--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:22:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/ribC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -843.53 -846.56
2 -843.46 -846.64
--------------------------------------
TOTAL -843.50 -846.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895106 0.090634 0.361872 1.478266 0.859936 1370.14 1435.57 1.000
r(A<->C){all} 0.161719 0.018745 0.000056 0.429959 0.127351 295.51 375.16 1.005
r(A<->G){all} 0.172807 0.021012 0.000061 0.473061 0.134206 278.75 306.30 1.004
r(A<->T){all} 0.169021 0.019463 0.000022 0.441047 0.134207 304.96 363.37 1.000
r(C<->G){all} 0.165434 0.018142 0.000075 0.433181 0.129955 255.44 290.75 1.001
r(C<->T){all} 0.170340 0.019978 0.000113 0.447098 0.132416 175.29 243.82 1.005
r(G<->T){all} 0.160680 0.017912 0.000088 0.433357 0.128069 206.07 249.42 1.000
pi(A){all} 0.177390 0.000232 0.146850 0.204973 0.177443 1265.14 1298.56 1.000
pi(C){all} 0.273802 0.000320 0.237322 0.307087 0.273768 1121.31 1285.43 1.000
pi(G){all} 0.339085 0.000359 0.301721 0.376194 0.338839 1227.31 1295.72 1.000
pi(T){all} 0.209724 0.000272 0.178009 0.241906 0.209136 1216.42 1225.63 1.000
alpha{1,2} 0.408667 0.215211 0.000105 1.336803 0.244070 1062.01 1176.23 1.000
alpha{3} 0.446218 0.242914 0.000248 1.441813 0.275944 1334.05 1337.71 1.000
pinvar{all} 0.997393 0.000010 0.991651 0.999998 0.998419 1196.10 1296.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -807.125175
Model 2: PositiveSelection -807.125108
Model 0: one-ratio -807.125201
Model 7: beta -807.125167
Model 8: beta&w>1 -807.125148
Model 0 vs 1 5.199999986871262E-5
Model 2 vs 1 1.3400000011642987E-4
Model 8 vs 7 3.80000001314329E-5
>C1
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C2
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C3
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C4
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C5
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C6
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=207
C1 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C2 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C3 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C4 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C5 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C6 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
**************************************************
C1 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C2 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C3 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C4 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C5 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C6 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
**************************************************
C1 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C2 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C3 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C4 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C5 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C6 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
**************************************************
C1 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C2 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C3 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C4 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C5 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C6 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
**************************************************
C1 PTGDLTR
C2 PTGDLTR
C3 PTGDLTR
C4 PTGDLTR
C5 PTGDLTR
C6 PTGDLTR
*******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 207 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 207 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6210]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6210]--->[6210]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.472 Mb, Max= 30.741 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C2 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C3 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C4 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C5 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
C6 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
**************************************************
C1 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C2 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C3 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C4 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C5 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
C6 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
**************************************************
C1 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C2 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C3 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C4 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C5 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
C6 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
**************************************************
C1 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C2 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C3 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C4 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C5 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
C6 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
**************************************************
C1 PTGDLTR
C2 PTGDLTR
C3 PTGDLTR
C4 PTGDLTR
C5 PTGDLTR
C6 PTGDLTR
*******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
C2 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
