553] -- 0:00:21
648500 -- (-504.371) (-504.270) [-504.451] (-506.062) * (-506.120) [-502.762] (-505.143) (-502.780) -- 0:00:21
649000 -- (-506.142) [-506.755] (-504.162) (-507.166) * (-502.874) (-504.952) [-504.205] (-504.281) -- 0:00:21
649500 -- (-504.191) (-503.560) [-502.627] (-502.488) * (-504.164) (-503.681) (-505.937) [-503.814] -- 0:00:21
650000 -- [-503.890] (-505.241) (-507.458) (-507.254) * (-509.431) (-503.050) [-508.444] (-502.354) -- 0:00:21
Average standard deviation of split frequencies: 0.007501
650500 -- [-510.501] (-508.497) (-504.050) (-505.724) * (-504.650) (-505.132) [-504.915] (-503.265) -- 0:00:21
651000 -- (-502.414) [-504.795] (-505.560) (-504.521) * (-505.364) (-505.794) [-506.443] (-503.976) -- 0:00:21
651500 -- [-502.611] (-503.636) (-507.416) (-506.866) * (-505.167) (-505.639) (-502.800) [-502.203] -- 0:00:21
652000 -- (-503.072) (-504.489) (-504.909) [-504.127] * (-504.468) (-509.096) (-506.014) [-503.325] -- 0:00:21
652500 -- (-505.416) (-504.925) [-503.889] (-506.969) * (-505.142) (-511.210) [-506.723] (-503.987) -- 0:00:21
653000 -- (-508.363) [-503.344] (-503.399) (-503.683) * [-503.789] (-509.144) (-508.170) (-506.551) -- 0:00:21
653500 -- [-505.702] (-503.552) (-502.888) (-505.052) * (-506.507) [-504.255] (-508.255) (-511.025) -- 0:00:21
654000 -- (-504.616) (-503.925) [-502.809] (-505.399) * (-503.162) (-504.603) [-504.969] (-503.450) -- 0:00:21
654500 -- (-514.807) (-505.430) [-503.735] (-507.541) * (-506.675) (-504.266) (-506.358) [-502.165] -- 0:00:21
655000 -- (-505.226) [-502.367] (-502.528) (-502.845) * (-504.435) (-507.353) [-505.764] (-506.948) -- 0:00:21
Average standard deviation of split frequencies: 0.007693
655500 -- (-504.277) [-502.362] (-506.628) (-505.092) * (-503.240) (-506.912) [-505.258] (-505.068) -- 0:00:21
656000 -- [-504.352] (-502.683) (-504.530) (-504.336) * (-503.069) (-503.083) (-509.192) [-504.157] -- 0:00:20
656500 -- (-503.346) (-503.302) (-504.098) [-504.003] * (-507.296) [-503.068] (-503.585) (-505.096) -- 0:00:20
657000 -- (-511.107) [-502.654] (-508.690) (-503.758) * (-502.959) [-504.365] (-508.637) (-503.585) -- 0:00:20
657500 -- (-502.156) (-503.554) (-506.279) [-503.125] * (-503.190) [-504.364] (-508.478) (-503.934) -- 0:00:20
658000 -- [-502.364] (-506.046) (-503.244) (-503.435) * (-505.714) (-504.736) (-506.288) [-505.816] -- 0:00:20
658500 -- (-503.280) (-507.894) (-502.870) [-504.206] * [-503.063] (-507.604) (-503.165) (-505.721) -- 0:00:20
659000 -- (-503.200) (-507.630) [-505.367] (-505.423) * (-503.893) (-506.749) (-504.523) [-502.933] -- 0:00:20
659500 -- (-505.570) (-503.814) [-503.928] (-506.186) * [-504.867] (-507.342) (-503.218) (-507.992) -- 0:00:21
660000 -- [-505.085] (-502.688) (-503.682) (-504.077) * (-503.861) (-504.133) (-502.687) [-504.753] -- 0:00:21
Average standard deviation of split frequencies: 0.007471
660500 -- (-504.552) (-502.751) [-502.046] (-503.664) * [-503.437] (-503.819) (-504.290) (-503.259) -- 0:00:21
661000 -- [-502.910] (-507.371) (-504.752) (-503.703) * [-504.945] (-504.652) (-504.424) (-503.982) -- 0:00:21
661500 -- [-502.105] (-503.372) (-507.078) (-503.379) * (-504.957) (-505.654) (-506.098) [-506.669] -- 0:00:20
662000 -- [-503.438] (-505.479) (-504.397) (-505.674) * (-503.987) (-505.335) (-504.459) [-504.228] -- 0:00:20
662500 -- (-504.284) [-506.024] (-505.336) (-506.962) * (-507.358) [-503.469] (-504.818) (-504.932) -- 0:00:20
663000 -- (-505.839) (-504.492) (-505.845) [-503.795] * (-503.786) (-508.005) [-505.479] (-505.010) -- 0:00:20
663500 -- [-504.210] (-503.451) (-504.543) (-504.549) * [-506.796] (-504.098) (-503.377) (-506.222) -- 0:00:20
664000 -- (-505.602) (-503.699) [-504.367] (-510.323) * [-503.200] (-511.076) (-506.115) (-505.140) -- 0:00:20
664500 -- [-503.567] (-504.942) (-504.977) (-507.036) * (-503.735) (-510.541) (-503.181) [-503.707] -- 0:00:20
665000 -- [-504.325] (-505.336) (-506.884) (-504.227) * [-502.789] (-506.756) (-502.990) (-503.802) -- 0:00:20
Average standard deviation of split frequencies: 0.007495
665500 -- (-507.133) (-502.317) [-502.598] (-504.950) * [-503.377] (-507.710) (-503.396) (-505.668) -- 0:00:20
666000 -- (-503.847) [-504.156] (-502.898) (-503.792) * (-505.223) (-504.868) (-502.802) [-503.839] -- 0:00:20
666500 -- [-503.246] (-506.103) (-505.255) (-503.732) * [-503.685] (-507.605) (-504.512) (-503.451) -- 0:00:20
667000 -- (-504.504) [-504.347] (-503.155) (-502.839) * (-502.927) (-507.659) (-504.830) [-504.640] -- 0:00:20
667500 -- (-509.750) (-505.948) [-502.403] (-502.940) * (-504.660) (-506.765) (-510.517) [-502.508] -- 0:00:20
668000 -- (-506.510) (-507.204) [-505.540] (-502.323) * (-506.183) (-507.104) [-504.463] (-503.434) -- 0:00:20
668500 -- (-503.417) (-509.461) [-504.766] (-502.991) * (-509.137) (-504.200) [-507.214] (-504.149) -- 0:00:20
669000 -- (-504.545) [-506.612] (-506.912) (-503.969) * (-505.420) [-503.380] (-505.302) (-505.204) -- 0:00:20
669500 -- (-508.315) (-504.868) (-503.704) [-504.409] * [-505.473] (-504.739) (-504.034) (-503.449) -- 0:00:20
670000 -- (-505.083) [-503.667] (-504.663) (-505.844) * (-503.070) [-503.865] (-503.682) (-505.809) -- 0:00:20
Average standard deviation of split frequencies: 0.007608
670500 -- [-504.508] (-507.060) (-503.529) (-505.916) * (-503.326) (-504.842) (-503.656) [-506.700] -- 0:00:20
671000 -- (-504.742) (-506.062) (-504.165) [-505.542] * (-505.588) (-505.625) [-502.780] (-505.026) -- 0:00:20
671500 -- (-502.529) (-503.989) [-503.482] (-508.342) * (-508.872) (-508.588) [-504.149] (-503.752) -- 0:00:20
672000 -- (-505.961) (-503.374) [-502.240] (-503.942) * [-504.026] (-505.456) (-503.623) (-503.637) -- 0:00:20
672500 -- (-505.675) (-503.910) (-502.732) [-503.694] * (-510.153) (-506.228) (-508.508) [-503.647] -- 0:00:19
673000 -- (-505.409) (-508.072) [-503.535] (-504.064) * (-503.374) [-507.242] (-504.693) (-503.399) -- 0:00:19
673500 -- (-506.437) [-502.764] (-503.459) (-504.003) * (-505.879) (-502.476) (-504.000) [-505.059] -- 0:00:19
674000 -- (-507.646) (-504.308) [-503.826] (-502.892) * (-505.933) (-504.767) (-505.596) [-504.211] -- 0:00:19
674500 -- (-507.006) [-506.101] (-504.329) (-513.810) * (-502.847) (-505.344) (-504.155) [-506.475] -- 0:00:19
675000 -- (-505.652) [-505.710] (-504.941) (-506.567) * [-503.852] (-504.471) (-502.555) (-506.047) -- 0:00:19
Average standard deviation of split frequencies: 0.007548
675500 -- (-507.612) [-507.424] (-505.961) (-502.448) * (-504.176) (-504.028) (-502.898) [-507.329] -- 0:00:20
676000 -- (-503.440) (-505.537) (-507.274) [-503.052] * (-503.510) (-505.716) [-502.076] (-504.587) -- 0:00:20
676500 -- (-504.671) [-504.103] (-503.568) (-504.726) * (-503.273) [-504.138] (-503.908) (-506.908) -- 0:00:20
677000 -- (-502.631) (-506.395) (-505.624) [-503.156] * (-505.824) [-505.977] (-505.318) (-504.265) -- 0:00:20
677500 -- (-504.210) (-503.869) (-503.866) [-502.463] * (-508.618) (-508.730) [-503.017] (-503.902) -- 0:00:19
678000 -- (-504.483) [-502.504] (-508.494) (-502.595) * (-502.955) [-505.258] (-503.017) (-503.469) -- 0:00:19
678500 -- (-503.808) (-505.171) (-508.635) [-503.818] * (-504.056) (-508.400) [-503.314] (-502.663) -- 0:00:19
679000 -- [-503.137] (-502.892) (-504.588) (-508.664) * (-502.773) (-505.935) [-502.171] (-502.710) -- 0:00:19
679500 -- (-502.839) (-502.362) [-504.439] (-506.026) * (-503.694) [-504.693] (-502.200) (-504.384) -- 0:00:19
680000 -- (-502.956) [-503.368] (-504.272) (-506.006) * (-504.725) (-503.391) (-503.353) [-502.557] -- 0:00:19
Average standard deviation of split frequencies: 0.007292
680500 -- (-504.659) [-505.498] (-504.165) (-518.423) * (-508.569) (-502.695) (-503.341) [-503.851] -- 0:00:19
681000 -- [-505.605] (-503.091) (-504.667) (-505.763) * (-508.193) [-503.465] (-505.900) (-505.077) -- 0:00:19
681500 -- (-505.174) (-505.306) [-502.415] (-504.830) * (-508.154) (-504.300) (-505.752) [-504.087] -- 0:00:19
682000 -- [-505.868] (-504.289) (-505.346) (-506.499) * (-503.576) [-507.530] (-503.214) (-503.886) -- 0:00:19
682500 -- (-506.895) [-504.653] (-504.454) (-505.418) * (-505.007) (-504.109) [-505.227] (-507.564) -- 0:00:19
683000 -- (-504.505) (-504.030) [-504.267] (-505.075) * [-504.191] (-502.539) (-503.757) (-505.353) -- 0:00:19
683500 -- (-503.748) (-504.031) (-505.825) [-507.211] * (-504.493) (-503.169) [-504.485] (-505.351) -- 0:00:19
684000 -- (-505.506) (-503.538) (-508.707) [-503.722] * [-504.442] (-503.158) (-502.121) (-505.178) -- 0:00:19
684500 -- (-503.715) [-503.319] (-505.407) (-503.260) * [-502.184] (-503.118) (-503.208) (-508.589) -- 0:00:19
685000 -- (-507.699) (-504.572) (-505.449) [-502.477] * (-505.263) (-502.614) (-503.586) [-508.025] -- 0:00:19
Average standard deviation of split frequencies: 0.007074
685500 -- (-509.296) [-503.862] (-504.259) (-503.192) * (-503.024) [-504.969] (-504.520) (-503.068) -- 0:00:19
686000 -- [-505.068] (-505.745) (-504.725) (-503.943) * (-503.625) [-502.857] (-503.934) (-503.096) -- 0:00:19
686500 -- (-503.859) [-503.274] (-502.966) (-505.971) * (-502.670) (-503.508) [-503.776] (-505.141) -- 0:00:19
687000 -- [-504.203] (-503.864) (-505.601) (-505.448) * (-505.506) (-508.389) (-502.962) [-503.767] -- 0:00:19
687500 -- (-505.184) [-503.659] (-503.906) (-503.965) * (-503.545) [-503.246] (-505.238) (-505.687) -- 0:00:19
688000 -- (-505.477) (-506.421) (-505.536) [-503.862] * (-504.783) (-504.103) [-505.712] (-504.260) -- 0:00:19
688500 -- [-502.998] (-505.175) (-502.696) (-504.887) * (-504.048) [-504.295] (-503.354) (-504.817) -- 0:00:19
689000 -- [-505.982] (-504.499) (-506.310) (-503.796) * (-507.071) (-504.873) (-504.838) [-503.739] -- 0:00:18
689500 -- [-504.322] (-504.169) (-502.761) (-509.939) * (-506.205) (-503.261) (-504.202) [-504.276] -- 0:00:18
690000 -- (-504.725) [-508.758] (-504.013) (-509.238) * (-506.332) [-504.098] (-512.658) (-503.796) -- 0:00:18
Average standard deviation of split frequencies: 0.007147
690500 -- (-503.203) (-505.660) [-506.339] (-506.933) * (-505.829) (-504.897) (-505.152) [-503.116] -- 0:00:18
691000 -- [-503.345] (-503.824) (-507.195) (-504.441) * [-502.898] (-506.745) (-504.639) (-507.696) -- 0:00:18
691500 -- (-504.274) (-506.460) (-505.810) [-505.918] * (-504.586) [-505.057] (-503.164) (-505.208) -- 0:00:18
692000 -- (-504.824) (-505.861) [-507.351] (-506.629) * (-506.584) [-505.205] (-506.387) (-502.166) -- 0:00:18
692500 -- (-508.922) (-504.586) [-504.737] (-505.571) * [-505.815] (-506.999) (-508.188) (-502.022) -- 0:00:19
693000 -- (-503.208) (-503.618) (-503.731) [-503.806] * [-506.261] (-503.384) (-506.157) (-505.434) -- 0:00:19
693500 -- [-508.418] (-503.214) (-506.533) (-505.689) * (-505.632) (-503.920) [-506.160] (-504.957) -- 0:00:19
694000 -- (-503.107) (-506.356) [-503.222] (-505.154) * (-506.125) (-504.420) [-502.918] (-502.336) -- 0:00:18
694500 -- (-507.901) (-505.247) [-503.409] (-502.855) * (-509.332) (-504.867) [-503.952] (-504.809) -- 0:00:18
695000 -- [-504.786] (-502.708) (-505.497) (-503.552) * (-507.513) (-504.929) [-505.188] (-507.310) -- 0:00:18
Average standard deviation of split frequencies: 0.007450
695500 -- [-504.075] (-502.751) (-506.195) (-507.279) * (-503.353) (-503.532) [-503.386] (-507.700) -- 0:00:18
696000 -- (-503.722) [-503.632] (-502.845) (-504.490) * (-506.918) (-505.328) (-504.123) [-503.937] -- 0:00:18
696500 -- (-505.863) (-510.178) [-504.839] (-503.700) * (-503.476) (-503.255) [-503.923] (-504.804) -- 0:00:18
697000 -- (-505.963) [-503.421] (-504.629) (-503.441) * (-505.618) (-503.645) (-503.940) [-504.082] -- 0:00:18
697500 -- (-503.219) (-504.226) (-505.051) [-505.456] * [-508.337] (-502.897) (-502.784) (-506.277) -- 0:00:18
698000 -- (-503.430) (-503.436) (-503.327) [-503.353] * (-502.854) (-503.144) (-505.796) [-508.191] -- 0:00:18
698500 -- (-502.648) (-503.222) [-505.573] (-503.882) * (-503.197) [-503.979] (-506.611) (-505.873) -- 0:00:18
699000 -- (-502.170) (-505.700) (-504.494) [-503.421] * (-504.990) (-506.218) [-505.505] (-505.202) -- 0:00:18
699500 -- (-504.222) [-507.831] (-503.070) (-503.253) * (-503.932) [-504.990] (-503.603) (-503.928) -- 0:00:18
700000 -- (-503.020) [-504.184] (-503.900) (-506.363) * (-503.484) [-503.531] (-503.350) (-503.776) -- 0:00:18
Average standard deviation of split frequencies: 0.006644
700500 -- (-502.779) (-503.963) (-508.441) [-507.964] * (-503.466) (-503.340) (-505.955) [-505.379] -- 0:00:18
701000 -- (-502.901) (-505.889) (-506.344) [-504.602] * (-504.240) (-509.841) [-506.744] (-503.577) -- 0:00:18
701500 -- (-504.387) (-503.355) [-507.071] (-504.722) * (-503.899) (-508.304) (-503.273) [-504.047] -- 0:00:18
702000 -- [-502.909] (-503.054) (-505.654) (-505.474) * [-505.492] (-504.919) (-504.378) (-502.007) -- 0:00:18
702500 -- (-503.775) (-504.379) (-507.896) [-505.285] * (-504.380) (-503.312) [-504.253] (-505.327) -- 0:00:18
703000 -- (-507.783) [-502.489] (-506.240) (-505.444) * (-503.830) (-505.543) [-503.234] (-504.083) -- 0:00:18
703500 -- (-509.782) (-502.138) [-506.317] (-505.726) * (-503.639) (-506.664) [-503.449] (-505.353) -- 0:00:18
704000 -- (-507.290) [-502.138] (-503.894) (-503.640) * (-504.730) [-504.138] (-502.587) (-503.616) -- 0:00:18
704500 -- (-506.473) (-502.505) (-506.060) [-502.372] * (-502.419) (-502.407) (-506.597) [-506.135] -- 0:00:18
705000 -- (-505.728) (-505.399) [-504.675] (-505.092) * (-504.397) [-503.390] (-507.844) (-505.000) -- 0:00:17