C3 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
C4 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
C5 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
C6 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
**************************************************
C1 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
C2 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
C3 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
C4 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
C5 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
C6 CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
**************************************************
C1 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
C2 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
C3 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
C4 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
C5 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
C6 ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
**************************************************
C1 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
C2 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
C3 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
C4 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
C5 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
C6 GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
**************************************************
C1 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
C2 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
C3 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
C4 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
C5 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
C6 GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
**************************************************
C1 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
C2 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
C3 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
C4 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
C5 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
C6 TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
**************************************************
C1 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
C2 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
C3 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
C4 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
C5 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
C6 GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
**************************************************
C1 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
C2 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
C3 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
C4 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
C5 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
C6 CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
**************************************************
C1 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
C2 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
C3 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
C4 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
C5 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
C6 TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
**************************************************
C1 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
C2 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
C3 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
C4 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
C5 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
C6 CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
**************************************************
C1 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
C2 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
C3 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
C4 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
C5 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
C6 CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
**************************************************
C1 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
C2 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
C3 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
C4 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
C5 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
C6 TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
**************************************************
C1 CCTACCGGGGATTTGACTCGA
C2 CCTACCGGGGATTTGACTCGA
C3 CCTACCGGGGATTTGACTCGA
C4 CCTACCGGGGATTTGACTCGA
C5 CCTACCGGGGATTTGACTCGA
C6 CCTACCGGGGATTTGACTCGA
*********************
>C1
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C2
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C3
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C4
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C5
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C6
ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC
CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG
ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG
GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC
GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC
TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG
GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA
CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG
TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG
CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC
CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC
TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT
CCTACCGGGGATTTGACTCGA
>C1
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C2
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C3
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C4
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C5
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
>C6
MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
PTGDLTR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 621 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789245
Setting output file names to "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1130677616
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0046767513
Seed = 279744880
Swapseed = 1579789245
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1389.827768 -- -24.965149
Chain 2 -- -1389.827768 -- -24.965149
Chain 3 -- -1389.827768 -- -24.965149
Chain 4 -- -1389.827556 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1389.827768 -- -24.965149
Chain 2 -- -1389.827687 -- -24.965149
Chain 3 -- -1389.827768 -- -24.965149
Chain 4 -- -1389.827687 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1389.828] (-1389.828) (-1389.828) (-1389.828) * [-1389.828] (-1389.828) (-1389.828) (-1389.828)
500 -- (-852.942) (-870.234) [-854.278] (-868.608) * (-862.646) (-856.217) (-852.655) [-851.149] -- 0:00:00
1000 -- (-856.829) (-851.766) [-849.642] (-852.990) * (-863.646) (-853.466) [-848.967] (-853.314) -- 0:00:00
1500 -- (-855.138) (-848.991) [-853.628] (-848.470) * (-854.441) [-847.260] (-854.510) (-852.144) -- 0:00:00
2000 -- [-852.863] (-865.110) (-855.432) (-848.518) * (-850.384) (-857.789) (-848.293) [-856.818] -- 0:00:00
2500 -- [-854.784] (-852.319) (-852.565) (-846.173) * (-853.343) (-857.860) (-856.959) [-851.589] -- 0:00:00
3000 -- (-856.350) (-854.153) [-854.968] (-854.840) * (-853.665) (-857.227) [-855.864] (-849.948) -- 0:00:00
3500 -- (-857.197) (-865.279) [-850.420] (-852.791) * [-849.579] (-850.098) (-861.488) (-852.842) -- 0:00:00
4000 -- (-855.680) [-857.086] (-859.513) (-850.823) * (-852.682) [-851.450] (-856.484) (-850.462) -- 0:00:00
4500 -- (-851.565) (-859.824) [-853.424] (-852.051) * (-862.336) [-852.795] (-853.924) (-849.256) -- 0:00:00
5000 -- (-856.163) (-852.796) [-848.900] (-854.861) * (-856.234) [-854.156] (-851.442) (-859.835) -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-850.345) (-853.429) [-850.893] (-856.500) * (-856.397) (-854.081) [-848.024] (-852.257) -- 0:00:00
6000 -- (-855.968) [-849.909] (-855.351) (-854.362) * (-851.658) [-854.526] (-847.038) (-854.839) -- 0:00:00
6500 -- (-849.898) [-846.862] (-863.035) (-848.456) * [-859.852] (-859.105) (-851.735) (-857.045) -- 0:00:00
7000 -- (-854.939) [-854.364] (-860.073) (-858.719) * [-853.395] (-860.257) (-856.086) (-856.442) -- 0:02:21
7500 -- (-851.232) [-848.731] (-859.232) (-857.708) * (-861.514) [-849.204] (-850.258) (-855.579) -- 0:02:12
8000 -- [-850.813] (-860.734) (-853.950) (-852.168) * (-850.727) (-869.365) (-854.490) [-852.096] -- 0:02:04
8500 -- (-856.422) [-853.938] (-856.720) (-860.533) * (-861.438) (-852.007) (-849.909) [-850.418] -- 0:01:56
9000 -- (-859.803) [-851.051] (-851.110) (-852.132) * [-853.932] (-856.947) (-859.205) (-862.640) -- 0:01:50
9500 -- [-856.975] (-857.229) (-853.388) (-852.841) * (-848.161) (-851.363) [-851.856] (-855.192) -- 0:01:44
10000 -- [-851.531] (-854.977) (-851.774) (-851.985) * (-854.839) (-857.453) (-854.937) [-854.367] -- 0:01:39
Average standard deviation of split frequencies: 0.081759
10500 -- (-859.023) (-856.420) [-853.786] (-851.084) * [-852.140] (-859.750) (-857.094) (-853.967) -- 0:01:34
11000 -- (-852.442) (-854.896) [-849.473] (-852.698) * [-848.903] (-850.581) (-852.696) (-862.631) -- 0:01:29
11500 -- (-845.893) (-854.879) [-855.328] (-853.107) * [-852.873] (-850.577) (-857.769) (-870.045) -- 0:01:25
12000 -- (-855.779) (-851.163) [-846.869] (-859.616) * [-852.192] (-853.207) (-852.835) (-850.966) -- 0:01:22
12500 -- (-851.519) (-874.998) (-855.876) [-850.404] * (-850.335) (-855.202) (-865.730) [-843.449] -- 0:01:19
13000 -- (-858.506) (-867.028) [-847.846] (-852.476) * (-863.275) [-855.528] (-874.137) (-843.633) -- 0:01:15
13500 -- (-855.103) (-844.879) [-849.466] (-856.273) * (-858.155) [-855.096] (-845.732) (-845.244) -- 0:01:13
14000 -- (-854.195) [-845.972] (-859.266) (-856.522) * (-853.876) (-853.523) [-844.445] (-844.917) -- 0:01:10
14500 -- (-860.266) (-843.681) (-848.729) [-849.790] * [-851.908] (-852.325) (-843.427) (-844.547) -- 0:01:07
15000 -- (-856.308) [-844.983] (-852.282) (-851.797) * [-851.231] (-849.219) (-845.041) (-844.854) -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- [-854.780] (-845.719) (-852.484) (-848.724) * [-852.745] (-859.846) (-843.854) (-844.572) -- 0:01:03
16000 -- (-852.540) (-845.498) [-855.999] (-849.197) * (-851.761) (-851.191) [-843.370] (-845.119) -- 0:01:01
16500 -- (-863.465) [-848.782] (-852.557) (-853.342) * (-850.241) (-856.515) (-842.329) [-845.687] -- 0:00:59
17000 -- (-854.995) [-847.843] (-848.625) (-859.736) * (-852.385) (-859.501) [-843.400] (-845.018) -- 0:00:57
17500 -- (-854.575) [-843.657] (-856.585) (-849.319) * (-855.230) (-851.289) (-851.114) [-844.281] -- 0:00:56
18000 -- (-861.294) (-843.911) [-853.745] (-853.017) * (-854.901) (-857.619) [-843.001] (-843.070) -- 0:00:54
18500 -- (-853.103) (-842.761) [-849.304] (-848.994) * [-850.455] (-855.301) (-844.413) (-845.866) -- 0:00:53
19000 -- (-849.294) [-844.547] (-853.714) (-853.493) * (-848.847) [-852.459] (-847.017) (-843.211) -- 0:00:51
19500 -- [-845.404] (-843.431) (-858.313) (-850.326) * (-853.297) [-855.846] (-846.792) (-847.733) -- 0:00:50
20000 -- (-856.823) [-845.021] (-859.715) (-854.475) * [-849.112] (-856.968) (-844.844) (-850.284) -- 0:00:49
Average standard deviation of split frequencies: 0.063868