Average standard deviation of split frequencies: 0.006913
705500 -- (-506.313) [-505.191] (-504.081) (-506.190) * [-504.719] (-504.130) (-504.267) (-503.486) -- 0:00:17
706000 -- [-502.828] (-506.334) (-506.286) (-505.076) * [-505.994] (-502.423) (-504.652) (-504.135) -- 0:00:17
706500 -- [-505.299] (-504.596) (-503.803) (-502.385) * (-509.304) (-505.348) [-505.487] (-502.963) -- 0:00:17
707000 -- (-505.346) [-505.356] (-502.080) (-502.429) * (-504.996) (-507.094) [-502.825] (-503.439) -- 0:00:17
707500 -- (-507.267) [-503.541] (-506.775) (-502.590) * (-503.973) (-502.107) [-505.528] (-510.854) -- 0:00:17
708000 -- (-506.680) (-504.711) (-505.927) [-505.338] * [-504.738] (-502.932) (-504.808) (-503.902) -- 0:00:17
708500 -- (-506.082) [-502.752] (-504.433) (-505.223) * (-503.932) (-502.967) [-505.277] (-507.201) -- 0:00:17
709000 -- [-504.275] (-502.342) (-504.076) (-503.573) * (-513.615) [-507.243] (-504.872) (-504.861) -- 0:00:18
709500 -- (-505.464) (-502.616) [-502.854] (-503.288) * (-509.934) (-510.146) [-503.164] (-506.665) -- 0:00:18
710000 -- [-504.803] (-503.722) (-506.413) (-503.176) * (-508.330) [-505.348] (-502.907) (-507.386) -- 0:00:17
Average standard deviation of split frequencies: 0.006716
710500 -- [-506.077] (-503.473) (-506.530) (-506.814) * (-508.922) (-503.722) (-504.323) [-505.189] -- 0:00:17
711000 -- (-504.773) [-503.999] (-503.750) (-504.495) * (-508.005) [-502.519] (-503.428) (-504.928) -- 0:00:17
711500 -- (-504.223) (-504.891) (-503.890) [-504.186] * (-505.071) (-502.878) (-503.197) [-503.268] -- 0:00:17
712000 -- (-503.794) [-503.644] (-505.896) (-503.757) * (-507.446) (-505.735) [-504.506] (-503.480) -- 0:00:17
712500 -- (-506.334) (-503.942) (-504.166) [-506.155] * (-505.701) [-503.147] (-503.652) (-505.177) -- 0:00:17
713000 -- (-505.933) [-504.300] (-505.862) (-503.204) * [-503.714] (-502.817) (-505.432) (-503.610) -- 0:00:17
713500 -- (-505.810) (-502.750) (-503.800) [-503.421] * (-506.173) (-503.126) (-504.006) [-503.447] -- 0:00:17
714000 -- (-505.759) (-503.586) [-503.671] (-503.448) * (-503.168) (-503.474) [-504.427] (-506.425) -- 0:00:17
714500 -- (-507.042) (-505.695) (-504.081) [-503.432] * (-503.152) (-503.033) [-504.587] (-506.912) -- 0:00:17
715000 -- (-503.396) (-505.937) (-507.119) [-509.043] * (-505.813) (-503.673) (-505.215) [-506.240] -- 0:00:17
Average standard deviation of split frequencies: 0.007242
715500 -- [-503.605] (-504.433) (-507.090) (-504.519) * (-506.961) (-503.256) (-503.599) [-507.626] -- 0:00:17
716000 -- (-507.236) [-503.139] (-504.887) (-503.592) * (-506.907) (-504.500) (-504.401) [-502.983] -- 0:00:17
716500 -- (-503.613) (-506.334) [-502.784] (-505.320) * (-502.467) (-507.133) [-505.439] (-503.980) -- 0:00:17
717000 -- [-506.061] (-504.243) (-504.527) (-503.333) * (-505.494) (-505.497) (-504.876) [-505.342] -- 0:00:17
717500 -- (-502.665) [-502.128] (-505.424) (-504.135) * (-504.181) [-504.065] (-506.419) (-505.731) -- 0:00:17
718000 -- (-508.591) (-502.597) [-503.874] (-503.430) * (-502.754) [-503.810] (-502.383) (-506.798) -- 0:00:17
718500 -- (-505.156) (-503.131) [-509.259] (-504.895) * (-504.239) (-503.641) [-502.718] (-503.114) -- 0:00:17
719000 -- (-505.140) (-506.086) [-503.310] (-503.529) * [-502.662] (-503.096) (-502.548) (-502.641) -- 0:00:17
719500 -- (-502.577) (-508.408) (-503.231) [-503.440] * (-504.373) (-507.420) [-505.535] (-503.823) -- 0:00:17
720000 -- (-503.466) [-503.356] (-504.047) (-502.317) * (-510.078) [-503.666] (-504.658) (-504.004) -- 0:00:17
Average standard deviation of split frequencies: 0.007413
720500 -- (-505.665) [-506.407] (-503.832) (-505.398) * (-507.342) (-502.968) (-503.178) [-504.705] -- 0:00:17
721000 -- [-502.297] (-505.580) (-504.864) (-503.229) * [-507.416] (-504.304) (-504.522) (-504.582) -- 0:00:17
721500 -- (-503.842) (-503.118) (-505.992) [-502.940] * (-507.024) (-502.964) (-506.055) [-504.298] -- 0:00:16
722000 -- [-503.402] (-503.205) (-507.867) (-506.747) * (-502.982) (-503.612) [-504.597] (-503.109) -- 0:00:16
722500 -- (-506.001) [-502.672] (-502.499) (-502.639) * (-503.607) (-502.858) (-503.496) [-502.772] -- 0:00:16
723000 -- (-506.048) (-504.291) [-503.105] (-503.501) * (-507.636) (-504.920) [-503.768] (-503.673) -- 0:00:16
723500 -- (-503.048) [-502.620] (-503.722) (-505.588) * (-503.809) (-504.135) (-504.147) [-503.598] -- 0:00:16
724000 -- (-504.218) (-505.535) (-503.544) [-504.589] * (-505.424) (-504.816) (-502.480) [-504.839] -- 0:00:16
724500 -- (-504.030) (-505.125) [-503.167] (-504.258) * [-503.526] (-506.887) (-507.365) (-504.833) -- 0:00:16
725000 -- [-505.451] (-504.882) (-504.596) (-504.342) * (-504.346) (-509.584) [-503.471] (-505.016) -- 0:00:16
Average standard deviation of split frequencies: 0.007359
725500 -- [-504.928] (-505.331) (-503.401) (-502.492) * (-507.250) [-504.583] (-502.311) (-502.433) -- 0:00:17
726000 -- (-505.285) [-503.872] (-503.072) (-502.604) * [-503.224] (-502.661) (-503.027) (-505.912) -- 0:00:16
726500 -- (-504.859) (-508.770) (-504.289) [-504.131] * (-506.148) [-503.997] (-502.672) (-506.596) -- 0:00:16
727000 -- (-502.622) (-506.741) (-503.241) [-502.114] * (-504.277) (-503.452) [-502.605] (-508.290) -- 0:00:16
727500 -- (-505.874) (-503.948) (-505.743) [-505.626] * (-503.641) [-503.156] (-504.486) (-508.318) -- 0:00:16
728000 -- (-503.897) [-504.901] (-505.418) (-504.552) * [-503.607] (-506.189) (-505.990) (-505.012) -- 0:00:16
728500 -- (-502.562) (-503.428) [-503.631] (-505.207) * [-503.153] (-504.055) (-504.112) (-505.774) -- 0:00:16
729000 -- (-503.416) (-504.907) [-503.273] (-505.666) * [-505.358] (-506.795) (-504.236) (-506.759) -- 0:00:16
729500 -- (-505.538) (-502.749) [-505.473] (-510.353) * (-503.916) [-504.394] (-507.586) (-502.974) -- 0:00:16
730000 -- (-503.412) (-505.504) (-504.914) [-504.625] * [-506.957] (-505.196) (-512.622) (-502.466) -- 0:00:16
Average standard deviation of split frequencies: 0.007269
730500 -- (-503.655) (-504.133) (-505.753) [-503.117] * (-503.952) [-505.750] (-503.153) (-502.822) -- 0:00:16
731000 -- (-505.569) [-502.271] (-505.328) (-504.599) * [-505.162] (-504.718) (-505.141) (-503.923) -- 0:00:16
731500 -- (-503.532) (-506.575) [-504.373] (-502.604) * (-504.788) [-502.564] (-511.292) (-504.966) -- 0:00:16
732000 -- (-506.504) (-506.058) (-504.218) [-503.551] * (-505.084) (-505.668) [-502.775] (-508.779) -- 0:00:16
732500 -- (-502.951) (-506.141) (-505.436) [-503.017] * [-504.381] (-504.960) (-503.047) (-502.815) -- 0:00:16
733000 -- (-502.993) (-505.770) (-504.291) [-504.022] * [-504.227] (-503.162) (-503.022) (-502.245) -- 0:00:16
733500 -- [-505.346] (-505.808) (-504.138) (-507.207) * (-507.757) [-504.497] (-504.626) (-504.263) -- 0:00:16
734000 -- (-504.161) (-505.682) [-503.626] (-503.154) * (-508.969) (-505.530) [-505.046] (-502.277) -- 0:00:16
734500 -- (-504.044) (-505.769) [-508.541] (-503.986) * [-503.151] (-503.278) (-504.297) (-502.948) -- 0:00:16
735000 -- (-502.596) (-504.575) (-502.625) [-505.147] * (-503.868) (-502.697) [-502.815] (-505.374) -- 0:00:16
Average standard deviation of split frequencies: 0.007131
735500 -- [-505.949] (-504.629) (-503.936) (-504.069) * (-503.430) (-502.250) (-505.615) [-505.044] -- 0:00:16
736000 -- (-504.486) (-501.970) (-503.923) [-503.519] * (-503.492) (-502.227) [-507.145] (-503.955) -- 0:00:16
736500 -- (-502.784) (-502.725) (-507.996) [-503.749] * (-506.556) (-506.397) [-505.891] (-503.897) -- 0:00:16
737000 -- (-505.685) (-504.093) [-503.552] (-503.988) * [-505.483] (-504.363) (-506.083) (-508.821) -- 0:00:16
737500 -- (-504.468) (-506.292) [-503.007] (-502.605) * (-504.113) (-506.777) [-503.948] (-504.661) -- 0:00:16
738000 -- (-503.188) (-502.919) (-503.978) [-504.445] * (-504.128) (-506.340) (-504.389) [-504.340] -- 0:00:15
738500 -- (-504.054) (-510.504) (-506.087) [-503.831] * [-502.258] (-502.114) (-507.975) (-502.084) -- 0:00:15
739000 -- (-504.011) (-506.724) [-508.056] (-502.158) * [-504.224] (-503.949) (-509.896) (-504.677) -- 0:00:15
739500 -- (-507.073) (-501.921) (-502.340) [-505.900] * (-504.385) [-504.679] (-503.517) (-504.100) -- 0:00:15
740000 -- (-502.459) (-506.940) [-506.562] (-505.766) * (-503.103) (-504.309) [-504.801] (-504.876) -- 0:00:15
Average standard deviation of split frequencies: 0.007213
740500 -- (-505.394) [-506.308] (-504.540) (-506.545) * (-504.584) [-505.661] (-505.040) (-502.392) -- 0:00:15
741000 -- (-505.648) (-506.817) (-506.982) [-505.671] * (-504.175) [-505.808] (-503.303) (-503.563) -- 0:00:15
741500 -- (-512.716) (-503.892) (-504.880) [-505.604] * (-511.881) (-506.744) [-502.612] (-503.522) -- 0:00:15
742000 -- (-507.481) (-506.349) [-502.748] (-505.787) * (-508.228) [-504.234] (-504.795) (-502.690) -- 0:00:15
742500 -- [-502.930] (-504.626) (-503.278) (-507.839) * (-505.719) (-507.022) (-503.971) [-504.655] -- 0:00:15
743000 -- (-505.577) [-504.591] (-505.469) (-504.225) * [-503.752] (-507.238) (-506.323) (-505.028) -- 0:00:15
743500 -- [-504.270] (-505.633) (-507.519) (-502.606) * (-504.525) (-503.570) (-505.661) [-505.406] -- 0:00:15
744000 -- (-503.376) (-503.857) (-505.676) [-506.924] * (-507.742) [-505.645] (-505.042) (-503.466) -- 0:00:15
744500 -- (-502.152) [-503.064] (-509.681) (-502.911) * (-507.262) [-502.739] (-506.918) (-505.436) -- 0:00:15
745000 -- (-503.264) (-503.404) [-505.666] (-502.645) * [-503.753] (-503.618) (-503.790) (-505.189) -- 0:00:15
Average standard deviation of split frequencies: 0.006656
745500 -- (-504.292) [-503.776] (-507.690) (-502.533) * (-508.514) [-503.323] (-503.406) (-505.760) -- 0:00:15
746000 -- [-505.835] (-506.876) (-503.478) (-508.831) * (-507.642) (-502.449) (-502.800) [-507.043] -- 0:00:15
746500 -- (-509.239) (-503.909) [-507.627] (-504.350) * (-509.003) [-507.140] (-505.445) (-505.594) -- 0:00:15
747000 -- (-505.604) (-503.543) [-503.354] (-505.368) * [-504.046] (-504.550) (-505.568) (-507.473) -- 0:00:15
747500 -- (-505.382) (-503.650) [-503.312] (-503.191) * (-503.204) (-505.279) [-503.069] (-505.652) -- 0:00:15
748000 -- (-506.283) [-503.112] (-503.348) (-504.009) * [-505.576] (-510.032) (-504.057) (-504.041) -- 0:00:15
748500 -- (-502.622) (-502.516) [-503.151] (-503.320) * (-503.143) [-504.762] (-503.375) (-506.699) -- 0:00:15
749000 -- [-504.993] (-502.610) (-503.273) (-505.087) * [-502.060] (-503.460) (-504.846) (-503.656) -- 0:00:15
749500 -- (-504.951) [-503.469] (-507.155) (-502.337) * (-506.119) (-504.080) (-503.202) [-504.117] -- 0:00:15
750000 -- (-506.420) (-505.307) (-503.121) [-502.242] * (-503.996) (-502.811) (-504.210) [-502.845] -- 0:00:15
Average standard deviation of split frequencies: 0.007201
750500 -- (-504.642) [-505.700] (-505.045) (-501.909) * (-503.984) (-503.004) (-503.578) [-503.013] -- 0:00:15
751000 -- (-507.412) [-506.705] (-505.887) (-504.863) * [-505.964] (-503.149) (-507.406) (-503.448) -- 0:00:15
751500 -- [-503.489] (-502.961) (-509.949) (-504.478) * (-509.773) (-502.874) (-504.893) [-502.056] -- 0:00:15
752000 -- (-508.658) (-505.548) (-506.974) [-506.555] * (-507.512) (-505.540) [-504.863] (-504.046) -- 0:00:15
752500 -- (-510.247) [-506.164] (-508.186) (-505.102) * [-504.281] (-507.552) (-504.236) (-503.909) -- 0:00:15
753000 -- (-502.751) [-509.344] (-507.911) (-504.517) * (-503.264) (-503.331) (-504.694) [-504.915] -- 0:00:15
753500 -- (-506.232) [-504.689] (-505.195) (-503.164) * (-502.641) (-505.338) (-505.870) [-504.632] -- 0:00:15
754000 -- (-503.413) (-504.098) (-509.031) [-503.325] * (-504.248) [-504.959] (-504.470) (-504.201) -- 0:00:15
754500 -- (-505.256) (-502.760) (-515.119) [-504.201] * (-506.824) [-502.157] (-505.602) (-503.362) -- 0:00:14
755000 -- (-503.279) (-503.712) [-504.396] (-504.934) * (-507.592) (-505.245) (-503.670) [-505.646] -- 0:00:14
Average standard deviation of split frequencies: 0.006901
755500 -- (-508.778) [-503.663] (-506.944) (-504.537) * [-509.944] (-506.097) (-504.582) (-503.613) -- 0:00:14
756000 -- (-501.969) (-505.142) [-504.856] (-504.260) * [-503.593] (-506.956) (-506.650) (-504.001) -- 0:00:14
756500 -- (-502.343) (-506.110) (-507.056) [-502.107] * [-506.506] (-510.508) (-504.375) (-504.540) -- 0:00:14
757000 -- (-506.059) (-504.930) [-503.402] (-502.900) * (-507.550) [-504.083] (-503.366) (-505.265) -- 0:00:14
757500 -- (-504.564) (-502.671) [-503.432] (-503.332) * (-509.823) [-505.014] (-502.924) (-506.727) -- 0:00:15
758000 -- (-504.707) [-504.634] (-508.474) (-505.112) * (-505.160) [-502.910] (-505.769) (-508.038) -- 0:00:15
758500 -- (-505.245) (-503.831) [-505.396] (-505.839) * (-505.131) (-502.809) (-504.687) [-503.506] -- 0:00:14
759000 -- (-503.737) (-502.828) [-505.556] (-506.285) * [-506.188] (-510.752) (-508.573) (-504.828) -- 0:00:14
759500 -- [-504.198] (-502.706) (-503.259) (-509.372) * [-504.524] (-503.305) (-503.180) (-504.176) -- 0:00:14
760000 -- (-504.723) (-504.070) [-504.932] (-506.537) * (-504.294) (-507.196) [-502.732] (-504.726) -- 0:00:14
Average standard deviation of split frequencies: 0.006900
760500 -- (-505.678) (-504.200) (-504.391) [-504.475] * (-503.924) [-504.460] (-504.601) (-502.702) -- 0:00:14
761000 -- (-505.035) (-505.360) [-507.771] (-504.241) * (-507.254) [-506.644] (-504.781) (-506.273) -- 0:00:14
761500 -- [-507.119] (-505.286) (-504.653) (-503.273) * (-505.704) (-502.268) [-504.070] (-502.727) -- 0:00:14