20500 -- (-854.992) (-845.839) [-851.919] (-857.853) * [-852.920] (-848.584) (-843.827) (-846.235) -- 0:00:47
21000 -- (-854.851) (-847.708) (-854.331) [-857.835] * [-854.584] (-850.931) (-844.036) (-842.563) -- 0:00:46
21500 -- (-853.006) [-844.803] (-853.327) (-853.555) * [-850.714] (-849.662) (-844.994) (-843.031) -- 0:00:45
22000 -- (-853.099) (-848.617) [-853.970] (-849.406) * (-857.818) (-849.754) (-845.291) [-842.943] -- 0:00:44
22500 -- [-852.037] (-844.767) (-854.392) (-850.076) * (-851.674) [-849.985] (-847.816) (-844.141) -- 0:00:43
23000 -- [-851.192] (-844.615) (-854.431) (-854.368) * (-855.762) (-857.515) (-846.044) [-843.809] -- 0:00:42
23500 -- (-858.501) [-845.641] (-850.381) (-854.949) * (-850.610) (-854.802) [-844.409] (-842.819) -- 0:01:23
24000 -- (-854.604) [-844.942] (-870.882) (-851.064) * [-851.425] (-858.183) (-843.681) (-842.489) -- 0:01:21
24500 -- [-854.397] (-843.943) (-854.299) (-853.848) * (-847.110) [-851.332] (-842.289) (-842.715) -- 0:01:19
25000 -- (-849.806) (-844.699) [-848.559] (-857.166) * (-843.164) (-849.457) [-844.710] (-847.361) -- 0:01:18
Average standard deviation of split frequencies: 0.057415
25500 -- (-854.638) [-843.814] (-854.414) (-852.151) * (-846.251) [-854.259] (-842.404) (-845.002) -- 0:01:16
26000 -- (-848.090) (-842.580) (-854.126) [-854.452] * (-846.243) [-858.959] (-846.037) (-846.283) -- 0:01:14
26500 -- (-858.792) [-843.446] (-854.387) (-848.999) * [-849.399] (-864.647) (-844.038) (-846.397) -- 0:01:13
27000 -- (-858.640) [-845.600] (-863.654) (-850.059) * (-847.056) (-856.834) [-843.187] (-844.629) -- 0:01:12
27500 -- (-851.129) [-842.928] (-857.936) (-847.758) * (-843.797) [-850.075] (-842.304) (-845.470) -- 0:01:10
28000 -- [-857.691] (-843.989) (-862.087) (-855.691) * (-843.607) (-846.032) [-842.989] (-843.985) -- 0:01:09
28500 -- (-851.649) [-842.578] (-842.814) (-862.223) * (-844.380) (-845.604) (-843.086) [-843.409] -- 0:01:08
29000 -- (-857.943) (-842.341) (-843.459) [-854.633] * [-843.973] (-843.281) (-847.259) (-845.517) -- 0:01:06
29500 -- (-851.503) [-844.723] (-848.038) (-850.618) * (-842.999) (-842.352) [-843.879] (-844.142) -- 0:01:05
30000 -- (-850.624) [-844.581] (-842.892) (-853.586) * [-844.907] (-847.307) (-842.526) (-845.548) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- [-852.838] (-843.034) (-842.497) (-856.090) * (-843.966) [-846.913] (-843.186) (-845.473) -- 0:01:03
31000 -- [-851.948] (-843.256) (-844.352) (-856.119) * [-844.147] (-843.441) (-842.509) (-847.687) -- 0:01:02
31500 -- [-857.205] (-842.705) (-844.541) (-857.429) * [-843.561] (-842.937) (-845.160) (-851.116) -- 0:01:01
32000 -- (-855.217) (-843.711) (-845.287) [-850.750] * (-842.887) (-842.082) [-845.049] (-844.417) -- 0:01:00
32500 -- (-859.248) (-845.045) (-846.605) [-846.787] * (-843.798) (-844.476) (-845.346) [-845.162] -- 0:00:59
33000 -- [-850.346] (-843.856) (-843.993) (-854.088) * (-844.100) (-844.988) [-844.362] (-846.820) -- 0:00:58
33500 -- (-845.629) (-843.960) (-847.050) [-846.443] * (-843.595) (-845.343) (-843.977) [-845.422] -- 0:00:57
34000 -- [-854.146] (-845.713) (-848.295) (-851.840) * (-843.788) (-846.616) [-845.953] (-842.742) -- 0:00:56
34500 -- (-855.255) (-848.249) [-842.396] (-855.618) * (-846.706) (-842.521) (-843.481) [-841.985] -- 0:00:55
35000 -- (-850.568) (-846.879) (-844.928) [-857.066] * [-846.649] (-844.750) (-842.822) (-843.643) -- 0:00:55
Average standard deviation of split frequencies: 0.042194
35500 -- (-859.126) [-843.510] (-846.699) (-854.495) * (-851.723) (-846.157) [-844.247] (-845.447) -- 0:00:54
36000 -- (-860.345) (-843.754) (-844.620) [-845.182] * (-844.581) (-842.696) [-845.015] (-845.090) -- 0:00:53
36500 -- [-847.227] (-843.515) (-848.385) (-846.763) * (-843.830) [-844.008] (-843.853) (-849.520) -- 0:00:52
37000 -- (-851.510) (-846.213) [-844.742] (-846.066) * (-844.507) (-843.506) [-845.163] (-844.251) -- 0:00:52
37500 -- (-854.932) [-844.278] (-844.844) (-845.017) * (-846.210) (-842.031) (-843.656) [-843.522] -- 0:00:51
38000 -- (-852.385) (-843.939) (-845.350) [-845.965] * (-845.721) (-842.048) (-847.716) [-845.912] -- 0:00:50
38500 -- [-849.307] (-843.889) (-844.885) (-843.541) * (-843.622) (-845.644) [-847.555] (-844.508) -- 0:00:49
39000 -- [-847.798] (-846.253) (-846.644) (-844.569) * (-843.300) [-842.432] (-843.757) (-842.753) -- 0:00:49
39500 -- (-850.227) (-844.941) (-844.232) [-843.643] * [-843.977] (-843.283) (-846.142) (-843.251) -- 0:00:48
40000 -- (-855.649) (-845.253) (-844.600) [-845.590] * [-844.830] (-845.916) (-844.428) (-845.013) -- 0:01:12
Average standard deviation of split frequencies: 0.045147
40500 -- (-846.678) [-842.327] (-843.913) (-845.110) * [-843.580] (-846.958) (-843.335) (-845.978) -- 0:01:11
41000 -- (-851.958) (-841.986) [-844.298] (-845.516) * (-845.915) (-846.134) (-847.005) [-844.047] -- 0:01:10
41500 -- [-851.375] (-844.438) (-848.096) (-843.944) * [-847.671] (-845.791) (-844.711) (-845.969) -- 0:01:09
42000 -- (-854.188) (-844.552) [-845.138] (-844.916) * (-848.854) (-844.750) [-844.441] (-843.860) -- 0:01:08
42500 -- (-857.505) (-844.302) (-844.249) [-842.536] * (-844.933) (-843.259) [-842.700] (-843.698) -- 0:01:07
43000 -- (-857.394) (-845.663) (-844.791) [-843.443] * (-843.948) (-842.415) [-845.309] (-844.856) -- 0:01:06
43500 -- (-849.480) [-844.043] (-848.269) (-845.478) * (-843.123) [-842.918] (-844.862) (-849.662) -- 0:01:05
44000 -- (-859.444) [-843.997] (-850.757) (-843.653) * (-843.539) (-844.847) [-843.271] (-844.642) -- 0:01:05
44500 -- (-850.164) [-846.404] (-845.758) (-845.820) * (-845.099) (-846.212) [-844.157] (-843.489) -- 0:01:04
45000 -- (-853.708) (-848.437) (-845.294) [-844.111] * (-844.507) (-843.397) [-846.196] (-843.445) -- 0:01:03
Average standard deviation of split frequencies: 0.036893
45500 -- (-857.640) (-852.038) (-843.387) [-843.408] * [-842.903] (-846.696) (-845.560) (-845.432) -- 0:01:02
46000 -- (-863.632) [-848.231] (-843.403) (-843.000) * [-842.699] (-845.197) (-848.666) (-842.610) -- 0:01:02
46500 -- [-856.067] (-844.685) (-844.398) (-843.586) * (-844.419) (-847.791) (-844.920) [-842.270] -- 0:01:01
47000 -- (-854.060) (-843.081) [-842.576] (-847.759) * (-845.850) (-845.118) [-845.585] (-843.546) -- 0:01:00
47500 -- (-850.089) [-842.440] (-842.417) (-848.600) * (-844.948) [-842.389] (-852.176) (-845.889) -- 0:01:00
48000 -- (-852.558) (-842.417) [-842.687] (-845.237) * (-848.521) (-843.341) [-842.253] (-844.401) -- 0:00:59
48500 -- (-847.819) (-843.637) (-844.737) [-846.544] * (-843.202) (-844.175) (-849.878) [-843.578] -- 0:00:58
49000 -- (-849.241) [-843.397] (-849.251) (-845.080) * [-842.289] (-842.690) (-847.119) (-843.728) -- 0:00:58
49500 -- [-844.691] (-846.519) (-844.190) (-845.599) * (-846.318) (-841.854) [-845.123] (-844.030) -- 0:00:57
50000 -- (-843.349) [-845.767] (-844.713) (-849.824) * (-845.506) (-842.033) [-843.152] (-843.468) -- 0:00:57
Average standard deviation of split frequencies: 0.033299
50500 -- (-845.055) [-844.917] (-843.277) (-843.069) * [-846.457] (-844.920) (-843.690) (-843.470) -- 0:00:56
51000 -- (-842.071) (-843.901) (-845.152) [-844.318] * (-847.508) [-844.473] (-850.248) (-842.685) -- 0:00:55
51500 -- (-842.012) (-843.880) (-844.815) [-842.460] * [-843.949] (-842.730) (-846.796) (-848.582) -- 0:00:55
52000 -- (-842.408) (-848.935) (-842.412) [-843.597] * (-844.537) (-846.185) [-843.378] (-844.318) -- 0:00:54
52500 -- (-842.658) (-844.934) [-843.460] (-843.730) * (-843.444) (-844.451) (-843.416) [-845.124] -- 0:00:54
53000 -- (-842.110) (-843.017) (-844.464) [-843.142] * (-843.521) (-843.914) (-845.344) [-847.817] -- 0:00:53
53500 -- (-844.900) [-843.728] (-845.724) (-848.272) * [-842.854] (-843.556) (-844.175) (-842.800) -- 0:00:53
54000 -- (-844.100) [-842.327] (-843.918) (-844.824) * (-842.607) [-842.968] (-848.050) (-843.902) -- 0:00:52
54500 -- (-845.406) (-842.431) (-845.431) [-844.436] * [-843.508] (-845.510) (-846.618) (-845.211) -- 0:00:52
55000 -- (-844.528) (-844.100) [-848.174] (-847.092) * (-848.125) (-846.445) (-844.869) [-843.355] -- 0:00:51
Average standard deviation of split frequencies: 0.029262
55500 -- (-841.943) (-842.320) [-843.585] (-846.705) * [-843.426] (-844.115) (-846.163) (-847.038) -- 0:01:08
56000 -- [-843.273] (-843.622) (-846.023) (-846.314) * (-843.512) [-844.817] (-845.901) (-843.792) -- 0:01:07
56500 -- (-844.985) [-843.622] (-847.081) (-846.323) * [-843.849] (-843.468) (-847.118) (-842.495) -- 0:01:06
57000 -- (-844.085) (-842.604) (-847.430) [-844.642] * (-845.061) (-848.470) [-847.617] (-842.933) -- 0:01:06
57500 -- [-846.380] (-843.777) (-846.515) (-843.940) * (-844.284) [-848.055] (-842.639) (-844.765) -- 0:01:05
58000 -- (-848.221) (-843.155) (-845.392) [-842.589] * [-846.054] (-843.655) (-843.834) (-844.065) -- 0:01:04
58500 -- (-847.430) (-843.246) (-845.180) [-842.626] * (-846.410) (-844.419) [-845.372] (-843.496) -- 0:01:04
59000 -- (-842.380) [-845.391] (-842.716) (-842.719) * (-843.117) (-843.906) (-844.897) [-844.783] -- 0:01:03
59500 -- (-844.611) (-846.894) (-845.154) [-843.417] * [-842.886] (-845.317) (-843.245) (-843.066) -- 0:01:03
60000 -- [-842.275] (-847.277) (-844.701) (-848.050) * [-842.761] (-844.950) (-844.894) (-846.437) -- 0:01:02
Average standard deviation of split frequencies: 0.024947
60500 -- [-844.217] (-847.901) (-844.982) (-842.854) * (-842.604) (-843.615) (-847.761) [-844.831] -- 0:01:02
61000 -- [-844.023] (-848.873) (-847.387) (-843.327) * (-842.524) (-843.210) (-845.426) [-844.554] -- 0:01:01
61500 -- (-849.654) (-845.654) [-844.852] (-843.509) * (-849.664) (-842.445) (-844.761) [-843.239] -- 0:01:01
62000 -- (-845.540) (-846.030) (-843.248) [-846.949] * [-845.630] (-843.639) (-843.886) (-844.061) -- 0:01:00
62500 -- (-842.936) [-844.027] (-843.780) (-845.853) * (-844.254) [-842.430] (-842.406) (-844.509) -- 0:01:00
63000 -- [-842.409] (-848.555) (-842.144) (-843.996) * (-845.397) (-842.408) [-842.406] (-842.549) -- 0:00:59
63500 -- (-843.036) [-844.121] (-844.846) (-844.189) * (-846.312) (-843.838) [-842.903] (-843.951) -- 0:00:58
64000 -- (-842.193) (-843.822) (-843.668) [-843.872] * (-843.365) (-844.268) (-843.019) [-843.275] -- 0:00:58
64500 -- (-842.294) [-843.239] (-846.964) (-842.521) * [-843.926] (-842.691) (-844.155) (-842.786) -- 0:00:58
65000 -- (-846.416) (-843.581) [-844.424] (-845.138) * (-844.618) [-844.817] (-844.147) (-844.828) -- 0:00:57
Average standard deviation of split frequencies: 0.027442
65500 -- (-846.868) [-844.074] (-843.273) (-844.919) * [-845.223] (-843.960) (-847.658) (-844.158) -- 0:00:57
66000 -- [-843.094] (-842.886) (-842.757) (-842.579) * [-845.185] (-843.185) (-846.136) (-843.618) -- 0:00:56
66500 -- (-842.637) (-842.886) (-842.939) [-843.864] * (-844.064) (-842.830) (-843.839) [-845.409] -- 0:00:56
67000 -- (-851.205) (-843.714) (-844.797) [-842.327] * [-843.902] (-845.588) (-843.822) (-846.324) -- 0:00:55
67500 -- (-844.183) [-846.962] (-843.103) (-843.127) * [-842.354] (-843.327) (-843.812) (-845.271) -- 0:00:55
68000 -- (-844.208) (-842.277) (-848.107) [-843.561] * (-844.144) (-844.756) (-845.370) [-844.519] -- 0:00:54
68500 -- (-843.243) (-843.253) [-843.652] (-842.071) * (-845.319) (-844.455) (-845.505) [-847.097] -- 0:00:54
69000 -- (-843.190) [-852.070] (-843.172) (-845.564) * (-845.318) (-847.769) (-845.128) [-844.592] -- 0:00:53
69500 -- (-842.632) (-842.657) (-844.321) [-846.787] * (-844.035) (-844.193) [-845.245] (-846.474) -- 0:00:53