762000 -- [-504.156] (-505.800) (-505.225) (-504.647) * [-502.844] (-502.752) (-503.636) (-504.000) -- 0:00:14
762500 -- (-503.932) (-503.388) [-502.795] (-503.643) * (-503.620) (-515.329) [-504.836] (-504.817) -- 0:00:14
763000 -- (-506.409) (-502.218) [-503.944] (-506.795) * [-504.755] (-504.705) (-510.481) (-505.631) -- 0:00:14
763500 -- (-509.017) (-505.555) (-502.467) [-505.021] * (-507.528) [-503.785] (-503.570) (-504.441) -- 0:00:14
764000 -- (-503.742) (-506.562) (-502.049) [-504.369] * [-503.855] (-506.430) (-503.384) (-504.921) -- 0:00:14
764500 -- [-507.381] (-503.520) (-506.064) (-503.759) * (-502.644) (-504.098) [-502.814] (-505.801) -- 0:00:14
765000 -- (-505.182) (-502.175) (-505.819) [-502.951] * [-503.100] (-507.623) (-503.646) (-505.562) -- 0:00:14
Average standard deviation of split frequencies: 0.007016
765500 -- [-507.278] (-502.490) (-504.039) (-506.453) * (-507.014) (-502.888) (-504.289) [-503.269] -- 0:00:14
766000 -- (-506.840) (-507.075) [-502.787] (-508.128) * (-503.870) (-503.546) [-503.421] (-503.169) -- 0:00:14
766500 -- [-504.232] (-505.328) (-503.227) (-505.781) * (-505.299) [-503.044] (-503.776) (-504.228) -- 0:00:14
767000 -- (-505.798) (-502.988) (-503.938) [-506.090] * [-506.492] (-507.104) (-504.672) (-502.847) -- 0:00:14
767500 -- (-504.791) (-509.267) [-504.089] (-506.645) * (-506.074) (-505.432) [-504.947] (-504.135) -- 0:00:14
768000 -- [-505.089] (-507.419) (-507.022) (-505.577) * (-507.845) (-504.204) [-503.234] (-510.847) -- 0:00:14
768500 -- (-505.050) [-506.606] (-505.892) (-503.558) * (-510.102) (-504.737) [-502.865] (-508.373) -- 0:00:14
769000 -- [-504.460] (-509.000) (-507.157) (-503.813) * [-504.880] (-504.253) (-503.907) (-509.088) -- 0:00:14
769500 -- [-503.415] (-505.689) (-510.213) (-505.427) * (-503.749) (-504.204) (-503.817) [-505.708] -- 0:00:14
770000 -- (-503.901) (-503.920) [-505.105] (-506.150) * (-504.697) (-504.169) [-506.624] (-505.979) -- 0:00:14
Average standard deviation of split frequencies: 0.006932
770500 -- (-505.208) (-505.415) (-503.507) [-504.765] * [-504.044] (-504.184) (-503.916) (-504.358) -- 0:00:13
771000 -- [-504.609] (-510.727) (-502.331) (-504.194) * [-503.475] (-505.296) (-504.063) (-506.832) -- 0:00:13
771500 -- (-504.102) (-505.999) (-502.722) [-507.478] * (-503.651) (-502.909) [-505.802] (-509.608) -- 0:00:13
772000 -- (-506.971) (-506.987) [-504.792] (-509.030) * (-503.349) [-502.428] (-504.462) (-506.904) -- 0:00:13
772500 -- [-505.183] (-502.849) (-506.149) (-510.985) * (-503.065) [-504.229] (-502.218) (-504.965) -- 0:00:13
773000 -- (-504.756) (-503.028) (-502.651) [-505.785] * (-503.737) [-502.735] (-505.556) (-503.876) -- 0:00:13
773500 -- [-505.631] (-503.267) (-502.759) (-503.135) * (-504.115) [-506.887] (-504.036) (-502.916) -- 0:00:13
774000 -- (-502.958) [-502.739] (-506.072) (-503.055) * [-503.362] (-504.841) (-502.643) (-504.426) -- 0:00:14
774500 -- [-505.025] (-504.136) (-506.224) (-504.996) * (-503.443) [-504.635] (-504.410) (-506.276) -- 0:00:13
775000 -- (-504.956) (-508.322) (-507.335) [-505.252] * (-504.866) (-503.564) [-504.166] (-505.010) -- 0:00:13
Average standard deviation of split frequencies: 0.006642
775500 -- (-505.064) (-504.611) (-504.685) [-504.199] * (-502.836) [-503.459] (-503.750) (-503.391) -- 0:00:13
776000 -- (-507.695) (-506.908) [-503.617] (-502.135) * (-502.903) (-503.400) [-502.588] (-504.002) -- 0:00:13
776500 -- [-503.153] (-505.302) (-506.908) (-502.156) * [-502.927] (-505.165) (-504.195) (-502.791) -- 0:00:13
777000 -- (-506.498) (-506.975) [-506.101] (-503.228) * (-505.686) (-504.215) (-504.627) [-504.225] -- 0:00:13
777500 -- (-504.219) (-504.954) [-503.362] (-505.589) * (-504.734) (-505.594) (-505.132) [-503.923] -- 0:00:13
778000 -- (-502.142) (-504.795) [-502.283] (-503.322) * [-503.710] (-505.886) (-506.338) (-505.397) -- 0:00:13
778500 -- (-502.406) (-504.697) [-502.726] (-502.613) * (-506.380) (-503.232) (-504.794) [-505.409] -- 0:00:13
779000 -- (-503.296) [-502.830] (-503.867) (-502.778) * (-504.372) (-503.030) (-507.140) [-506.587] -- 0:00:13
779500 -- (-503.138) (-504.096) (-507.529) [-504.018] * [-504.331] (-504.537) (-505.502) (-506.090) -- 0:00:13
780000 -- (-504.590) (-504.382) (-504.803) [-504.858] * (-506.847) [-503.440] (-507.318) (-504.110) -- 0:00:13
Average standard deviation of split frequencies: 0.006723
780500 -- (-502.002) [-503.708] (-503.040) (-502.876) * (-504.391) (-504.332) (-502.197) [-504.613] -- 0:00:13
781000 -- (-502.488) (-503.517) (-502.646) [-503.091] * (-503.618) (-504.957) [-502.192] (-504.512) -- 0:00:13
781500 -- (-502.988) (-508.244) (-502.541) [-502.544] * (-503.736) [-502.983] (-503.971) (-506.229) -- 0:00:13
782000 -- [-502.992] (-504.444) (-503.483) (-505.455) * [-505.518] (-502.190) (-505.853) (-504.763) -- 0:00:13
782500 -- (-503.492) (-505.461) (-504.125) [-504.859] * (-502.628) (-504.051) [-505.170] (-505.993) -- 0:00:13
783000 -- (-506.497) [-505.966] (-503.008) (-503.912) * (-504.829) (-506.103) (-505.562) [-503.453] -- 0:00:13
783500 -- (-506.608) (-505.154) [-503.422] (-501.985) * [-502.786] (-503.222) (-504.073) (-502.918) -- 0:00:13
784000 -- (-503.265) [-504.317] (-504.484) (-503.511) * (-504.265) [-505.329] (-507.785) (-502.725) -- 0:00:13
784500 -- (-504.820) (-502.977) (-504.915) [-503.590] * (-503.497) (-504.880) (-504.474) [-502.844] -- 0:00:13
785000 -- [-508.172] (-504.785) (-505.007) (-502.988) * (-508.535) [-503.266] (-504.860) (-502.183) -- 0:00:13
Average standard deviation of split frequencies: 0.006557
785500 -- (-509.559) [-504.056] (-505.261) (-503.157) * (-505.779) (-504.007) [-506.739] (-503.629) -- 0:00:13
786000 -- (-505.997) (-502.801) [-505.101] (-506.767) * [-503.839] (-504.497) (-506.302) (-505.224) -- 0:00:13
786500 -- [-504.222] (-505.690) (-503.172) (-506.832) * [-504.691] (-507.624) (-503.307) (-509.023) -- 0:00:13
787000 -- (-507.179) (-504.966) [-503.100] (-507.068) * [-505.103] (-505.517) (-505.537) (-510.334) -- 0:00:13
787500 -- (-504.562) (-505.536) [-503.778] (-503.595) * (-505.934) (-505.532) (-509.010) [-507.112] -- 0:00:13
788000 -- [-507.281] (-502.332) (-504.059) (-503.552) * [-503.918] (-503.035) (-506.269) (-503.775) -- 0:00:13
788500 -- [-505.385] (-504.273) (-504.104) (-502.572) * [-502.774] (-504.812) (-503.611) (-503.161) -- 0:00:13
789000 -- (-506.490) (-502.557) (-503.478) [-505.464] * (-504.234) [-504.272] (-504.782) (-505.868) -- 0:00:13
789500 -- (-508.700) [-502.267] (-502.937) (-503.455) * (-505.719) (-506.291) (-503.232) [-505.591] -- 0:00:13
790000 -- (-506.032) (-502.851) (-506.280) [-504.118] * (-506.062) [-505.115] (-507.527) (-506.450) -- 0:00:13
Average standard deviation of split frequencies: 0.006757
790500 -- (-507.234) [-504.246] (-503.108) (-508.224) * (-505.369) (-503.962) [-504.720] (-502.903) -- 0:00:12
791000 -- (-506.282) (-504.389) (-505.320) [-503.576] * (-505.273) [-504.440] (-506.071) (-504.722) -- 0:00:12
791500 -- (-503.381) (-503.463) (-502.669) [-503.159] * (-505.242) [-505.790] (-504.116) (-503.302) -- 0:00:12
792000 -- (-503.564) (-511.798) [-503.640] (-509.469) * (-504.783) [-504.487] (-505.148) (-503.860) -- 0:00:12
792500 -- (-507.751) (-505.984) (-504.322) [-504.652] * (-502.971) [-505.432] (-503.194) (-506.237) -- 0:00:12
793000 -- (-503.901) [-507.073] (-503.069) (-507.792) * (-504.431) (-505.287) [-503.250] (-502.194) -- 0:00:12
793500 -- [-504.328] (-508.361) (-502.315) (-502.463) * (-502.920) (-505.745) [-502.738] (-503.051) -- 0:00:12
794000 -- (-505.111) [-506.055] (-505.624) (-502.730) * (-505.304) [-504.781] (-504.462) (-503.849) -- 0:00:12
794500 -- (-502.860) [-504.374] (-508.955) (-510.301) * (-506.475) (-502.972) (-503.103) [-504.579] -- 0:00:12
795000 -- [-502.857] (-505.722) (-506.766) (-504.229) * (-506.093) (-503.304) [-508.080] (-503.629) -- 0:00:12
Average standard deviation of split frequencies: 0.007067
795500 -- (-506.669) (-503.091) [-505.876] (-508.918) * [-502.578] (-502.625) (-507.805) (-505.647) -- 0:00:12
796000 -- (-512.423) (-504.249) (-503.832) [-506.143] * (-503.385) [-506.090] (-504.421) (-504.367) -- 0:00:12
796500 -- (-505.061) (-502.709) (-503.839) [-504.035] * (-505.292) (-506.336) (-503.335) [-505.296] -- 0:00:12
797000 -- (-502.269) [-503.952] (-505.204) (-504.347) * (-503.399) [-504.346] (-503.736) (-504.499) -- 0:00:12
797500 -- (-504.197) [-506.538] (-506.942) (-504.142) * (-505.577) [-503.668] (-502.996) (-507.074) -- 0:00:12
798000 -- (-506.030) (-503.759) (-502.694) [-503.703] * (-503.999) [-503.263] (-503.413) (-502.911) -- 0:00:12
798500 -- (-503.190) [-504.811] (-503.152) (-504.408) * (-505.361) (-507.508) (-504.762) [-502.549] -- 0:00:12
799000 -- [-502.938] (-505.432) (-506.350) (-506.401) * (-503.797) [-513.288] (-504.249) (-502.957) -- 0:00:12
799500 -- (-507.661) (-507.156) (-503.984) [-502.683] * (-503.527) (-506.902) [-506.663] (-504.343) -- 0:00:12
800000 -- [-505.391] (-502.852) (-503.488) (-502.280) * (-511.063) [-507.054] (-506.886) (-508.228) -- 0:00:12
Average standard deviation of split frequencies: 0.007222
800500 -- [-503.933] (-503.159) (-504.353) (-502.973) * (-507.316) (-504.021) (-509.222) [-506.567] -- 0:00:12
801000 -- (-503.295) [-504.977] (-505.357) (-504.408) * (-504.136) [-504.117] (-503.651) (-506.145) -- 0:00:12
801500 -- (-504.158) (-504.692) [-502.663] (-503.541) * [-506.737] (-504.367) (-504.863) (-502.466) -- 0:00:12
802000 -- (-503.373) [-503.148] (-502.978) (-505.065) * (-506.328) [-503.179] (-505.407) (-506.290) -- 0:00:12
802500 -- (-503.010) [-503.556] (-503.818) (-507.317) * (-508.467) [-506.106] (-505.186) (-503.658) -- 0:00:12
803000 -- (-505.137) (-503.099) (-503.009) [-505.678] * (-505.489) (-506.791) [-502.558] (-503.463) -- 0:00:12
803500 -- (-505.658) (-502.670) [-501.940] (-505.200) * (-505.366) (-506.110) [-502.547] (-504.366) -- 0:00:12
804000 -- (-502.656) (-502.491) (-506.292) [-503.358] * (-504.933) [-504.462] (-504.976) (-505.304) -- 0:00:12
804500 -- (-502.474) (-502.205) [-505.722] (-502.771) * (-503.951) (-503.796) [-506.500] (-503.724) -- 0:00:12
805000 -- (-503.931) (-507.534) [-506.307] (-502.925) * (-503.948) (-502.822) [-504.590] (-506.057) -- 0:00:12
Average standard deviation of split frequencies: 0.007057
805500 -- [-503.907] (-502.832) (-504.770) (-504.521) * (-508.377) (-504.543) (-505.730) [-503.333] -- 0:00:12
806000 -- (-505.989) (-505.213) (-505.110) [-502.147] * [-503.129] (-505.200) (-507.142) (-505.178) -- 0:00:12
806500 -- (-503.140) [-502.211] (-505.026) (-502.507) * [-503.659] (-502.175) (-504.792) (-506.084) -- 0:00:11
807000 -- (-503.277) (-503.463) (-503.917) [-503.558] * [-503.486] (-503.057) (-504.474) (-504.631) -- 0:00:11
807500 -- (-502.849) (-502.491) (-506.945) [-503.654] * (-505.336) [-502.516] (-504.022) (-503.768) -- 0:00:11
808000 -- (-505.692) [-503.874] (-505.926) (-504.682) * (-505.847) (-502.881) (-503.985) [-502.947] -- 0:00:11
808500 -- (-504.766) (-502.454) [-504.377] (-503.722) * (-506.613) [-502.057] (-502.217) (-504.281) -- 0:00:11
809000 -- (-505.547) [-502.784] (-504.525) (-504.208) * [-502.949] (-502.849) (-505.466) (-504.955) -- 0:00:11
809500 -- [-507.104] (-505.201) (-504.990) (-504.952) * (-507.001) (-502.091) [-506.649] (-504.964) -- 0:00:11
810000 -- (-510.716) (-505.027) [-504.965] (-501.978) * (-503.573) (-503.094) [-504.845] (-504.476) -- 0:00:11
Average standard deviation of split frequencies: 0.007094
810500 -- (-505.542) (-509.241) (-504.261) [-503.390] * (-503.569) (-502.909) (-507.061) [-502.210] -- 0:00:11
811000 -- (-504.032) (-504.321) [-508.729] (-503.439) * (-505.760) [-503.191] (-504.157) (-502.453) -- 0:00:11
811500 -- [-505.063] (-503.973) (-502.560) (-503.036) * (-504.730) [-503.195] (-507.576) (-505.542) -- 0:00:11
812000 -- [-503.046] (-507.328) (-505.797) (-505.071) * (-502.999) (-504.076) [-502.693] (-502.216) -- 0:00:11
812500 -- (-502.618) (-502.555) [-502.321] (-502.133) * (-503.699) (-505.359) [-505.970] (-504.566) -- 0:00:11
813000 -- (-503.780) (-507.642) [-502.393] (-502.850) * [-502.735] (-507.129) (-504.007) (-503.838) -- 0:00:11
813500 -- (-505.341) (-505.307) (-506.642) [-502.562] * [-504.340] (-504.025) (-502.533) (-507.133) -- 0:00:11
814000 -- (-507.053) (-507.238) (-505.880) [-502.833] * [-503.453] (-504.657) (-504.909) (-504.720) -- 0:00:11
814500 -- (-504.207) (-511.547) (-503.713) [-505.966] * (-508.051) [-502.880] (-504.075) (-503.487) -- 0:00:11
815000 -- (-503.411) [-505.954] (-504.927) (-505.646) * [-505.674] (-503.230) (-503.708) (-502.534) -- 0:00:11
Average standard deviation of split frequencies: 0.006932
815500 -- (-504.453) (-504.155) (-503.835) [-504.887] * (-508.584) [-507.672] (-508.449) (-505.351) -- 0:00:11
816000 -- [-505.913] (-506.416) (-502.658) (-505.069) * (-504.652) (-504.236) (-507.760) [-506.990] -- 0:00:11
816500 -- (-502.339) (-504.715) [-506.524] (-504.891) * (-508.794) (-506.617) [-506.922] (-506.177) -- 0:00:11
817000 -- [-505.523] (-502.379) (-502.726) (-503.218) * (-504.026) (-505.834) (-503.964) [-503.369] -- 0:00:11
817500 -- (-504.637) (-503.006) (-502.829) [-504.079] * (-503.395) (-508.274) [-505.123] (-503.622) -- 0:00:11
818000 -- (-504.336) (-505.324) (-502.898) [-505.444] * (-503.175) (-502.575) (-504.025) [-502.960] -- 0:00:11
818500 -- (-505.988) [-507.194] (-507.471) (-503.674) * [-507.858] (-502.905) (-504.758) (-505.697) -- 0:00:11
819000 -- (-503.942) (-503.214) (-503.170) [-503.064] * (-503.292) [-502.950] (-507.990) (-503.032) -- 0:00:11
819500 -- (-506.332) [-503.537] (-503.820) (-507.897) * (-503.249) (-502.768) [-504.867] (-503.185) -- 0:00:11
820000 -- (-505.598) (-504.806) (-503.459) [-503.233] * (-504.827) (-505.484) [-509.588] (-503.238) -- 0:00:11
Average standard deviation of split frequencies: 0.007161
820500 -- (-507.362) (-505.212) [-503.789] (-506.226) * (-503.895) (-506.272) (-507.754) [-505.662] -- 0:00:11
821000 -- (-508.114) (-506.478) (-505.641) [-505.682] * (-502.015) (-505.823) [-503.839] (-503.844) -- 0:00:11
821500 -- [-504.645] (-507.131) (-506.529) (-505.747) * (-502.015) (-502.192) [-504.561] (-506.168) -- 0:00:11
822000 -- [-505.459] (-504.720) (-505.610) (-506.440) * [-506.552] (-502.509) (-511.772) (-503.772) -- 0:00:11
822500 -- (-507.273) (-507.256) (-505.210) [-505.497] * (-502.645) (-503.934) (-506.852) [-505.935] -- 0:00:11
823000 -- [-502.927] (-504.389) (-506.042) (-502.985) * (-506.111) (-503.529) [-504.471] (-504.054) -- 0:00:10
823500 -- (-504.427) (-504.683) [-506.353] (-503.016) * (-507.864) (-503.024) (-506.703) [-503.366] -- 0:00:10
824000 -- (-504.320) (-507.854) (-507.571) [-503.188] * (-505.440) [-502.261] (-504.225) (-505.077) -- 0:00:10
824500 -- [-503.359] (-504.546) (-505.070) (-505.439) * (-512.840) [-503.904] (-507.263) (-504.721) -- 0:00:10
825000 -- (-503.648) [-503.690] (-504.269) (-506.169) * (-507.412) (-502.259) [-502.815] (-503.647) -- 0:00:10
Average standard deviation of split frequencies: 0.007153
825500 -- (-508.105) (-507.692) [-502.917] (-504.531) * (-504.354) (-504.637) [-504.480] (-503.345) -- 0:00:10
826000 -- (-509.753) [-503.723] (-504.472) (-504.351) * [-504.266] (-504.538) (-502.721) (-505.266) -- 0:00:10
826500 -- [-510.719] (-503.018) (-502.624) (-503.368) * (-503.528) (-502.850) (-505.297) [-506.263] -- 0:00:10
827000 -- [-507.777] (-504.713) (-503.537) (-503.388) * (-504.647) [-504.383] (-504.025) (-504.022) -- 0:00:10
827500 -- (-503.865) (-502.957) [-507.667] (-502.910) * (-504.296) (-509.143) [-503.557] (-504.526) -- 0:00:10
828000 -- (-504.024) (-507.266) (-505.161) [-506.482] * [-503.301] (-507.157) (-504.657) (-505.337) -- 0:00:10
828500 -- (-502.774) (-504.718) [-505.890] (-505.290) * [-502.721] (-504.269) (-502.193) (-504.951) -- 0:00:10
829000 -- (-502.812) [-504.031] (-508.583) (-503.446) * [-504.793] (-503.324) (-503.136) (-505.262) -- 0:00:10
829500 -- [-502.932] (-507.387) (-506.625) (-502.848) * [-503.803] (-507.553) (-504.494) (-505.122) -- 0:00:10
830000 -- (-505.829) (-506.166) (-504.077) [-503.481] * [-502.273] (-510.983) (-507.561) (-503.573) -- 0:00:10
Average standard deviation of split frequencies: 0.006999
830500 -- [-506.967] (-507.444) (-503.720) (-505.955) * (-502.870) (-502.690) (-507.715) [-503.094] -- 0:00:10
831000 -- [-502.810] (-506.000) (-507.801) (-504.573) * (-508.335) (-506.201) [-510.883] (-507.360) -- 0:00:10
831500 -- (-505.528) (-502.054) [-502.711] (-509.013) * (-504.173) [-503.970] (-503.881) (-503.561) -- 0:00:10
832000 -- (-503.100) (-508.623) [-503.332] (-507.394) * (-508.332) [-502.905] (-504.414) (-505.251) -- 0:00:10
832500 -- [-503.249] (-508.139) (-505.443) (-502.913) * (-506.326) (-503.582) (-504.017) [-502.864] -- 0:00:10
833000 -- (-503.330) (-504.454) (-506.153) [-504.188] * (-503.108) [-502.604] (-503.387) (-504.202) -- 0:00:10
833500 -- [-506.300] (-503.155) (-503.078) (-510.841) * (-503.617) (-504.600) [-503.444] (-503.290) -- 0:00:10
834000 -- (-503.912) (-505.300) [-505.113] (-515.797) * (-510.066) (-507.815) (-505.051) [-503.102] -- 0:00:10
834500 -- (-503.715) (-506.755) (-508.048) [-507.916] * (-507.128) (-505.527) (-511.168) [-503.098] -- 0:00:10
835000 -- (-505.732) [-503.011] (-502.860) (-506.404) * [-503.303] (-504.141) (-504.515) (-502.974) -- 0:00:10
Average standard deviation of split frequencies: 0.006879
835500 -- [-504.332] (-502.731) (-504.738) (-502.757) * [-503.844] (-505.689) (-502.252) (-503.215) -- 0:00:10
836000 -- (-503.118) (-503.751) [-504.781] (-503.187) * (-504.258) [-502.467] (-504.557) (-506.105) -- 0:00:10
836500 -- [-502.080] (-506.039) (-502.362) (-507.877) * (-503.972) [-504.037] (-504.424) (-504.747) -- 0:00:10
837000 -- [-503.032] (-504.469) (-506.361) (-502.715) * (-504.273) (-503.154) [-503.058] (-504.093) -- 0:00:10
837500 -- (-503.081) (-503.803) [-503.882] (-502.409) * (-502.298) (-502.708) (-503.328) [-503.852] -- 0:00:10
838000 -- (-502.767) [-503.068] (-505.298) (-503.917) * (-504.535) (-502.553) (-503.646) [-503.269] -- 0:00:10
838500 -- (-502.730) (-504.797) [-503.228] (-503.398) * (-502.869) (-503.113) [-503.282] (-502.183) -- 0:00:10
839000 -- (-504.098) [-503.054] (-503.024) (-503.236) * [-503.840] (-507.958) (-503.117) (-502.168) -- 0:00:09
839500 -- (-508.117) (-503.870) [-503.293] (-503.772) * (-503.681) (-504.050) (-504.792) [-503.323] -- 0:00:09
840000 -- (-508.405) (-503.699) [-502.444] (-505.259) * (-502.873) (-503.718) [-503.014] (-503.390) -- 0:00:09
Average standard deviation of split frequencies: 0.006879
840500 -- (-503.532) (-503.627) (-503.406) [-502.772] * [-503.138] (-504.117) (-503.083) (-502.865) -- 0:00:09
841000 -- [-504.893] (-502.972) (-503.078) (-502.612) * [-503.642] (-503.725) (-503.956) (-502.644) -- 0:00:09
841500 -- [-504.193] (-503.010) (-503.009) (-504.216) * (-503.024) (-504.277) (-507.703) [-504.949] -- 0:00:09
842000 -- [-503.739] (-502.447) (-504.924) (-504.735) * (-504.834) (-505.995) [-503.224] (-506.142) -- 0:00:09
842500 -- (-508.192) (-506.308) (-504.065) [-504.414] * [-503.174] (-505.263) (-506.283) (-508.304) -- 0:00:09
843000 -- (-503.814) (-507.681) (-503.506) [-504.488] * (-504.207) [-502.428] (-505.757) (-503.071) -- 0:00:09
843500 -- (-505.373) [-505.713] (-505.992) (-504.526) * (-502.752) (-504.338) (-505.523) [-502.610] -- 0:00:09
844000 -- (-503.011) (-506.927) [-504.601] (-505.730) * (-503.447) (-502.059) (-503.948) [-504.361] -- 0:00:09
844500 -- (-502.975) [-503.782] (-503.241) (-507.685) * [-503.185] (-505.136) (-503.917) (-505.186) -- 0:00:09
845000 -- (-502.922) (-504.115) (-505.520) [-507.267] * (-503.019) (-507.269) (-503.955) [-506.701] -- 0:00:09
Average standard deviation of split frequencies: 0.006984
845500 -- (-504.928) (-503.039) [-503.927] (-503.588) * (-503.969) (-502.626) [-502.489] (-504.856) -- 0:00:09
846000 -- (-504.139) (-502.714) (-502.482) [-505.355] * [-503.289] (-505.656) (-504.587) (-505.683) -- 0:00:09
846500 -- (-505.948) (-502.008) [-506.545] (-504.636) * (-503.550) (-505.504) [-504.092] (-502.961) -- 0:00:09
847000 -- (-504.359) [-502.686] (-504.002) (-507.947) * (-504.969) (-508.102) (-508.742) [-502.338] -- 0:00:09
847500 -- [-503.992] (-503.778) (-502.899) (-507.639) * (-505.838) (-505.987) [-505.968] (-503.779) -- 0:00:09
848000 -- [-504.954] (-502.375) (-509.164) (-506.367) * [-502.330] (-504.327) (-504.120) (-505.495) -- 0:00:09
848500 -- (-507.752) (-502.736) (-504.890) [-504.467] * (-502.147) [-502.943] (-505.505) (-504.444) -- 0:00:09
849000 -- [-504.220] (-503.007) (-504.010) (-503.077) * [-504.123] (-505.155) (-505.501) (-507.022) -- 0:00:09
849500 -- [-505.205] (-502.963) (-502.287) (-503.129) * (-506.695) (-504.458) [-506.599] (-506.474) -- 0:00:09
850000 -- (-505.173) (-502.898) (-506.867) [-502.717] * [-505.160] (-503.360) (-507.148) (-510.677) -- 0:00:09
Average standard deviation of split frequencies: 0.007056
850500 -- [-502.611] (-505.508) (-507.127) (-507.247) * (-502.453) [-503.220] (-507.161) (-505.627) -- 0:00:09
851000 -- (-506.181) (-504.345) [-503.951] (-512.311) * (-503.054) (-503.316) (-502.414) [-504.287] -- 0:00:09
851500 -- [-503.196] (-505.683) (-504.248) (-505.763) * (-506.471) (-505.789) (-502.228) [-503.042] -- 0:00:09
852000 -- (-506.179) [-505.546] (-506.455) (-504.530) * (-504.383) (-503.888) [-504.878] (-504.240) -- 0:00:09
852500 -- [-505.353] (-506.642) (-505.771) (-503.997) * (-505.544) (-504.035) [-504.212] (-503.753) -- 0:00:09
853000 -- (-505.424) (-502.849) (-503.528) [-503.172] * (-502.725) [-503.991] (-509.116) (-504.752) -- 0:00:09
853500 -- (-506.061) (-507.803) (-504.537) [-503.272] * [-502.193] (-503.990) (-508.128) (-508.857) -- 0:00:09
854000 -- (-506.561) (-503.419) (-503.182) [-502.500] * [-502.782] (-505.028) (-512.679) (-505.386) -- 0:00:09
854500 -- (-503.656) [-502.833] (-502.830) (-508.048) * (-505.016) (-504.348) (-506.063) [-504.828] -- 0:00:09
855000 -- (-504.908) (-504.757) (-507.349) [-506.277] * (-502.077) (-503.530) (-507.716) [-505.776] -- 0:00:08
Average standard deviation of split frequencies: 0.007379
855500 -- (-505.789) (-505.080) (-504.703) [-507.584] * (-504.785) (-504.141) [-503.156] (-506.110) -- 0:00:08
856000 -- (-503.826) (-504.143) [-504.137] (-502.978) * [-504.614] (-503.514) (-503.193) (-504.379) -- 0:00:08
856500 -- (-503.569) [-502.914] (-503.838) (-502.808) * (-502.858) [-503.940] (-506.607) (-505.158) -- 0:00:08
857000 -- (-502.968) (-503.520) (-503.533) [-502.598] * (-506.363) (-505.001) [-503.861] (-503.555) -- 0:00:08
857500 -- (-504.526) [-503.677] (-506.278) (-503.938) * [-507.536] (-502.814) (-504.879) (-509.455) -- 0:00:08
858000 -- (-509.694) (-503.162) [-502.536] (-503.624) * (-503.988) (-504.211) [-502.838] (-504.526) -- 0:00:08
858500 -- (-504.746) (-504.990) (-504.397) [-502.886] * (-504.031) (-507.408) [-506.447] (-502.843) -- 0:00:08
859000 -- (-506.482) (-506.900) [-504.049] (-507.561) * (-504.850) (-503.399) [-505.419] (-506.759) -- 0:00:08
859500 -- [-503.520] (-504.203) (-506.346) (-506.808) * (-505.098) [-504.265] (-503.412) (-506.177) -- 0:00:08
860000 -- (-505.072) (-508.026) [-503.062] (-503.922) * [-503.916] (-503.083) (-505.035) (-502.591) -- 0:00:08
Average standard deviation of split frequencies: 0.007376
860500 -- (-504.029) [-503.995] (-503.450) (-508.629) * [-506.292] (-504.686) (-506.643) (-507.325) -- 0:00:08
861000 -- [-502.735] (-504.344) (-503.242) (-510.319) * (-505.480) (-504.050) (-504.899) [-503.030] -- 0:00:08
861500 -- [-503.035] (-505.772) (-508.080) (-505.548) * (-506.747) (-502.997) (-504.132) [-508.911] -- 0:00:08
862000 -- (-507.649) (-505.309) [-503.679] (-503.394) * (-504.336) (-504.084) (-503.148) [-508.840] -- 0:00:08
862500 -- [-502.419] (-504.468) (-504.047) (-504.242) * [-503.405] (-502.555) (-502.519) (-505.854) -- 0:00:08
863000 -- [-502.524] (-504.549) (-503.451) (-504.922) * [-505.899] (-506.139) (-502.244) (-505.096) -- 0:00:08
863500 -- (-502.475) (-503.587) (-503.107) [-505.076] * (-506.337) [-504.108] (-505.054) (-502.791) -- 0:00:08
864000 -- (-502.566) (-503.895) [-502.390] (-505.071) * (-507.225) (-503.459) [-502.733] (-503.615) -- 0:00:08
864500 -- (-504.676) (-503.809) (-508.161) [-502.586] * (-505.312) (-503.174) [-502.150] (-503.759) -- 0:00:08
865000 -- [-503.892] (-508.816) (-503.248) (-504.006) * (-503.892) (-504.609) [-502.826] (-511.617) -- 0:00:08
Average standard deviation of split frequencies: 0.006931
865500 -- (-503.756) (-506.213) (-507.310) [-504.474] * (-504.034) [-505.168] (-503.372) (-504.879) -- 0:00:08
866000 -- (-504.471) (-503.657) (-503.166) [-503.123] * (-505.808) (-502.622) [-503.724] (-502.858) -- 0:00:08
866500 -- [-502.743] (-503.861) (-504.362) (-503.681) * (-504.543) (-503.914) [-504.122] (-502.268) -- 0:00:08
867000 -- (-503.724) [-504.700] (-502.924) (-503.148) * (-504.344) (-505.593) (-504.973) [-502.198] -- 0:00:08
867500 -- (-503.532) (-504.002) [-504.227] (-503.476) * (-503.321) (-506.607) [-502.503] (-504.300) -- 0:00:08
868000 -- (-502.955) [-502.950] (-503.271) (-504.141) * (-502.954) (-504.572) [-503.730] (-507.429) -- 0:00:08
868500 -- (-502.839) (-503.857) (-502.721) [-503.174] * (-508.216) (-505.606) [-503.652] (-504.811) -- 0:00:08
869000 -- (-503.750) (-503.941) [-503.423] (-504.221) * (-504.586) (-505.413) [-504.914] (-505.726) -- 0:00:08
869500 -- (-503.626) [-506.885] (-503.418) (-504.454) * (-503.124) [-503.197] (-504.549) (-507.608) -- 0:00:08
870000 -- (-502.925) (-503.108) [-505.683] (-505.779) * [-503.801] (-503.687) (-504.345) (-508.898) -- 0:00:08
Average standard deviation of split frequencies: 0.006750
870500 -- (-506.388) [-505.264] (-502.976) (-505.673) * (-504.752) [-503.532] (-504.516) (-502.811) -- 0:00:08
871000 -- (-504.534) (-506.520) (-503.583) [-506.459] * [-504.515] (-504.891) (-503.434) (-506.054) -- 0:00:07
871500 -- (-504.133) [-505.813] (-506.591) (-505.366) * [-502.343] (-504.916) (-505.633) (-504.951) -- 0:00:07
872000 -- (-505.002) (-506.829) [-502.318] (-508.497) * [-502.667] (-503.205) (-506.556) (-504.846) -- 0:00:07
872500 -- (-503.170) (-502.485) [-503.561] (-505.562) * (-502.294) [-503.869] (-508.785) (-508.760) -- 0:00:07
873000 -- (-503.617) [-505.141] (-506.104) (-503.593) * (-502.297) [-503.872] (-503.356) (-506.412) -- 0:00:07
873500 -- (-506.052) [-505.123] (-507.364) (-503.923) * (-505.610) [-504.074] (-504.026) (-504.148) -- 0:00:07
874000 -- (-502.595) [-509.483] (-505.247) (-503.906) * (-502.391) (-505.588) [-504.837] (-506.005) -- 0:00:07
874500 -- [-505.662] (-505.641) (-505.846) (-504.495) * (-503.805) (-504.970) [-504.825] (-505.646) -- 0:00:07
875000 -- (-504.341) (-508.732) [-503.323] (-502.671) * (-503.540) [-507.059] (-505.523) (-504.348) -- 0:00:07
Average standard deviation of split frequencies: 0.006673
875500 -- [-505.205] (-506.170) (-505.168) (-502.345) * (-502.299) (-505.195) (-504.799) [-505.592] -- 0:00:07