70000 -- (-843.268) (-843.485) (-845.055) [-844.827] * [-842.799] (-845.552) (-844.866) (-845.537) -- 0:00:53
Average standard deviation of split frequencies: 0.025413
70500 -- (-842.098) (-846.696) (-844.912) [-843.459] * (-843.042) (-844.419) (-845.109) [-846.257] -- 0:00:52
71000 -- (-845.213) (-846.965) [-844.052] (-843.242) * [-842.672] (-846.628) (-845.350) (-844.122) -- 0:00:52
71500 -- (-848.636) [-842.685] (-844.192) (-843.686) * (-842.608) (-844.474) [-844.473] (-844.450) -- 0:00:51
72000 -- (-847.222) (-842.179) (-846.017) [-844.081] * [-842.491] (-843.042) (-844.104) (-842.888) -- 0:00:51
72500 -- (-842.686) (-844.835) [-844.672] (-847.293) * (-845.230) [-844.320] (-843.819) (-845.030) -- 0:01:03
73000 -- [-843.878] (-847.178) (-845.455) (-844.805) * (-846.747) (-842.788) (-843.030) [-841.869] -- 0:01:03
73500 -- [-842.516] (-844.186) (-842.870) (-849.462) * (-842.120) [-845.282] (-852.805) (-843.407) -- 0:01:03
74000 -- (-842.338) (-843.382) (-846.533) [-844.727] * (-845.859) [-844.967] (-842.605) (-843.175) -- 0:01:02
74500 -- (-843.769) [-843.830] (-844.554) (-844.728) * (-842.515) (-844.039) (-846.492) [-844.186] -- 0:01:02
75000 -- [-842.036] (-847.230) (-844.095) (-844.217) * (-843.576) [-847.043] (-844.864) (-845.959) -- 0:01:01
Average standard deviation of split frequencies: 0.025790
75500 -- [-841.980] (-844.247) (-843.138) (-844.553) * [-843.814] (-851.787) (-846.020) (-849.630) -- 0:01:01
76000 -- (-843.369) (-844.740) (-846.442) [-844.569] * [-844.085] (-845.669) (-842.080) (-843.753) -- 0:01:00
76500 -- (-843.109) [-845.102] (-843.059) (-844.963) * [-844.286] (-845.201) (-843.682) (-848.182) -- 0:01:00
77000 -- (-842.427) [-843.380] (-844.466) (-846.464) * [-845.822] (-847.143) (-843.815) (-844.811) -- 0:00:59
77500 -- (-842.094) (-843.812) (-842.857) [-846.223] * (-845.667) [-842.640] (-843.176) (-843.336) -- 0:00:59
78000 -- [-844.684] (-843.407) (-843.432) (-847.418) * (-843.617) (-842.479) (-843.324) [-843.251] -- 0:00:59
78500 -- (-842.602) [-843.965] (-843.823) (-848.218) * [-845.018] (-844.842) (-843.038) (-849.410) -- 0:00:58
79000 -- (-849.914) [-844.305] (-842.834) (-843.608) * [-844.008] (-844.676) (-846.364) (-842.467) -- 0:00:58
79500 -- (-846.180) (-844.613) [-846.766] (-846.787) * (-844.172) (-844.935) (-843.172) [-842.240] -- 0:00:57
80000 -- (-842.838) (-846.272) [-845.123] (-844.170) * (-844.366) (-843.004) [-842.708] (-842.913) -- 0:00:57
Average standard deviation of split frequencies: 0.022688
80500 -- [-843.531] (-844.356) (-842.648) (-844.144) * [-842.038] (-846.743) (-842.657) (-843.533) -- 0:00:57
81000 -- (-843.674) (-843.698) [-843.337] (-849.506) * (-843.643) (-844.822) (-844.670) [-844.536] -- 0:00:56
81500 -- (-844.553) [-845.072] (-844.143) (-844.874) * (-848.609) (-845.778) (-843.564) [-844.301] -- 0:00:56
82000 -- (-845.449) [-844.190] (-843.613) (-851.108) * (-843.799) (-845.521) (-842.459) [-841.997] -- 0:00:55
82500 -- [-842.666] (-842.743) (-843.713) (-846.265) * [-843.895] (-845.365) (-842.067) (-843.167) -- 0:00:55
83000 -- (-843.404) (-842.824) (-844.207) [-847.536] * (-842.590) [-847.002] (-843.603) (-845.471) -- 0:00:55
83500 -- [-846.117] (-845.352) (-843.218) (-846.746) * (-842.970) [-843.785] (-845.505) (-846.148) -- 0:00:54
84000 -- [-846.078] (-846.194) (-844.868) (-845.204) * (-844.246) [-844.676] (-844.414) (-846.636) -- 0:00:54
84500 -- (-855.919) (-844.380) (-846.172) [-844.948] * (-845.421) (-848.313) [-847.890] (-845.318) -- 0:00:54
85000 -- (-846.401) [-844.282] (-847.250) (-846.206) * (-843.458) (-842.172) [-847.956] (-845.226) -- 0:00:53
Average standard deviation of split frequencies: 0.018271
85500 -- (-844.418) (-847.436) [-843.267] (-842.535) * [-846.639] (-842.873) (-843.354) (-843.215) -- 0:00:53
86000 -- (-844.938) (-846.828) [-844.234] (-842.708) * [-842.349] (-843.870) (-842.047) (-843.929) -- 0:00:53
86500 -- (-845.449) [-847.260] (-844.710) (-845.017) * (-843.229) (-846.812) [-845.702] (-845.565) -- 0:00:52
87000 -- (-843.354) [-843.840] (-844.850) (-845.797) * [-847.048] (-842.861) (-851.125) (-846.923) -- 0:00:52
87500 -- (-843.374) (-845.643) (-848.776) [-843.374] * (-845.488) (-842.876) (-842.454) [-843.309] -- 0:00:52
88000 -- (-843.148) [-842.298] (-846.069) (-846.519) * (-846.023) (-845.216) [-842.693] (-843.497) -- 0:00:51
88500 -- (-843.265) (-845.170) (-844.164) [-843.355] * [-844.222] (-842.847) (-843.532) (-846.900) -- 0:00:51
89000 -- (-844.316) [-842.212] (-845.687) (-843.832) * [-845.842] (-843.723) (-844.347) (-847.008) -- 0:01:01
89500 -- (-846.266) [-844.543] (-844.771) (-845.699) * (-847.375) [-844.385] (-843.888) (-846.246) -- 0:01:01
90000 -- [-844.377] (-844.681) (-844.512) (-843.658) * (-849.385) [-843.002] (-843.942) (-846.352) -- 0:01:00
Average standard deviation of split frequencies: 0.017787
90500 -- (-848.514) (-847.051) (-845.037) [-844.228] * (-843.938) [-842.801] (-843.986) (-845.782) -- 0:01:00
91000 -- [-845.085] (-842.664) (-844.696) (-842.862) * (-847.389) [-845.564] (-844.538) (-845.437) -- 0:00:59
91500 -- (-846.220) [-845.379] (-845.942) (-845.073) * (-847.007) [-844.971] (-842.325) (-843.580) -- 0:00:59
92000 -- [-843.917] (-848.712) (-845.559) (-842.883) * (-843.437) [-845.150] (-842.673) (-843.731) -- 0:00:59
92500 -- (-842.304) (-851.143) (-851.555) [-842.883] * (-843.258) (-844.814) [-843.460] (-845.025) -- 0:00:58
93000 -- (-842.063) [-845.210] (-845.212) (-843.080) * (-844.281) [-842.797] (-845.566) (-844.199) -- 0:00:58
93500 -- (-842.093) (-843.191) (-845.071) [-842.539] * [-843.940] (-844.275) (-844.163) (-845.430) -- 0:00:58
94000 -- (-844.341) [-843.188] (-845.669) (-842.887) * [-843.460] (-842.409) (-844.555) (-845.637) -- 0:00:57
94500 -- (-842.236) [-845.826] (-847.340) (-844.168) * (-844.102) (-845.882) [-847.178] (-844.311) -- 0:00:57