876000 -- (-505.799) [-503.918] (-504.908) (-503.645) * (-504.671) [-505.574] (-504.816) (-503.185) -- 0:00:07
876500 -- (-504.086) [-503.954] (-502.897) (-508.939) * (-503.173) [-503.302] (-505.466) (-505.570) -- 0:00:07
877000 -- [-503.021] (-504.609) (-505.313) (-509.335) * (-506.011) [-503.154] (-504.532) (-505.434) -- 0:00:07
877500 -- (-505.197) [-504.701] (-502.901) (-502.693) * (-505.243) [-503.097] (-502.829) (-502.281) -- 0:00:07
878000 -- (-505.787) (-503.390) [-502.591] (-504.532) * (-505.719) [-505.510] (-502.556) (-506.657) -- 0:00:07
878500 -- (-503.653) [-504.140] (-505.185) (-503.297) * (-505.829) (-504.552) (-502.496) [-503.962] -- 0:00:07
879000 -- (-503.074) (-504.986) (-503.827) [-502.872] * (-505.658) [-504.563] (-505.900) (-502.380) -- 0:00:07
879500 -- (-506.678) (-504.683) (-502.317) [-502.894] * [-503.763] (-505.223) (-504.652) (-503.033) -- 0:00:07
880000 -- (-508.051) (-503.830) (-502.874) [-502.469] * (-505.271) (-503.793) [-504.311] (-504.105) -- 0:00:07
Average standard deviation of split frequencies: 0.007101
880500 -- (-505.772) [-503.495] (-503.431) (-502.660) * (-503.683) (-504.589) (-504.921) [-505.122] -- 0:00:07
881000 -- [-503.671] (-502.510) (-505.461) (-502.679) * [-505.857] (-506.169) (-502.956) (-503.307) -- 0:00:07
881500 -- [-504.820] (-502.632) (-505.225) (-503.583) * [-503.881] (-504.825) (-504.510) (-503.434) -- 0:00:07
882000 -- (-502.593) [-502.614] (-509.665) (-503.408) * (-503.368) (-505.440) (-505.337) [-502.041] -- 0:00:07
882500 -- (-503.161) (-506.488) (-502.987) [-504.136] * (-503.540) (-503.535) [-503.815] (-502.149) -- 0:00:07
883000 -- (-503.216) (-506.947) (-503.057) [-504.011] * (-504.724) [-503.123] (-503.580) (-506.271) -- 0:00:07
883500 -- [-503.597] (-508.522) (-503.077) (-503.360) * (-505.374) (-503.040) [-502.333] (-503.962) -- 0:00:07
884000 -- (-503.838) (-503.914) [-502.583] (-504.161) * (-502.946) [-503.636] (-504.170) (-503.578) -- 0:00:07
884500 -- (-503.832) (-503.378) [-503.028] (-505.958) * [-504.374] (-503.344) (-504.800) (-503.853) -- 0:00:07
885000 -- (-507.099) (-504.782) [-506.180] (-509.062) * (-503.912) (-503.830) [-502.720] (-503.075) -- 0:00:07
Average standard deviation of split frequencies: 0.007307
885500 -- [-504.349] (-503.727) (-505.131) (-502.613) * (-506.466) (-504.958) [-502.969] (-505.453) -- 0:00:07
886000 -- (-503.955) [-502.590] (-504.859) (-502.777) * (-504.112) (-503.010) (-502.765) [-505.882] -- 0:00:07
886500 -- [-506.391] (-505.463) (-507.608) (-502.901) * (-505.084) (-502.712) [-506.603] (-503.466) -- 0:00:07
887000 -- (-504.607) (-507.360) (-503.719) [-504.772] * (-502.577) (-502.145) (-504.497) [-503.525] -- 0:00:07
887500 -- (-504.637) (-505.798) (-504.449) [-505.054] * [-505.568] (-503.997) (-507.062) (-503.961) -- 0:00:06
888000 -- (-506.868) [-504.727] (-503.602) (-503.475) * (-504.541) (-502.794) [-507.021] (-505.245) -- 0:00:06
888500 -- (-502.600) [-504.689] (-503.029) (-503.595) * (-506.077) (-504.313) (-503.842) [-502.974] -- 0:00:06
889000 -- (-503.837) (-506.628) (-506.189) [-504.433] * [-506.018] (-502.637) (-506.400) (-505.469) -- 0:00:06
889500 -- (-503.892) (-505.851) [-506.250] (-502.377) * (-508.147) [-503.591] (-505.070) (-504.138) -- 0:00:06
890000 -- (-506.377) [-504.587] (-504.170) (-504.939) * [-504.559] (-504.152) (-506.385) (-502.186) -- 0:00:06
Average standard deviation of split frequencies: 0.007339
890500 -- [-502.584] (-505.476) (-504.187) (-503.432) * (-506.411) (-505.437) [-505.069] (-504.876) -- 0:00:06
891000 -- [-507.726] (-508.000) (-502.198) (-506.605) * [-504.949] (-506.796) (-503.827) (-502.643) -- 0:00:06
891500 -- (-508.530) [-503.155] (-507.092) (-502.644) * (-504.848) (-505.373) (-506.895) [-503.621] -- 0:00:06
892000 -- (-502.371) (-502.939) (-503.072) [-503.343] * (-503.042) (-504.279) [-502.994] (-503.105) -- 0:00:06
892500 -- (-503.605) (-502.882) (-505.320) [-504.906] * (-502.291) (-505.074) [-503.276] (-506.286) -- 0:00:06
893000 -- (-503.006) (-503.715) (-509.030) [-504.893] * (-502.546) (-505.783) [-504.261] (-507.560) -- 0:00:06
893500 -- [-502.878] (-506.779) (-507.264) (-502.933) * (-504.628) (-503.448) [-503.835] (-505.089) -- 0:00:06
894000 -- (-502.658) [-505.991] (-504.586) (-504.911) * [-506.991] (-503.760) (-503.878) (-504.013) -- 0:00:06
894500 -- (-505.745) [-504.072] (-505.968) (-506.463) * (-503.917) [-505.223] (-509.284) (-504.063) -- 0:00:06
895000 -- (-503.798) (-503.935) [-503.835] (-504.531) * (-506.386) [-503.246] (-504.414) (-502.654) -- 0:00:06
Average standard deviation of split frequencies: 0.006804
895500 -- (-504.686) (-507.328) (-503.672) [-503.663] * (-502.158) [-503.135] (-503.682) (-504.310) -- 0:00:06
896000 -- [-502.813] (-503.321) (-510.356) (-502.540) * (-505.476) (-504.565) [-505.074] (-511.784) -- 0:00:06
896500 -- (-503.302) (-504.623) (-504.244) [-502.510] * (-504.513) (-503.307) [-504.783] (-509.310) -- 0:00:06
897000 -- (-503.450) (-507.428) [-504.098] (-502.830) * (-510.090) (-504.843) (-503.072) [-503.723] -- 0:00:06
897500 -- (-506.571) (-507.534) (-503.487) [-504.177] * (-504.351) [-503.912] (-503.591) (-506.544) -- 0:00:06
898000 -- (-508.322) (-507.063) (-502.260) [-503.554] * (-503.275) (-504.844) (-512.224) [-505.186] -- 0:00:06
898500 -- (-507.402) (-503.787) [-502.739] (-502.164) * [-504.808] (-503.452) (-507.287) (-506.618) -- 0:00:06
899000 -- [-505.626] (-503.335) (-503.673) (-506.007) * (-503.769) [-502.385] (-502.936) (-508.335) -- 0:00:06
899500 -- [-505.771] (-504.499) (-509.142) (-502.149) * (-503.176) (-504.798) [-503.028] (-505.206) -- 0:00:06
900000 -- (-504.447) (-502.994) (-507.062) [-502.939] * [-502.951] (-503.481) (-504.901) (-504.635) -- 0:00:06
Average standard deviation of split frequencies: 0.006804
900500 -- (-504.160) (-507.126) (-507.752) [-504.012] * (-506.729) (-504.150) [-508.393] (-504.841) -- 0:00:06
901000 -- (-503.678) [-504.467] (-505.761) (-504.453) * [-503.619] (-503.358) (-502.683) (-503.542) -- 0:00:06
901500 -- (-506.926) (-503.758) [-503.669] (-504.094) * [-502.690] (-503.909) (-502.611) (-505.874) -- 0:00:06
902000 -- [-505.590] (-503.724) (-505.791) (-502.457) * (-503.675) (-504.222) (-504.513) [-508.069] -- 0:00:06
902500 -- [-502.505] (-504.304) (-505.726) (-507.791) * (-503.735) (-503.773) [-502.936] (-503.911) -- 0:00:06
903000 -- (-502.894) [-504.563] (-503.096) (-506.337) * (-505.958) (-503.695) [-504.607] (-507.123) -- 0:00:06
903500 -- (-502.814) (-503.299) (-509.307) [-503.937] * (-507.829) (-503.419) [-506.662] (-511.327) -- 0:00:05
904000 -- (-502.672) (-508.239) (-505.516) [-506.431] * (-505.541) [-503.990] (-502.838) (-506.712) -- 0:00:05
904500 -- (-507.245) (-506.293) (-503.945) [-504.812] * (-504.222) (-502.704) (-504.410) [-503.589] -- 0:00:05
905000 -- (-503.604) (-504.460) [-504.967] (-503.572) * (-503.756) (-504.690) [-502.906] (-502.928) -- 0:00:05
Average standard deviation of split frequencies: 0.006833
905500 -- [-502.976] (-504.154) (-504.562) (-502.894) * [-505.395] (-503.996) (-505.608) (-508.610) -- 0:00:05
906000 -- (-504.083) [-502.487] (-507.879) (-503.095) * [-507.192] (-503.210) (-505.056) (-506.413) -- 0:00:05
906500 -- (-504.359) [-502.559] (-504.127) (-505.599) * (-503.155) (-502.306) [-504.604] (-505.958) -- 0:00:05
907000 -- [-508.957] (-506.565) (-503.538) (-502.448) * [-503.072] (-504.503) (-503.169) (-503.014) -- 0:00:05
907500 -- (-504.207) (-503.333) [-503.551] (-503.361) * [-505.081] (-502.769) (-502.918) (-503.553) -- 0:00:05
908000 -- [-502.537] (-503.713) (-502.999) (-502.882) * [-502.473] (-502.621) (-503.543) (-503.266) -- 0:00:05
908500 -- [-502.483] (-506.357) (-503.744) (-504.641) * (-503.227) (-506.844) (-505.447) [-505.129] -- 0:00:05
909000 -- (-505.460) (-504.301) (-504.167) [-505.441] * (-504.551) [-502.820] (-506.996) (-503.540) -- 0:00:05
909500 -- (-503.841) [-506.911] (-502.963) (-502.755) * [-507.251] (-505.314) (-503.493) (-502.324) -- 0:00:05
910000 -- (-505.029) (-506.410) (-509.594) [-504.338] * (-505.345) [-505.433] (-504.839) (-503.919) -- 0:00:05
Average standard deviation of split frequencies: 0.006798
910500 -- (-504.606) (-508.368) [-507.741] (-503.868) * (-506.522) (-502.098) [-503.808] (-502.925) -- 0:00:05
911000 -- (-507.861) (-505.169) [-506.531] (-504.816) * (-504.612) (-502.079) [-503.522] (-503.830) -- 0:00:05
911500 -- (-507.397) (-503.757) (-508.552) [-504.329] * (-504.326) (-504.593) (-503.903) [-502.003] -- 0:00:05
912000 -- (-505.718) [-505.545] (-505.219) (-506.437) * (-503.211) [-505.407] (-504.049) (-504.711) -- 0:00:05
912500 -- (-505.598) (-503.563) [-503.438] (-507.919) * (-504.174) (-503.510) (-503.979) [-505.037] -- 0:00:05
913000 -- (-502.372) (-506.921) [-504.552] (-508.512) * [-503.664] (-502.773) (-514.063) (-502.945) -- 0:00:05
913500 -- (-504.485) (-505.373) (-503.832) [-507.712] * [-502.643] (-508.190) (-503.199) (-502.686) -- 0:00:05
914000 -- (-504.251) (-503.272) (-506.786) [-503.553] * (-503.174) (-504.741) [-504.224] (-503.726) -- 0:00:05
914500 -- (-507.826) (-505.149) [-503.302] (-504.743) * (-503.392) (-502.620) (-505.432) [-504.241] -- 0:00:05
915000 -- [-503.131] (-505.491) (-503.926) (-502.944) * [-503.043] (-503.489) (-506.026) (-503.502) -- 0:00:05
Average standard deviation of split frequencies: 0.006347
915500 -- (-505.255) (-506.223) [-503.307] (-503.736) * (-503.669) [-504.408] (-505.591) (-505.849) -- 0:00:05
916000 -- [-505.106] (-507.568) (-506.171) (-505.997) * (-502.566) [-506.126] (-504.330) (-508.207) -- 0:00:05
916500 -- (-505.576) [-505.646] (-503.359) (-507.570) * (-502.501) (-503.626) (-503.192) [-502.938] -- 0:00:05
917000 -- (-507.246) (-507.214) (-503.711) [-504.010] * (-507.419) (-509.859) [-502.335] (-504.489) -- 0:00:05
917500 -- (-505.582) (-502.898) [-503.085] (-503.244) * [-505.338] (-503.416) (-503.121) (-507.811) -- 0:00:05
918000 -- [-503.136] (-504.889) (-504.143) (-503.334) * (-508.889) [-505.158] (-504.063) (-507.831) -- 0:00:05
918500 -- [-506.800] (-504.685) (-506.178) (-502.296) * [-508.236] (-502.130) (-502.903) (-510.625) -- 0:00:05
919000 -- (-504.126) (-507.167) [-505.234] (-505.600) * (-507.156) (-502.956) (-505.406) [-509.608] -- 0:00:05
919500 -- (-502.462) (-505.165) (-504.034) [-503.114] * [-507.140] (-505.643) (-502.221) (-504.389) -- 0:00:04
920000 -- (-504.542) (-503.030) (-506.414) [-502.392] * (-509.628) [-504.440] (-502.221) (-502.612) -- 0:00:04
Average standard deviation of split frequencies: 0.006452
920500 -- (-505.101) (-504.123) [-505.526] (-503.961) * (-504.913) [-503.512] (-502.483) (-504.676) -- 0:00:04
921000 -- [-506.871] (-507.351) (-506.754) (-503.052) * (-507.401) (-504.320) [-504.386] (-507.397) -- 0:00:04
921500 -- (-505.708) [-505.911] (-503.035) (-505.209) * [-504.882] (-504.791) (-509.500) (-506.543) -- 0:00:04
922000 -- (-502.567) (-505.460) [-505.281] (-503.145) * (-504.254) [-507.045] (-504.694) (-505.424) -- 0:00:04
922500 -- [-502.446] (-504.514) (-503.784) (-503.653) * [-503.932] (-511.038) (-504.636) (-503.225) -- 0:00:04
923000 -- [-502.214] (-504.846) (-502.406) (-502.891) * (-505.155) (-503.273) [-504.924] (-502.346) -- 0:00:04
923500 -- (-502.969) [-508.568] (-506.518) (-505.080) * (-503.388) (-503.407) [-503.377] (-504.134) -- 0:00:04
924000 -- (-504.196) (-504.576) (-503.642) [-508.129] * (-502.320) [-505.432] (-505.594) (-504.604) -- 0:00:04
924500 -- (-505.012) (-505.428) [-504.055] (-505.789) * [-506.045] (-504.218) (-505.686) (-504.516) -- 0:00:04
925000 -- (-502.162) (-504.124) [-506.665] (-504.307) * (-504.671) [-502.198] (-505.904) (-508.835) -- 0:00:04
Average standard deviation of split frequencies: 0.006618
925500 -- (-502.587) (-506.385) (-507.240) [-503.706] * (-503.095) (-502.657) (-502.952) [-506.147] -- 0:00:04
926000 -- (-505.083) [-503.556] (-503.931) (-504.472) * (-505.720) (-503.259) (-510.328) [-504.274] -- 0:00:04
926500 -- [-508.385] (-503.136) (-506.354) (-505.327) * (-506.363) [-504.140] (-506.957) (-504.272) -- 0:00:04
927000 -- [-508.647] (-504.302) (-504.671) (-506.989) * (-507.725) (-506.996) [-503.163] (-505.190) -- 0:00:04
927500 -- (-506.890) (-506.625) [-502.445] (-503.927) * (-504.083) [-503.653] (-504.001) (-510.988) -- 0:00:04
928000 -- (-505.328) (-506.257) (-503.443) [-504.479] * (-504.181) [-503.666] (-504.998) (-509.674) -- 0:00:04
928500 -- [-504.657] (-508.055) (-503.907) (-502.893) * [-503.594] (-503.917) (-503.323) (-505.702) -- 0:00:04
929000 -- (-506.493) (-504.090) [-504.071] (-502.741) * (-503.770) (-503.808) [-505.560] (-503.682) -- 0:00:04
929500 -- (-505.941) (-504.562) (-504.239) [-506.028] * (-504.641) (-508.543) (-503.031) [-504.519] -- 0:00:04
930000 -- (-502.783) (-503.966) (-503.273) [-503.210] * (-507.125) (-504.309) [-507.840] (-505.473) -- 0:00:04
Average standard deviation of split frequencies: 0.006956
930500 -- (-504.198) [-505.392] (-502.897) (-502.510) * (-502.426) [-504.054] (-502.959) (-505.492) -- 0:00:04
931000 -- [-503.818] (-504.370) (-505.269) (-502.754) * (-502.888) (-505.304) (-502.170) [-503.574] -- 0:00:04
931500 -- (-504.790) (-504.989) (-504.811) [-503.027] * (-503.300) (-504.593) [-503.890] (-504.775) -- 0:00:04
932000 -- (-505.478) (-504.642) [-503.794] (-504.660) * (-507.032) (-505.377) [-504.086] (-504.012) -- 0:00:04
932500 -- (-505.645) (-502.667) [-503.636] (-510.132) * (-509.358) (-503.780) [-503.758] (-505.693) -- 0:00:04