95000 -- (-842.387) [-844.098] (-846.356) (-843.546) * (-842.614) (-845.355) (-845.536) [-845.316] -- 0:00:57
Average standard deviation of split frequencies: 0.017459
95500 -- (-842.576) (-844.720) (-849.041) [-844.972] * (-843.589) [-843.441] (-844.136) (-843.650) -- 0:00:56
96000 -- (-846.285) (-844.944) (-849.073) [-844.723] * (-844.220) [-842.473] (-844.351) (-843.359) -- 0:00:56
96500 -- (-845.523) (-844.011) [-843.693] (-843.263) * (-846.791) (-842.609) [-843.422] (-843.720) -- 0:00:56
97000 -- (-842.486) (-843.342) (-842.251) [-844.474] * (-844.808) (-844.718) (-843.743) [-843.018] -- 0:00:55
97500 -- (-842.871) [-844.824] (-846.372) (-845.712) * [-844.224] (-845.932) (-843.974) (-843.989) -- 0:00:55
98000 -- (-843.953) [-844.544] (-845.961) (-843.780) * (-844.881) (-844.773) (-842.594) [-846.493] -- 0:00:55
98500 -- (-842.466) (-845.096) (-843.533) [-844.542] * (-843.968) (-844.202) (-844.632) [-843.116] -- 0:00:54
99000 -- (-844.746) (-844.061) (-843.987) [-846.009] * (-843.338) (-847.564) [-844.582] (-842.635) -- 0:00:54
99500 -- (-847.435) [-842.524] (-844.258) (-842.905) * (-843.473) (-843.249) (-843.541) [-843.279] -- 0:00:54
100000 -- (-848.864) (-842.413) (-844.890) [-842.825] * (-842.400) (-843.514) (-844.380) [-843.835] -- 0:00:54
Average standard deviation of split frequencies: 0.018471
100500 -- (-844.413) (-843.863) (-843.631) [-842.827] * [-844.334] (-844.536) (-842.326) (-847.267) -- 0:00:53
101000 -- (-848.413) [-842.855] (-843.934) (-845.565) * [-843.473] (-843.949) (-844.227) (-847.602) -- 0:00:53
101500 -- (-849.903) (-842.348) (-846.355) [-850.433] * [-846.112] (-845.384) (-845.714) (-842.968) -- 0:00:53
102000 -- (-848.298) [-842.530] (-844.962) (-843.055) * (-842.018) (-848.288) [-845.994] (-843.465) -- 0:00:52
102500 -- (-841.994) (-844.225) [-844.850] (-844.182) * [-842.020] (-847.131) (-844.671) (-843.837) -- 0:00:52
103000 -- (-843.849) (-843.509) (-842.118) [-849.861] * [-844.477] (-846.720) (-844.518) (-844.819) -- 0:00:52
103500 -- (-842.878) (-843.225) (-842.561) [-843.218] * [-844.916] (-844.969) (-845.259) (-843.103) -- 0:00:51
104000 -- (-844.323) (-843.723) (-846.349) [-846.825] * (-845.304) (-843.708) [-843.629] (-842.610) -- 0:00:51
104500 -- (-843.699) (-843.015) (-845.972) [-845.284] * (-849.877) [-843.119] (-844.583) (-844.243) -- 0:00:59
105000 -- (-844.122) (-843.677) [-845.165] (-846.483) * (-844.657) [-842.746] (-843.877) (-844.104) -- 0:00:59
Average standard deviation of split frequencies: 0.018456
105500 -- (-843.330) [-844.044] (-843.995) (-843.752) * (-843.033) (-843.495) (-844.014) [-844.178] -- 0:00:59
106000 -- (-845.018) [-844.723] (-844.802) (-843.707) * (-844.508) (-848.423) (-846.265) [-842.538] -- 0:00:59
106500 -- (-843.017) (-845.674) [-846.725] (-845.738) * [-842.864] (-842.920) (-842.359) (-843.887) -- 0:00:58
107000 -- (-842.706) [-845.861] (-844.651) (-847.489) * (-845.532) (-844.722) (-843.138) [-844.208] -- 0:00:58
107500 -- [-843.797] (-843.739) (-845.580) (-845.785) * (-842.814) (-844.441) [-842.547] (-845.857) -- 0:00:58
108000 -- (-845.534) [-843.619] (-844.212) (-842.958) * (-845.361) (-843.120) [-843.066] (-844.646) -- 0:00:57
108500 -- (-848.452) [-844.348] (-844.174) (-845.198) * (-842.738) [-843.421] (-842.389) (-842.852) -- 0:00:57
109000 -- (-849.527) (-850.267) [-842.886] (-844.456) * (-843.600) (-843.266) (-846.060) [-843.093] -- 0:00:57
109500 -- (-843.333) [-844.964] (-842.751) (-843.144) * (-843.254) (-843.210) [-843.298] (-845.052) -- 0:00:56
110000 -- [-843.165] (-845.835) (-843.327) (-842.775) * [-845.194] (-843.308) (-843.320) (-844.747) -- 0:00:56
Average standard deviation of split frequencies: 0.019056
110500 -- (-843.384) (-844.106) [-842.839] (-842.999) * (-847.071) (-845.763) [-844.193] (-845.312) -- 0:00:56
111000 -- (-842.844) [-842.561] (-844.806) (-844.197) * (-845.101) [-846.195] (-846.479) (-847.207) -- 0:00:56
111500 -- (-849.146) (-844.550) [-843.673] (-845.980) * (-843.277) [-845.033] (-842.323) (-845.250) -- 0:00:55
112000 -- (-842.584) [-848.717] (-842.272) (-842.081) * [-844.211] (-844.015) (-842.106) (-843.255) -- 0:00:55
112500 -- (-843.478) (-842.909) [-842.124] (-843.068) * (-847.260) (-845.049) (-843.775) [-845.513] -- 0:00:55
113000 -- (-844.276) [-843.376] (-843.109) (-842.158) * (-843.460) (-846.969) [-844.420] (-844.394) -- 0:00:54
113500 -- [-842.772] (-842.761) (-842.641) (-844.113) * (-842.688) (-846.685) (-843.984) [-842.361] -- 0:00:54
114000 -- (-843.537) [-842.369] (-843.294) (-846.200) * (-843.512) [-848.262] (-845.254) (-842.725) -- 0:00:54
114500 -- (-844.735) (-843.659) [-842.242] (-844.528) * [-844.951] (-843.534) (-844.410) (-843.196) -- 0:00:54
115000 -- (-843.558) (-843.849) [-843.867] (-845.438) * (-842.252) [-847.827] (-845.970) (-843.115) -- 0:00:53
Average standard deviation of split frequencies: 0.022803
115500 -- (-844.794) [-842.531] (-843.688) (-844.060) * [-843.084] (-845.362) (-844.223) (-848.729) -- 0:00:53
116000 -- (-842.014) (-845.320) (-844.553) [-844.192] * (-844.386) (-844.400) (-843.966) [-848.757] -- 0:00:53
116500 -- (-842.045) (-845.222) [-843.646] (-844.511) * (-844.422) (-844.160) (-843.929) [-843.805] -- 0:00:53
117000 -- (-847.672) (-844.448) (-843.839) [-844.242] * (-843.095) (-844.107) [-842.913] (-843.691) -- 0:00:52
117500 -- (-843.734) (-842.432) [-843.951] (-842.410) * (-846.310) (-843.925) [-843.067] (-842.830) -- 0:00:52
118000 -- [-842.654] (-843.049) (-843.163) (-843.383) * (-843.438) [-846.783] (-847.756) (-850.383) -- 0:00:52
118500 -- (-842.868) [-843.433] (-843.657) (-843.209) * (-844.240) (-843.593) (-846.150) [-844.056] -- 0:00:52
119000 -- [-843.210] (-843.749) (-843.028) (-845.384) * [-842.660] (-844.662) (-843.894) (-842.458) -- 0:00:51