933000 -- (-502.587) [-504.685] (-504.663) (-503.698) * (-506.813) (-502.717) (-504.817) [-508.018] -- 0:00:04
933500 -- (-505.794) (-504.806) (-504.225) [-506.873] * (-503.607) [-503.039] (-504.601) (-507.603) -- 0:00:04
934000 -- (-505.046) [-507.047] (-505.612) (-508.018) * (-504.099) (-504.293) [-506.266] (-504.787) -- 0:00:04
934500 -- [-504.983] (-513.282) (-504.262) (-503.736) * (-504.398) (-509.519) (-503.692) [-504.588] -- 0:00:04
935000 -- (-504.055) [-504.238] (-504.734) (-503.587) * [-504.052] (-507.549) (-505.337) (-509.265) -- 0:00:04
Average standard deviation of split frequencies: 0.006849
935500 -- (-507.743) (-506.467) (-505.258) [-503.104] * [-505.709] (-505.855) (-505.547) (-505.425) -- 0:00:03
936000 -- (-502.558) (-504.731) (-502.364) [-506.619] * [-504.364] (-504.038) (-503.264) (-506.350) -- 0:00:03
936500 -- (-502.148) (-503.543) (-505.726) [-502.016] * [-504.007] (-507.313) (-503.512) (-504.000) -- 0:00:03
937000 -- (-503.929) (-505.003) [-503.732] (-503.155) * (-503.780) [-504.023] (-508.480) (-503.704) -- 0:00:03
937500 -- (-503.779) (-505.089) (-504.698) [-502.970] * (-507.563) [-505.886] (-504.841) (-510.260) -- 0:00:03
938000 -- [-503.698] (-506.038) (-503.831) (-503.187) * (-506.013) (-503.174) (-503.932) [-507.067] -- 0:00:03
938500 -- (-504.016) (-510.285) [-508.496] (-504.097) * [-504.764] (-503.336) (-507.302) (-507.021) -- 0:00:03
939000 -- (-503.574) (-508.150) (-507.463) [-503.962] * (-503.331) [-503.333] (-503.513) (-506.950) -- 0:00:03
939500 -- (-506.218) [-507.182] (-509.917) (-505.384) * (-503.603) (-503.304) (-503.563) [-503.534] -- 0:00:03
940000 -- (-504.198) [-504.704] (-505.825) (-504.358) * (-503.158) [-504.064] (-505.592) (-503.664) -- 0:00:03
Average standard deviation of split frequencies: 0.007392
940500 -- (-506.926) [-504.037] (-508.145) (-504.529) * (-503.765) (-502.453) (-504.044) [-503.404] -- 0:00:03
941000 -- (-504.701) (-503.122) (-508.007) [-503.282] * (-503.570) (-504.280) [-504.265] (-506.306) -- 0:00:03
941500 -- (-504.729) (-508.981) [-509.271] (-504.113) * (-502.397) [-504.449] (-504.487) (-503.514) -- 0:00:03
942000 -- (-503.692) (-505.264) (-502.867) [-502.430] * (-502.111) (-502.838) [-502.182] (-505.500) -- 0:00:03
942500 -- (-506.010) [-508.549] (-505.858) (-503.321) * (-502.492) (-502.531) (-505.778) [-505.269] -- 0:00:03
943000 -- (-505.506) (-506.770) (-509.241) [-505.186] * (-503.978) (-503.261) [-505.835] (-504.012) -- 0:00:03
943500 -- (-508.006) (-502.926) (-505.236) [-504.581] * (-503.065) (-503.338) (-506.732) [-504.777] -- 0:00:03
944000 -- (-505.523) (-504.831) [-503.586] (-504.568) * (-502.730) (-503.358) (-507.701) [-507.284] -- 0:00:03
944500 -- (-503.784) (-504.297) (-506.301) [-505.393] * (-502.903) (-504.071) (-509.137) [-505.273] -- 0:00:03
945000 -- (-511.628) (-504.793) (-504.759) [-503.751] * (-502.065) (-503.073) [-503.242] (-502.864) -- 0:00:03
Average standard deviation of split frequencies: 0.007350
945500 -- (-506.890) (-504.489) [-503.191] (-506.583) * (-503.677) (-503.695) (-504.411) [-505.440] -- 0:00:03
946000 -- [-504.218] (-506.920) (-508.317) (-505.369) * (-503.296) [-503.690] (-505.031) (-505.053) -- 0:00:03
946500 -- [-502.509] (-503.636) (-504.821) (-504.393) * (-504.078) (-501.959) [-502.834] (-503.331) -- 0:00:03
947000 -- [-503.861] (-503.213) (-503.434) (-504.044) * (-503.130) [-504.348] (-504.583) (-504.413) -- 0:00:03
947500 -- (-503.122) (-504.538) (-503.461) [-501.997] * [-503.447] (-505.517) (-503.547) (-502.868) -- 0:00:03
948000 -- [-502.890] (-503.266) (-504.921) (-504.218) * (-503.413) (-504.453) [-506.010] (-504.679) -- 0:00:03
948500 -- (-502.498) [-504.472] (-506.195) (-506.448) * (-502.411) (-504.976) [-502.983] (-503.807) -- 0:00:03
949000 -- [-503.176] (-503.563) (-504.143) (-507.083) * [-503.541] (-506.052) (-503.781) (-503.105) -- 0:00:03
949500 -- (-504.926) (-502.849) [-503.437] (-503.298) * [-503.210] (-503.845) (-502.539) (-502.560) -- 0:00:03
950000 -- (-504.135) (-504.673) [-509.672] (-503.344) * (-503.599) (-503.760) (-508.117) [-502.437] -- 0:00:03
Average standard deviation of split frequencies: 0.006911
950500 -- [-503.800] (-504.940) (-506.592) (-504.606) * (-503.396) [-503.439] (-503.595) (-503.312) -- 0:00:03
951000 -- (-504.846) (-502.301) (-504.093) [-503.156] * (-501.950) (-503.348) [-503.037] (-503.455) -- 0:00:03
951500 -- (-502.833) [-503.658] (-509.226) (-503.594) * (-503.367) (-507.036) [-505.459] (-513.759) -- 0:00:03
952000 -- (-506.651) (-502.996) [-504.389] (-506.159) * (-507.902) (-502.973) [-504.300] (-505.435) -- 0:00:02
952500 -- (-505.526) [-505.692] (-506.890) (-504.673) * (-505.405) (-504.677) [-506.123] (-503.144) -- 0:00:02
953000 -- (-519.830) (-503.601) [-503.110] (-503.913) * (-509.586) (-506.891) (-505.852) [-505.525] -- 0:00:02
953500 -- (-502.462) (-504.811) (-503.163) [-505.988] * (-504.041) [-502.105] (-507.849) (-503.455) -- 0:00:02
954000 -- (-503.353) [-502.568] (-506.306) (-504.091) * (-503.580) (-504.103) (-505.220) [-506.204] -- 0:00:02
954500 -- (-504.135) (-501.853) [-503.814] (-505.119) * [-503.764] (-506.720) (-502.743) (-505.081) -- 0:00:02
955000 -- [-507.437] (-502.641) (-502.672) (-507.885) * (-503.386) (-508.924) [-503.182] (-505.005) -- 0:00:02
Average standard deviation of split frequencies: 0.005983
955500 -- (-507.072) (-503.973) (-506.096) [-508.485] * (-503.504) [-507.105] (-503.490) (-504.266) -- 0:00:02
956000 -- (-505.437) [-504.889] (-506.133) (-503.578) * (-506.178) [-503.053] (-504.181) (-504.871) -- 0:00:02
956500 -- (-504.597) (-504.635) (-504.916) [-506.829] * (-504.254) (-503.592) (-503.632) [-505.897] -- 0:00:02
957000 -- (-503.369) (-505.057) (-502.588) [-504.641] * (-504.083) [-502.747] (-504.134) (-512.041) -- 0:00:02
957500 -- [-504.151] (-504.199) (-506.412) (-504.677) * (-503.924) (-505.195) [-502.773] (-505.474) -- 0:00:02
958000 -- (-502.516) (-506.567) [-503.128] (-505.453) * (-502.507) [-503.586] (-504.280) (-507.328) -- 0:00:02
958500 -- (-502.805) (-506.184) [-502.243] (-509.172) * (-502.752) (-505.413) [-503.511] (-503.248) -- 0:00:02
959000 -- (-503.402) (-504.953) [-502.433] (-506.522) * [-502.482] (-507.030) (-508.776) (-507.182) -- 0:00:02
959500 -- (-508.105) (-503.684) (-509.290) [-502.237] * (-505.280) [-503.337] (-508.016) (-507.823) -- 0:00:02
960000 -- [-505.941] (-505.281) (-504.071) (-506.333) * (-504.373) (-504.121) [-504.738] (-503.312) -- 0:00:02
Average standard deviation of split frequencies: 0.005888
960500 -- (-503.524) [-503.557] (-506.514) (-506.648) * [-507.149] (-503.056) (-507.613) (-502.800) -- 0:00:02
961000 -- (-509.522) (-503.675) (-503.108) [-506.745] * (-506.252) (-503.112) (-504.395) [-502.505] -- 0:00:02
961500 -- (-508.017) (-505.070) [-502.330] (-505.675) * (-502.461) (-503.377) (-503.663) [-503.016] -- 0:00:02
962000 -- [-505.719] (-503.376) (-503.814) (-507.713) * (-503.580) [-504.590] (-503.060) (-504.534) -- 0:00:02
962500 -- (-504.033) (-503.209) (-502.616) [-503.770] * [-502.885] (-509.043) (-505.582) (-505.148) -- 0:00:02
963000 -- [-504.128] (-502.686) (-503.408) (-504.053) * (-504.986) (-505.680) (-503.822) [-503.730] -- 0:00:02
963500 -- [-505.255] (-503.800) (-508.521) (-505.264) * (-508.774) (-504.408) (-511.162) [-503.178] -- 0:00:02
964000 -- (-505.351) (-504.729) [-506.314] (-505.481) * (-505.775) [-503.295] (-505.190) (-504.313) -- 0:00:02
964500 -- (-505.226) (-507.451) (-507.256) [-505.996] * (-503.003) (-505.509) (-503.370) [-504.947] -- 0:00:02
965000 -- (-503.851) (-505.549) [-508.107] (-504.225) * (-504.040) [-504.030] (-503.459) (-506.363) -- 0:00:02
Average standard deviation of split frequencies: 0.005921
965500 -- (-504.390) (-504.584) [-503.603] (-504.808) * (-503.821) (-502.846) [-503.724] (-503.605) -- 0:00:02
966000 -- (-503.857) (-504.850) (-506.090) [-504.695] * [-504.559] (-502.291) (-503.253) (-505.349) -- 0:00:02
966500 -- (-503.998) [-509.850] (-503.084) (-503.495) * (-504.689) [-502.911] (-504.743) (-504.389) -- 0:00:02
967000 -- (-504.233) (-505.255) (-505.997) [-502.564] * [-503.892] (-503.137) (-503.537) (-502.669) -- 0:00:02
967500 -- (-506.653) (-503.479) (-504.113) [-506.233] * (-502.551) [-504.855] (-504.794) (-503.984) -- 0:00:02
968000 -- (-504.385) [-503.459] (-503.289) (-504.870) * (-503.741) (-503.466) [-505.086] (-502.755) -- 0:00:01
968500 -- (-504.604) (-506.198) (-504.312) [-504.845] * (-507.215) [-504.065] (-507.429) (-502.602) -- 0:00:01
969000 -- (-504.405) (-505.072) [-504.315] (-504.524) * (-508.211) (-503.966) (-506.765) [-503.823] -- 0:00:01
969500 -- (-506.160) (-509.050) [-505.156] (-504.275) * [-503.794] (-507.933) (-506.178) (-507.535) -- 0:00:01
970000 -- (-503.136) (-507.344) (-504.218) [-504.265] * (-505.128) (-505.614) [-503.689] (-503.800) -- 0:00:01
Average standard deviation of split frequencies: 0.006313
970500 -- (-505.077) (-507.172) (-506.999) [-504.042] * (-504.597) (-503.329) [-506.474] (-505.303) -- 0:00:01
971000 -- (-503.882) (-505.266) (-504.810) [-506.148] * (-504.720) (-506.069) [-505.251] (-503.743) -- 0:00:01
971500 -- (-505.096) (-503.042) (-504.175) [-503.316] * [-503.210] (-504.755) (-510.049) (-504.089) -- 0:00:01
972000 -- (-506.179) [-506.847] (-504.488) (-502.809) * (-504.447) (-504.646) [-508.671] (-503.675) -- 0:00:01
972500 -- (-504.611) (-509.694) (-509.008) [-504.077] * (-505.448) (-503.269) [-504.848] (-504.687) -- 0:00:01
973000 -- [-505.202] (-508.378) (-505.989) (-504.557) * (-503.484) (-504.412) [-506.417] (-502.621) -- 0:00:01
973500 -- (-502.133) (-506.002) [-505.971] (-504.409) * (-503.911) (-504.325) (-510.244) [-503.064] -- 0:00:01
974000 -- [-504.799] (-505.235) (-504.495) (-503.712) * [-505.290] (-502.941) (-505.279) (-502.676) -- 0:00:01
974500 -- [-505.018] (-509.301) (-506.482) (-503.547) * (-506.333) (-503.554) (-503.715) [-504.855] -- 0:00:01
975000 -- (-505.113) (-505.074) [-507.542] (-503.176) * (-503.036) [-503.095] (-507.231) (-508.418) -- 0:00:01
Average standard deviation of split frequencies: 0.006339
975500 -- (-503.028) (-504.173) (-509.277) [-503.292] * (-503.873) [-505.290] (-505.788) (-504.009) -- 0:00:01
976000 -- (-502.816) (-502.836) (-504.713) [-502.068] * (-506.667) (-503.664) (-507.024) [-503.836] -- 0:00:01
976500 -- (-505.464) [-503.097] (-511.288) (-502.118) * [-503.554] (-502.348) (-502.609) (-506.455) -- 0:00:01
977000 -- [-503.724] (-507.523) (-502.772) (-501.914) * (-503.213) (-502.843) [-506.680] (-504.659) -- 0:00:01
977500 -- (-502.719) (-506.050) (-502.951) [-503.844] * (-506.586) (-503.957) [-502.771] (-505.289) -- 0:00:01
978000 -- (-503.046) [-504.885] (-503.055) (-505.199) * (-504.915) [-503.820] (-503.269) (-504.235) -- 0:00:01
978500 -- (-508.774) [-503.707] (-502.452) (-507.642) * (-503.727) (-505.268) [-505.398] (-504.454) -- 0:00:01
979000 -- (-504.063) [-504.133] (-505.679) (-504.919) * (-504.432) (-503.164) (-504.233) [-503.302] -- 0:00:01
979500 -- [-505.079] (-504.452) (-504.221) (-505.680) * (-504.758) (-507.321) (-503.538) [-506.610] -- 0:00:01
980000 -- (-504.048) (-503.216) (-502.743) [-505.569] * (-502.497) [-506.401] (-506.658) (-503.472) -- 0:00:01
Average standard deviation of split frequencies: 0.006956
980500 -- (-512.215) [-504.325] (-502.978) (-503.326) * (-502.874) [-504.835] (-505.248) (-503.647) -- 0:00:01
981000 -- (-502.624) (-502.580) [-502.846] (-504.364) * (-503.654) [-503.905] (-507.023) (-505.627) -- 0:00:01
981500 -- (-505.745) (-503.263) [-506.011] (-504.286) * [-503.071] (-502.326) (-512.143) (-504.897) -- 0:00:01
982000 -- (-505.868) (-503.980) [-503.999] (-509.462) * (-504.233) [-504.398] (-507.162) (-503.489) -- 0:00:01
982500 -- (-504.170) [-503.683] (-505.945) (-503.421) * (-508.361) (-507.386) (-503.750) [-502.907] -- 0:00:01
983000 -- (-502.681) (-505.884) [-504.367] (-502.135) * (-503.668) (-503.803) [-503.173] (-506.292) -- 0:00:01
983500 -- (-502.555) (-502.650) [-508.187] (-504.234) * (-508.846) [-503.720] (-503.967) (-506.776) -- 0:00:01
984000 -- (-503.491) (-504.575) [-502.868] (-506.830) * (-508.785) [-503.952] (-502.640) (-504.472) -- 0:00:00
984500 -- (-504.740) (-504.182) [-505.136] (-502.071) * [-503.278] (-503.267) (-503.044) (-505.069) -- 0:00:00
985000 -- (-504.811) [-503.214] (-505.449) (-503.131) * (-502.826) (-502.665) [-505.904] (-506.595) -- 0:00:00
Average standard deviation of split frequencies: 0.006721
985500 -- (-503.286) (-507.113) [-507.730] (-505.819) * (-507.576) (-506.091) [-502.792] (-507.317) -- 0:00:00
986000 -- (-505.889) (-506.384) (-503.882) [-506.374] * [-503.797] (-505.064) (-502.875) (-503.460) -- 0:00:00
986500 -- (-507.079) (-505.588) [-504.857] (-504.092) * (-502.223) (-502.754) (-502.687) [-506.676] -- 0:00:00
987000 -- (-504.935) (-503.852) (-505.249) [-505.752] * (-503.459) [-505.395] (-506.431) (-502.717) -- 0:00:00
987500 -- (-504.465) (-503.075) [-506.287] (-505.946) * (-505.206) (-504.146) (-505.172) [-502.205] -- 0:00:00
988000 -- (-506.695) [-503.453] (-502.211) (-505.023) * (-505.179) (-502.902) [-503.817] (-503.825) -- 0:00:00
988500 -- (-504.422) (-502.975) (-504.163) [-502.660] * (-504.184) (-505.044) [-502.642] (-502.740) -- 0:00:00
989000 -- [-504.639] (-504.383) (-502.980) (-507.346) * (-505.350) [-504.146] (-502.939) (-503.841) -- 0:00:00
989500 -- (-504.324) (-504.900) (-505.077) [-505.272] * (-504.025) (-504.095) (-505.640) [-502.297] -- 0:00:00
990000 -- (-503.784) (-507.700) [-502.980] (-504.173) * [-502.652] (-507.885) (-502.823) (-502.538) -- 0:00:00
Average standard deviation of split frequencies: 0.006335
990500 -- (-503.665) (-504.449) (-505.469) [-503.647] * (-502.136) (-505.326) (-502.373) [-505.207] -- 0:00:00
991000 -- (-504.099) (-504.140) (-505.054) [-502.085] * [-502.946] (-503.618) (-504.501) (-502.950) -- 0:00:00
991500 -- (-503.935) [-505.250] (-503.350) (-502.803) * (-502.354) [-502.907] (-503.747) (-504.015) -- 0:00:00
992000 -- (-504.667) [-504.657] (-503.342) (-504.539) * (-507.761) (-504.211) [-505.767] (-505.388) -- 0:00:00
992500 -- (-503.407) (-503.998) [-502.922] (-503.372) * (-502.916) (-506.484) (-505.820) [-504.508] -- 0:00:00
993000 -- (-504.225) (-505.823) (-502.495) [-505.035] * [-503.793] (-504.359) (-509.056) (-505.335) -- 0:00:00
993500 -- (-503.334) [-503.990] (-504.776) (-505.885) * [-505.089] (-504.258) (-506.427) (-505.705) -- 0:00:00
994000 -- (-503.376) [-503.920] (-505.352) (-502.334) * (-505.663) [-504.417] (-504.727) (-505.836) -- 0:00:00
994500 -- (-506.324) (-502.349) [-503.019] (-504.895) * [-504.361] (-506.399) (-503.650) (-506.977) -- 0:00:00
995000 -- [-505.178] (-502.471) (-504.665) (-504.756) * (-502.446) (-502.268) [-504.776] (-503.088) -- 0:00:00
Average standard deviation of split frequencies: 0.006212
995500 -- [-504.375] (-503.070) (-505.951) (-506.934) * [-504.110] (-503.049) (-504.327) (-504.626) -- 0:00:00
996000 -- (-503.697) [-507.688] (-504.659) (-506.484) * [-504.473] (-503.202) (-502.596) (-504.000) -- 0:00:00
996500 -- (-503.165) [-504.081] (-503.193) (-505.957) * (-505.252) (-504.046) (-503.950) [-503.403] -- 0:00:00
997000 -- (-502.505) [-504.466] (-503.390) (-502.836) * (-507.578) [-502.647] (-505.558) (-506.737) -- 0:00:00
997500 -- (-504.522) (-502.757) (-503.563) [-503.622] * [-502.644] (-504.217) (-504.055) (-505.770) -- 0:00:00
998000 -- (-505.635) (-504.744) [-503.249] (-505.717) * (-502.243) (-506.547) [-503.231] (-505.238) -- 0:00:00
998500 -- (-507.609) [-507.219] (-503.066) (-506.221) * [-504.272] (-502.585) (-502.733) (-504.647) -- 0:00:00
999000 -- (-512.073) (-503.669) (-504.738) [-503.408] * [-504.097] (-502.343) (-504.348) (-502.650) -- 0:00:00
999500 -- (-506.448) (-503.318) (-507.129) [-504.679] * (-505.337) (-502.683) [-503.504] (-502.022) -- 0:00:00
1000000 -- (-506.413) [-505.603] (-509.460) (-504.546) * [-504.560] (-503.062) (-510.420) (-504.055) -- 0:00:00
Average standard deviation of split frequencies: 0.005590
Analysis completed in 1 mins 2 seconds
Analysis used 61.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -501.85
Likelihood of best state for "cold" chain of run 2 was -501.85
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.1 % ( 37 %) Dirichlet(Pi{all})
35.9 % ( 24 %) Slider(Pi{all})
78.7 % ( 66 %) Multiplier(Alpha{1,2})
78.0 % ( 49 %) Multiplier(Alpha{3})
24.4 % ( 29 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
69.7 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 95 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.4 % ( 27 %) Dirichlet(Pi{all})
35.2 % ( 29 %) Slider(Pi{all})
78.4 % ( 48 %) Multiplier(Alpha{1,2})
77.8 % ( 50 %) Multiplier(Alpha{3})
25.3 % ( 33 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 20 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.8 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166952 0.82 0.67
3 | 166760 166886 0.84
4 | 166815 166478 166109
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167000 0.83 0.66
3 | 166471 165840 0.83
4 | 167189 166296 167204
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -503.56
| 2 |
| 212 |
| 1 1 1 1 2 1 2|
| 2 1 2 2 1 |
| * 2 2 1 2 |
| *2 22 1 2 1 2 2 1 1 1 2 2 |
| 1 *1 2 21 2 1 1 2 1 1 2 |
| 12 1 1 2 2 2*2 1 * 21|
| 2 2 2 1 2 1 2 1 2* 2 |
| 2 2 1 2 2 1 * |
|* 1 21 1 2 2 2 1 1 1 |
| 1 1 1 1 1 2 1 1 1 |
| 1 2 1 2 1 11 2 |
| 2 2 |
| 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -505.12
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -503.60 -507.23
2 -503.59 -506.93
--------------------------------------
TOTAL -503.59 -507.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892905 0.089435 0.346565 1.484922 0.862531 1282.86 1384.85 1.000
r(A<->C){all} 0.169026 0.020012 0.000038 0.459969 0.134334 254.08 311.26 1.000
r(A<->G){all} 0.173474 0.021574 0.000138 0.463583 0.132934 196.15 269.63 1.000
r(A<->T){all} 0.169511 0.021248 0.000013 0.472800 0.134107 243.88 249.17 1.000
r(C<->G){all} 0.151957 0.017309 0.000037 0.420191 0.116085 180.47 253.37 1.002
r(C<->T){all} 0.171365 0.021221 0.000010 0.473474 0.133443 129.07 161.76 1.000
r(G<->T){all} 0.164667 0.017619 0.000165 0.424536 0.135562 179.88 246.65 1.000
pi(A){all} 0.236291 0.000478 0.194240 0.278451 0.236079 1154.16 1163.35 1.000
pi(C){all} 0.308547 0.000548 0.264178 0.355273 0.308723 1230.21 1240.54 1.000
pi(G){all} 0.306112 0.000557 0.261431 0.353169 0.305773 1249.36 1335.68 1.000
pi(T){all} 0.149051 0.000328 0.115026 0.184898 0.148208 836.25 1080.83 1.000
alpha{1,2} 0.405734 0.221168 0.000127 1.341922 0.236388 1188.10 1195.50 1.000
alpha{3} 0.456308 0.250092 0.000340 1.482230 0.292638 1075.02 1113.78 1.000
pinvar{all} 0.995526 0.000028 0.985681 0.999995 0.997226 1197.03 1240.75 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ..****
9 -- .***.*
10 -- ...*.*
11 -- .****.
12 -- .*.***
13 -- .**...
14 -- ..*..*
15 -- ..*.*.
16 -- ....**
17 -- ..**..
18 -- .*...*
19 -- .*..*.
20 -- ...**.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.009893 0.149234 0.163225 2
8 447 0.148901 0.005182 0.145237 0.152565 2
9 443 0.147568 0.000471 0.147235 0.147901 2
10 438 0.145903 0.001884 0.144570 0.147235 2
11 435 0.144903 0.003298 0.142572 0.147235 2
12 433 0.144237 0.002355 0.142572 0.145903 2
13 430 0.143238 0.015075 0.132578 0.153897 2
14 428 0.142572 0.004711 0.139241 0.145903 2
15 428 0.142572 0.000942 0.141905 0.143238 2
16 427 0.142239 0.011777 0.133911 0.150566 2
17 421 0.140240 0.004240 0.137242 0.143238 2
18 416 0.138574 0.000000 0.138574 0.138574 2
19 415 0.138241 0.000471 0.137908 0.138574 2
20 414 0.137908 0.012248 0.129247 0.146569 2
21 410 0.136576 0.011306 0.128581 0.144570 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099595 0.010087 0.000000 0.296725 0.068378 1.000 2
length{all}[2] 0.100891 0.010343 0.000003 0.302802 0.068498 1.000 2
length{all}[3] 0.099301 0.010330 0.000076 0.298363 0.066313 1.000 2
length{all}[4] 0.099263 0.010261 0.000071 0.287241 0.069846 1.000 2
length{all}[5] 0.099033 0.009977 0.000040 0.304439 0.067785 1.000 2
length{all}[6] 0.100935 0.010320 0.000016 0.300505 0.068229 1.000 2
length{all}[7] 0.103732 0.012139 0.000107 0.327968 0.067981 1.002 2
length{all}[8] 0.098641 0.009779 0.000431 0.298236 0.071464 0.999 2
length{all}[9] 0.091238 0.009372 0.000310 0.294558 0.064151 0.998 2
length{all}[10] 0.101420 0.011701 0.000003 0.296177 0.066702 0.998 2
length{all}[11] 0.098797 0.009862 0.000116 0.305528 0.063864 0.998 2
length{all}[12] 0.101437 0.009973 0.000096 0.288283 0.067595 1.003 2
length{all}[13] 0.101393 0.010577 0.000096 0.333697 0.069026 0.998 2
length{all}[14] 0.095191 0.007621 0.000257 0.265138 0.069460 1.007 2
length{all}[15] 0.106609 0.012623 0.000666 0.347266 0.067643 0.998 2
length{all}[16] 0.088659 0.008051 0.000031 0.280084 0.061492 0.999 2
length{all}[17] 0.100233 0.011450 0.000027 0.307605 0.062773 0.998 2
length{all}[18] 0.100000 0.011126 0.000125 0.272098 0.068784 0.998 2
length{all}[19] 0.093152 0.008926 0.000219 0.285126 0.063448 0.998 2
length{all}[20] 0.099292 0.010348 0.000421 0.308328 0.067350 1.000 2
length{all}[21] 0.097947 0.010285 0.000100 0.299991 0.062736 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005590
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 372
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 124 / 124 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 124 / 124 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.047783 0.058450 0.080227 0.049567 0.038858 0.088889 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -523.835412
Iterating by ming2
Initial: fx= 523.835412
x= 0.04778 0.05845 0.08023 0.04957 0.03886 0.08889 0.30000 1.30000
1 h-m-p 0.0000 0.0003 297.5975 +++ 495.525221 m 0.0003 14 | 1/8
2 h-m-p 0.0028 0.0224 31.3464 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 273.3997 ++ 490.042447 m 0.0001 46 | 2/8
4 h-m-p 0.0007 0.0637 23.9922 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 244.7441 ++ 489.164803 m 0.0000 77 | 3/8
6 h-m-p 0.0002 0.0859 19.4337 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 211.7660 ++ 485.884539 m 0.0001 107 | 4/8
8 h-m-p 0.0008 0.1043 14.9387 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 172.9106 +++ 480.494702 m 0.0002 139 | 5/8
10 h-m-p 0.0022 0.2913 9.9461 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 122.6618 ++ 479.415443 m 0.0001 171 | 6/8
12 h-m-p 0.4830 8.0000 0.0000 +++ 479.415443 m 8.0000 183 | 6/8
13 h-m-p 0.2250 8.0000 0.0000 --Y 479.415443 0 0.0035 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415443 m 8.0000 214 | 6/8
15 h-m-p 0.0160 8.0000 0.0332 +++++ 479.415443 m 8.0000 230 | 6/8
16 h-m-p 0.5301 8.0000 0.5012 +C 479.415443 0 1.9769 244 | 6/8
17 h-m-p 1.6000 8.0000 0.1060 C 479.415443 0 1.3470 257 | 6/8
18 h-m-p 1.6000 8.0000 0.0089 Y 479.415443 0 1.0433 270 | 6/8
19 h-m-p 1.6000 8.0000 0.0004 C 479.415443 0 1.6000 283 | 6/8
20 h-m-p 1.3319 8.0000 0.0004 ------------C 479.415443 0 0.0000 308
Out..
lnL = -479.415443
309 lfun, 309 eigenQcodon, 1854 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102788 0.106567 0.064031 0.107221 0.088560 0.091019 1.403736 0.835177 0.536592
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.965454
np = 9
lnL0 = -547.426186
Iterating by ming2
Initial: fx= 547.426186
x= 0.10279 0.10657 0.06403 0.10722 0.08856 0.09102 1.40374 0.83518 0.53659
1 h-m-p 0.0000 0.0005 292.2052 +++ 501.275871 m 0.0005 15 | 1/9
2 h-m-p 0.0001 0.0004 245.1169 ++ 486.091473 m 0.0004 27 | 2/9
3 h-m-p 0.0001 0.0007 68.6145 ++ 484.361096 m 0.0007 39 | 3/9
4 h-m-p 0.0000 0.0000 7296.1181 ++ 479.982232 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0001 490.1718 ++ 479.465134 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 6077.9480 ++ 479.415462 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0004 ++ 479.415462 m 8.0000 87 | 6/9
8 h-m-p 0.0032 0.6457 0.9137 ++++ 479.415449 m 0.6457 104 | 7/9
9 h-m-p 1.6000 8.0000 0.0004 --------------Y 479.415449 0 0.0000 133 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 ----------N 479.415449 0 0.0000 157
Out..
lnL = -479.415449
158 lfun, 474 eigenQcodon, 1896 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106460 0.015573 0.104137 0.051008 0.107367 0.040344 1.421918 1.157580 0.445515 0.419060 1.441445
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.952578
np = 11
lnL0 = -529.608111
Iterating by ming2
Initial: fx= 529.608111
x= 0.10646 0.01557 0.10414 0.05101 0.10737 0.04034 1.42192 1.15758 0.44552 0.41906 1.44145
1 h-m-p 0.0000 0.0001 278.2657 ++ 519.007604 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 169.8014 ++ 504.162642 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0001 403.7226 ++ 499.431435 m 0.0001 44 | 3/11
4 h-m-p 0.0001 0.0011 245.1522 ++ 480.119657 m 0.0011 58 | 4/11
5 h-m-p 0.0000 0.0001 363.2255 ++ 479.529046 m 0.0001 72 | 5/11
6 h-m-p 0.0006 0.0239 41.5477 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 123.8240 ++ 479.415469 m 0.0000 109 | 6/11
8 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415469 m 8.0000 126 | 6/11
9 h-m-p 0.0160 8.0000 0.0016 +++++ 479.415469 m 8.0000 148 | 6/11
10 h-m-p 0.0654 0.4211 0.1900 ----------C 479.415469 0 0.0000 177 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 C 479.415469 0 0.0040 196 | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415469 m 8.0000 218 | 6/11
13 h-m-p 0.0017 0.4133 0.1836 ------Y 479.415469 0 0.0000 243 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415469 m 8.0000 265 | 6/11
15 h-m-p 0.0018 0.4692 0.1596 -----Y 479.415469 0 0.0000 289 | 6/11
16 h-m-p 0.0160 8.0000 0.0001 --C 479.415469 0 0.0003 310 | 6/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 479.415469 m 8.0000 332 | 6/11
18 h-m-p 0.0056 0.5540 0.1351 -----C 479.415469 0 0.0000 356 | 6/11
19 h-m-p 0.0160 8.0000 0.0021 +++++ 479.415469 m 8.0000 378 | 6/11
20 h-m-p 0.1113 0.6003 0.1525 --------C 479.415469 0 0.0000 405 | 6/11
21 h-m-p 0.0160 8.0000 0.0002 ---C 479.415469 0 0.0001 427 | 6/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415469 m 8.0000 449 | 6/11
23 h-m-p 0.0019 0.8229 0.1153 -----C 479.415469 0 0.0000 473 | 6/11
24 h-m-p 0.0160 8.0000 0.0001 -Y 479.415469 0 0.0010 493 | 6/11
25 h-m-p 0.0160 8.0000 0.0005 +++++ 479.415469 m 8.0000 515 | 6/11
26 h-m-p 0.0208 0.5593 0.1753 -----------Y 479.415469 0 0.0000 545 | 6/11
27 h-m-p 0.0160 8.0000 0.0000 Y 479.415469 0 0.0160 564 | 6/11
28 h-m-p 0.0160 8.0000 0.0001 +++++ 479.415469 m 8.0000 586 | 6/11
29 h-m-p 0.0040 0.6304 0.1949 -----Y 479.415469 0 0.0000 610 | 6/11
30 h-m-p 0.0160 8.0000 0.0004 +++++ 479.415469 m 8.0000 632 | 6/11
31 h-m-p 0.0185 0.7468 0.1692 ----------Y 479.415469 0 0.0000 661 | 6/11
32 h-m-p 0.0160 8.0000 0.0000 -C 479.415469 0 0.0010 681 | 6/11
33 h-m-p 0.0160 8.0000 0.0000 -C 479.415469 0 0.0016 701 | 6/11
34 h-m-p 0.0160 8.0000 0.0001 --------Y 479.415469 0 0.0000 728
Out..
lnL = -479.415469
729 lfun, 2916 eigenQcodon, 13122 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -479.422558 S = -479.413657 -0.003405
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:05
did 20 / 39 patterns 0:05
did 30 / 39 patterns 0:05
did 39 / 39 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088565 0.032488 0.102399 0.037636 0.033656 0.031702 1.417006 0.736299 1.660173
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.755590
np = 9
lnL0 = -518.527385
Iterating by ming2
Initial: fx= 518.527385
x= 0.08857 0.03249 0.10240 0.03764 0.03366 0.03170 1.41701 0.73630 1.66017
1 h-m-p 0.0000 0.0003 282.6076 +++ 496.200288 m 0.0003 15 | 1/9
2 h-m-p 0.0055 0.0643 12.8986 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 269.7512 ++ 495.725833 m 0.0000 49 | 2/9
4 h-m-p 0.0003 0.1690 6.3383 ----------.. | 2/9
5 h-m-p 0.0000 0.0000 241.1284 ++ 495.161795 m 0.0000 81 | 3/9
6 h-m-p 0.0003 0.1748 5.9987 ----------.. | 3/9
7 h-m-p 0.0000 0.0000 208.5445 ++ 493.723591 m 0.0000 113 | 4/9
8 h-m-p 0.0010 0.1911 5.4001 -----------.. | 4/9
9 h-m-p 0.0000 0.0004 170.0549 +++ 481.176059 m 0.0004 147 | 5/9
10 h-m-p 0.0171 0.6415 2.9864 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 124.1589 ++ 479.415494 m 0.0001 182 | 6/9
12 h-m-p 1.2096 8.0000 0.0000 ++ 479.415494 m 8.0000 194 | 6/9
13 h-m-p 0.1003 8.0000 0.0002 ----C 479.415494 0 0.0001 213
Out..
lnL = -479.415494
214 lfun, 2354 eigenQcodon, 12840 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059968 0.078461 0.052172 0.012730 0.047782 0.097540 1.416996 0.900000 1.089131 1.395747 1.241059
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.791757
np = 11
lnL0 = -520.758210
Iterating by ming2
Initial: fx= 520.758210
x= 0.05997 0.07846 0.05217 0.01273 0.04778 0.09754 1.41700 0.90000 1.08913 1.39575 1.24106
1 h-m-p 0.0000 0.0001 278.5757 ++ 512.072379 m 0.0001 16 | 1/11
2 h-m-p 0.0003 0.0037 82.0589 ++ 490.871438 m 0.0037 30 | 2/11
3 h-m-p 0.0000 0.0000 6551.1070 ++ 488.783658 m 0.0000 44 | 3/11
4 h-m-p 0.0008 0.0090 38.5187 ++ 487.458299 m 0.0090 58 | 4/11
5 h-m-p 0.0001 0.0005 117.8645 ++ 482.334612 m 0.0005 72 | 5/11
6 h-m-p 0.0044 0.0829 12.7686 ------------.. | 5/11
7 h-m-p 0.0000 0.0002 121.6480 +++ 479.415446 m 0.0002 111 | 6/11
8 h-m-p 0.1418 8.0000 0.0000 +++ 479.415446 m 8.0000 126 | 6/11
9 h-m-p 0.0160 8.0000 0.0390 --------N 479.415446 0 0.0000 153 | 6/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 479.415446 m 8.0000 175 | 6/11
11 h-m-p 0.0021 0.8757 0.5555 +++++ 479.415437 m 0.8757 197 | 7/11
12 h-m-p 1.6000 8.0000 0.1464 ++ 479.415436 m 8.0000 216 | 7/11
13 h-m-p 0.0297 0.1484 1.8894 ++ 479.415436 m 0.1484 234 | 7/11
14 h-m-p 0.0000 0.0000 0.5368
h-m-p: 2.36229560e-18 1.18114780e-17 5.36751535e-01 479.415436
.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 479.415436 m 8.0000 266 | 7/11
16 h-m-p 0.0160 8.0000 0.2812 +++++ 479.415422 m 8.0000 287 | 7/11
17 h-m-p 1.6000 8.0000 0.6030 ++ 479.415416 m 8.0000 305 | 7/11
18 h-m-p 1.6000 8.0000 1.4432 ++ 479.415412 m 8.0000 323 | 7/11
19 h-m-p 1.6000 8.0000 0.9215 ++ 479.415411 m 8.0000 337 | 7/11
20 h-m-p 0.3918 1.9589 13.5792 -----------C 479.415411 0 0.0000 366 | 7/11
21 h-m-p 0.1578 8.0000 0.0000 +++ 479.415411 m 8.0000 381 | 7/11
22 h-m-p 0.0330 8.0000 0.0005 ++++ 479.415411 m 8.0000 401 | 7/11
23 h-m-p 0.0160 8.0000 1.5976 +++++ 479.415408 m 8.0000 422 | 7/11
24 h-m-p 1.6000 8.0000 6.0756 ++ 479.415406 m 8.0000 436 | 7/11
25 h-m-p 1.6000 8.0000 7.6970 ++ 479.415406 m 8.0000 450 | 7/11
26 h-m-p 1.6000 8.0000 16.1327 ++ 479.415406 m 8.0000 464 | 7/11
27 h-m-p 0.2640 1.3201 195.8994 ---------Y 479.415406 0 0.0000 487 | 7/11
28 h-m-p 1.6000 8.0000 0.0000 ---N 479.415406 0 0.0063 504 | 7/11
29 h-m-p 1.6000 8.0000 0.0000 ----------N 479.415406 0 0.0000 532
Out..
lnL = -479.415406
533 lfun, 6396 eigenQcodon, 35178 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -479.412540 S = -479.412500 -0.000017
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:18
did 20 / 39 patterns 0:18
did 30 / 39 patterns 0:19
did 39 / 39 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=124
NC_011896_1_WP_010908646_1_2092_MLBR_RS09935 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
NC_002677_1_NP_302325_1_1197_rpsM MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD
**************************************************
NC_011896_1_WP_010908646_1_2092_MLBR_RS09935 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
NC_002677_1_NP_302325_1_1197_rpsM DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060 DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG
**************************************************
NC_011896_1_WP_010908646_1_2092_MLBR_RS09935 QRTKTNARTRKGPKRTIAGKKKAR
NC_002677_1_NP_302325_1_1197_rpsM QRTKTNARTRKGPKRTIAGKKKAR
NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465 QRTKTNARTRKGPKRTIAGKKKAR
NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775 QRTKTNARTRKGPKRTIAGKKKAR
NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765 QRTKTNARTRKGPKRTIAGKKKAR
NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060 QRTKTNARTRKGPKRTIAGKKKAR
************************
>NC_011896_1_WP_010908646_1_2092_MLBR_RS09935 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG >NC_002677_1_NP_302325_1_1197_rpsM ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG >NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG >NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG >NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG >NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060 ATGGCTCGACTAGTCGGCGTCGACCTGCCGCGCGACAAGCGGATGGAGGT CGCCCTGACCTACATCTATGGTATTGGACGCACCCGTGCCAACGAAATTT TAGAGGCCACCGGCATTGAACGGGACCTACGGACCAGGGATCTCACCGAT GACCAGCTGACCCACCTGCGCGACTACATCGAAGCTAATCTCAAGGTGGA AGGTGACTTGCGTCGCGAGGTGCAGGCCGATATCCGCCGCAAGATGGAGA TCGGCTGTTACCAAGGTTTGCGACACCGCCGCGGCCTGCCGGTGCGTGGC CAGCGGACCAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCAT TGCAGGCAAGAAGAAGGCCAGG
>NC_011896_1_WP_010908646_1_2092_MLBR_RS09935 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR >NC_002677_1_NP_302325_1_1197_rpsM MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR >NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR >NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR >NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR >NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060 MARLVGVDLPRDKRMEVALTYIYGIGRTRANEILEATGIERDLRTRDLTD DQLTHLRDYIEANLKVEGDLRREVQADIRRKMEIGCYQGLRHRRGLPVRG QRTKTNARTRKGPKRTIAGKKKAR
#NEXUS
[ID: 0794959148]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908646_1_2092_MLBR_RS09935
NC_002677_1_NP_302325_1_1197_rpsM
NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465
NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775
NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765
NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908646_1_2092_MLBR_RS09935,
2 NC_002677_1_NP_302325_1_1197_rpsM,
3 NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465,
4 NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775,
5 NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765,
6 NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0683783,2:0.06849832,3:0.06631299,4:0.0698455,5:0.06778521,6:0.06822916);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0683783,2:0.06849832,3:0.06631299,4:0.0698455,5:0.06778521,6:0.06822916);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -503.60 -507.23
2 -503.59 -506.93
--------------------------------------
TOTAL -503.59 -507.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892905 0.089435 0.346565 1.484922 0.862531 1282.86 1384.85 1.000
r(A<->C){all} 0.169026 0.020012 0.000038 0.459969 0.134334 254.08 311.26 1.000
r(A<->G){all} 0.173474 0.021574 0.000138 0.463583 0.132934 196.15 269.63 1.000
r(A<->T){all} 0.169511 0.021248 0.000013 0.472800 0.134107 243.88 249.17 1.000
r(C<->G){all} 0.151957 0.017309 0.000037 0.420191 0.116085 180.47 253.37 1.002
r(C<->T){all} 0.171365 0.021221 0.000010 0.473474 0.133443 129.07 161.76 1.000
r(G<->T){all} 0.164667 0.017619 0.000165 0.424536 0.135562 179.88 246.65 1.000
pi(A){all} 0.236291 0.000478 0.194240 0.278451 0.236079 1154.16 1163.35 1.000
pi(C){all} 0.308547 0.000548 0.264178 0.355273 0.308723 1230.21 1240.54 1.000
pi(G){all} 0.306112 0.000557 0.261431 0.353169 0.305773 1249.36 1335.68 1.000
pi(T){all} 0.149051 0.000328 0.115026 0.184898 0.148208 836.25 1080.83 1.000
alpha{1,2} 0.405734 0.221168 0.000127 1.341922 0.236388 1188.10 1195.50 1.000
alpha{3} 0.456308 0.250092 0.000340 1.482230 0.292638 1075.02 1113.78 1.000
pinvar{all} 0.995526 0.000028 0.985681 0.999995 0.997226 1197.03 1240.75 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsM/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 124
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 10 10 10 10 10 10
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 10 10 10 10 10 10 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 7 7 7 7 7 7 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 5 5 5 5 5 5 | GAC 6 6 6 6 6 6 | GGC 7 7 7 7 7 7
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908646_1_2092_MLBR_RS09935
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
#2: NC_002677_1_NP_302325_1_1197_rpsM
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
#3: NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
#4: NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
#5: NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
#6: NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 0 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 18
CTC 12 | CCC 6 | CAC 12 | CGC 60
CTA 12 | CCA 0 | Gln Q CAA 6 | CGA 12
CTG 30 | CCG 12 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 24 | ACC 60 | AAC 12 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 0 | AAG 42 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 18
GTC 18 | GCC 30 | GAC 36 | GGC 42
GTA 0 | GCA 6 | Glu E GAA 24 | GGA 6
GTG 18 | GCG 6 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06452 C:0.30645 A:0.28226 G:0.34677
position 2: T:0.23387 C:0.17742 A:0.31452 G:0.27419
position 3: T:0.14516 C:0.44355 A:0.11290 G:0.29839
Average T:0.14785 C:0.30914 A:0.23656 G:0.30645
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -479.415443 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.403736 1.241059
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908646_1_2092_MLBR_RS09935: 0.000004, NC_002677_1_NP_302325_1_1197_rpsM: 0.000004, NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465: 0.000004, NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775: 0.000004, NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765: 0.000004, NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.40374
omega (dN/dS) = 1.24106
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
7..2 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
7..3 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
7..4 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
7..5 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
7..6 0.000 296.8 75.2 1.2411 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -479.415449 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.421918 0.000010 0.239972
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908646_1_2092_MLBR_RS09935: 0.000004, NC_002677_1_NP_302325_1_1197_rpsM: 0.000004, NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465: 0.000004, NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775: 0.000004, NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765: 0.000004, NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.42192
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.23997 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 296.7 75.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -479.415469 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.417006 0.569308 0.258134 0.051264 1.509356
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908646_1_2092_MLBR_RS09935: 0.000004, NC_002677_1_NP_302325_1_1197_rpsM: 0.000004, NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465: 0.000004, NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775: 0.000004, NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765: 0.000004, NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.41701
MLEs of dN/dS (w) for site classes (K=3)
p: 0.56931 0.25813 0.17256
w: 0.05126 1.00000 1.50936
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
7..2 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
7..3 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
7..4 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
7..5 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
7..6 0.000 296.8 75.2 0.5478 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908646_1_2092_MLBR_RS09935)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908646_1_2092_MLBR_RS09935)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -479.415494 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.416996 0.736182 1.660039
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908646_1_2092_MLBR_RS09935: 0.000004, NC_002677_1_NP_302325_1_1197_rpsM: 0.000004, NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465: 0.000004, NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775: 0.000004, NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765: 0.000004, NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.41700
Parameters in M7 (beta):
p = 0.73618 q = 1.66004
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00989 0.04456 0.09083 0.14674 0.21216 0.28799 0.37623 0.48086 0.61064 0.79430
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
7..2 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
7..3 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
7..4 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
7..5 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
7..6 0.000 296.8 75.2 0.3054 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -479.415406 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 146.941850 0.000010 0.005000 1.302811 234.946579
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908646_1_2092_MLBR_RS09935: 0.000004, NC_002677_1_NP_302325_1_1197_rpsM: 0.000004, NZ_LVXE01000050_1_WP_010908646_1_2121_A3216_RS11465: 0.000004, NZ_LYPH01000079_1_WP_010908646_1_2654_A8144_RS12775: 0.000004, NZ_CP029543_1_WP_010908646_1_2114_DIJ64_RS10765: 0.000004, NZ_AP014567_1_WP_010908646_1_2173_JK2ML_RS11060: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 146.94185
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.30281
(p1 = 0.99999) w = 234.94658
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 234.94658
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 95.4 234.9442 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908646_1_2092_MLBR_RS09935)
Pr(w>1) post mean +- SE for w
1 M 1.000** 234.944
2 A 1.000** 234.944
3 R 1.000** 234.944
4 L 1.000** 234.944
5 V 1.000** 234.944
6 G 1.000** 234.944
7 V 1.000** 234.944
8 D 1.000** 234.944
9 L 1.000** 234.944
10 P 1.000** 234.944
11 R 1.000** 234.944
12 D 1.000** 234.944
13 K 1.000** 234.944
14 R 1.000** 234.944
15 M 1.000** 234.944
16 E 1.000** 234.944
17 V 1.000** 234.944
18 A 1.000** 234.944
19 L 1.000** 234.944
20 T 1.000** 234.944
21 Y 1.000** 234.944
22 I 1.000** 234.944
23 Y 1.000** 234.944
24 G 1.000** 234.944
25 I 1.000** 234.944
26 G 1.000** 234.944
27 R 1.000** 234.944
28 T 1.000** 234.944
29 R 1.000** 234.944
30 A 1.000** 234.944
31 N 1.000** 234.944
32 E 1.000** 234.944
33 I 1.000** 234.944
34 L 1.000** 234.944
35 E 1.000** 234.944
36 A 1.000** 234.944
37 T 1.000** 234.944
38 G 1.000** 234.944
39 I 1.000** 234.944
40 E 1.000** 234.944
41 R 1.000** 234.944
42 D 1.000** 234.944
43 L 1.000** 234.944
44 R 1.000** 234.944
45 T 1.000** 234.944
46 R 1.000** 234.944
47 D 1.000** 234.944
48 L 1.000** 234.944
49 T 1.000** 234.944
50 D 1.000** 234.944
51 D 1.000** 234.944
52 Q 1.000** 234.944
53 L 1.000** 234.944
54 T 1.000** 234.944
55 H 1.000** 234.944
56 L 1.000** 234.944
57 R 1.000** 234.944
58 D 1.000** 234.944
59 Y 1.000** 234.944
60 I 1.000** 234.944
61 E 1.000** 234.944
62 A 1.000** 234.944
63 N 1.000** 234.944
64 L 1.000** 234.944
65 K 1.000** 234.944
66 V 1.000** 234.944
67 E 1.000** 234.944
68 G 1.000** 234.944
69 D 1.000** 234.944
70 L 1.000** 234.944
71 R 1.000** 234.944
72 R 1.000** 234.944
73 E 1.000** 234.944
74 V 1.000** 234.944
75 Q 1.000** 234.944
76 A 1.000** 234.944
77 D 1.000** 234.944
78 I 1.000** 234.944
79 R 1.000** 234.944
80 R 1.000** 234.944
81 K 1.000** 234.944
82 M 1.000** 234.944
83 E 1.000** 234.944
84 I 1.000** 234.944
85 G 1.000** 234.944
86 C 1.000** 234.944
87 Y 1.000** 234.944
88 Q 1.000** 234.944
89 G 1.000** 234.944
90 L 1.000** 234.944
91 R 1.000** 234.944
92 H 1.000** 234.944
93 R 1.000** 234.944
94 R 1.000** 234.944
95 G 1.000** 234.944
96 L 1.000** 234.944
97 P 1.000** 234.944
98 V 1.000** 234.944
99 R 1.000** 234.944
100 G 1.000** 234.944
101 Q 1.000** 234.944
102 R 1.000** 234.944
103 T 1.000** 234.944
104 K 1.000** 234.944
105 T 1.000** 234.944
106 N 1.000** 234.944
107 A 1.000** 234.944
108 R 1.000** 234.944
109 T 1.000** 234.944
110 R 1.000** 234.944
111 K 1.000** 234.944
112 G 1.000** 234.944
113 P 1.000** 234.944
114 K 1.000** 234.944
115 R 1.000** 234.944
116 T 1.000** 234.944
117 I 1.000** 234.944
118 A 1.000** 234.944
119 G 1.000** 234.944
120 K 1.000** 234.944
121 K 1.000** 234.944
122 K 1.000** 234.944
123 A 1.000** 234.944
124 R 1.000** 234.944
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908646_1_2092_MLBR_RS09935)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:19
Model 1: NearlyNeutral -479.415449 Model 2: PositiveSelection -479.415469 Model 0: one-ratio -479.415443 Model 7: beta -479.415494 Model 8: beta&w>1 -479.415406 Model 0 vs 1 1.200000008338975E-5 Model 2 vs 1 3.999999989900971E-5 Model 8 vs 7 1.7600000001039007E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