119500 -- (-844.889) (-843.040) [-843.290] (-844.278) * (-851.918) (-843.097) (-846.258) [-842.880] -- 0:00:58
120000 -- (-846.655) (-844.157) (-842.507) [-843.149] * [-842.806] (-844.768) (-842.340) (-843.841) -- 0:00:58
Average standard deviation of split frequencies: 0.020356
120500 -- (-843.115) (-843.912) (-846.964) [-843.330] * (-842.834) (-842.091) (-842.909) [-844.937] -- 0:00:58
121000 -- (-842.785) (-843.453) (-844.447) [-843.788] * [-843.554] (-842.692) (-846.729) (-843.811) -- 0:00:58
121500 -- [-842.918] (-843.407) (-845.535) (-842.669) * (-848.252) (-844.244) [-844.605] (-841.897) -- 0:00:57
122000 -- (-845.889) (-842.350) (-848.073) [-845.880] * (-844.014) (-842.648) (-847.228) [-846.959] -- 0:00:57
122500 -- (-846.789) (-845.441) [-843.948] (-844.315) * (-843.055) (-844.820) (-842.599) [-842.900] -- 0:00:57
123000 -- (-847.851) (-843.756) [-846.725] (-844.230) * (-845.576) [-842.965] (-844.482) (-846.864) -- 0:00:57
123500 -- (-843.062) [-843.462] (-849.118) (-844.437) * (-842.918) [-845.989] (-844.062) (-847.648) -- 0:00:56
124000 -- [-844.465] (-844.191) (-844.083) (-843.392) * (-843.205) (-843.341) [-845.499] (-845.486) -- 0:00:56
124500 -- [-845.067] (-842.512) (-844.106) (-844.414) * (-845.106) (-843.976) (-844.292) [-842.991] -- 0:00:56
125000 -- [-843.662] (-843.711) (-843.091) (-845.123) * (-846.211) (-842.968) [-844.150] (-843.056) -- 0:00:56
Average standard deviation of split frequencies: 0.018903
125500 -- (-843.547) (-844.631) (-844.131) [-842.658] * (-846.394) (-843.178) (-844.523) [-843.626] -- 0:00:55
126000 -- (-842.952) [-843.912] (-843.210) (-848.586) * (-842.863) [-842.634] (-843.511) (-844.219) -- 0:00:55
126500 -- (-843.964) (-845.596) (-844.354) [-843.799] * [-842.265] (-843.553) (-843.909) (-843.557) -- 0:00:55
127000 -- [-844.936] (-842.482) (-842.657) (-843.129) * (-842.353) (-843.428) (-842.999) [-845.550] -- 0:00:54
127500 -- (-852.811) (-843.810) [-843.611] (-842.930) * [-844.424] (-842.952) (-843.074) (-843.984) -- 0:00:54
128000 -- (-849.788) (-844.080) [-844.074] (-844.384) * (-846.781) (-844.053) (-843.020) [-846.227] -- 0:00:54
128500 -- [-846.114] (-843.768) (-845.114) (-845.269) * (-847.355) (-845.490) (-845.640) [-842.591] -- 0:00:54
129000 -- (-843.164) (-843.043) (-843.427) [-845.057] * (-844.783) (-843.260) [-843.601] (-842.244) -- 0:00:54
129500 -- (-844.575) [-844.681] (-846.486) (-843.114) * [-848.743] (-843.865) (-844.938) (-843.140) -- 0:00:53
130000 -- [-842.855] (-846.580) (-845.681) (-843.271) * (-850.256) (-846.304) [-841.909] (-845.272) -- 0:00:53
Average standard deviation of split frequencies: 0.017137
130500 -- [-844.395] (-844.894) (-849.365) (-842.433) * (-846.443) (-843.083) [-842.756] (-845.272) -- 0:00:53
131000 -- (-853.066) (-843.675) (-845.493) [-844.147] * (-845.866) (-842.685) (-843.314) [-843.792] -- 0:00:53
131500 -- [-845.916] (-843.394) (-844.787) (-844.923) * (-848.069) (-848.086) [-843.417] (-844.982) -- 0:00:52
132000 -- [-844.250] (-842.693) (-844.283) (-843.374) * (-851.130) (-846.020) (-842.828) [-843.049] -- 0:00:52
132500 -- (-843.557) [-843.773] (-848.607) (-845.433) * (-843.090) [-846.276] (-843.156) (-842.978) -- 0:00:52
133000 -- (-843.729) (-843.124) (-844.216) [-844.224] * (-846.062) (-844.222) [-842.653] (-852.374) -- 0:00:52
133500 -- (-843.052) (-843.408) (-843.188) [-845.024] * [-843.811] (-843.428) (-842.532) (-849.451) -- 0:00:51
134000 -- (-843.721) (-841.998) (-845.650) [-844.677] * (-844.509) (-843.609) (-842.183) [-847.159] -- 0:00:51
134500 -- (-843.442) (-842.208) [-844.524] (-844.665) * (-844.109) (-845.369) [-842.558] (-845.139) -- 0:00:51
135000 -- (-845.421) (-847.264) [-843.553] (-846.318) * (-843.144) (-844.553) [-842.113] (-845.071) -- 0:00:51
Average standard deviation of split frequencies: 0.014959
135500 -- (-848.806) (-848.632) (-843.006) [-845.196] * (-847.477) (-844.600) (-842.324) [-846.151] -- 0:00:57
136000 -- [-843.751] (-845.349) (-846.817) (-845.309) * [-843.597] (-846.510) (-848.331) (-845.295) -- 0:00:57
136500 -- [-843.906] (-843.707) (-845.286) (-845.777) * (-847.943) (-846.669) [-844.677] (-844.084) -- 0:00:56
137000 -- (-845.403) (-844.629) (-846.048) [-844.956] * (-845.359) (-848.313) (-844.408) [-843.576] -- 0:00:56
137500 -- (-843.054) (-843.946) [-843.531] (-842.245) * (-845.165) [-842.600] (-844.080) (-846.308) -- 0:00:56
138000 -- (-846.568) (-844.183) (-843.567) [-842.609] * [-842.736] (-844.095) (-842.746) (-844.057) -- 0:00:56
138500 -- (-844.043) (-842.947) (-844.615) [-842.612] * (-842.506) [-845.293] (-843.852) (-843.821) -- 0:00:55
139000 -- (-845.413) [-843.520] (-842.508) (-842.391) * (-842.874) (-844.471) [-845.204] (-842.847) -- 0:00:55
139500 -- [-843.532] (-846.006) (-843.246) (-842.665) * (-849.036) [-842.656] (-845.622) (-844.010) -- 0:00:55
140000 -- [-842.148] (-844.643) (-843.411) (-843.722) * (-846.606) (-844.717) [-843.102] (-843.947) -- 0:00:55
Average standard deviation of split frequencies: 0.017939
140500 -- (-845.549) (-844.138) (-844.399) [-845.446] * (-846.300) (-842.758) [-843.307] (-844.884) -- 0:00:55
141000 -- (-844.508) [-844.728] (-845.352) (-842.863) * (-843.235) [-842.126] (-843.684) (-843.506) -- 0:00:54
141500 -- (-842.487) [-843.029] (-844.532) (-844.248) * [-843.380] (-841.885) (-846.170) (-845.998) -- 0:00:54
142000 -- [-842.776] (-842.660) (-844.141) (-847.442) * (-845.525) (-844.908) [-843.035] (-844.511) -- 0:00:54
142500 -- (-842.107) (-844.608) [-848.722] (-843.509) * (-846.082) (-842.026) (-842.737) [-845.898] -- 0:00:54
143000 -- (-843.498) [-846.576] (-843.436) (-846.172) * [-843.328] (-844.124) (-842.951) (-844.230) -- 0:00:53
143500 -- [-842.159] (-843.586) (-843.080) (-844.962) * (-843.436) (-843.319) [-843.186] (-844.495) -- 0:00:53
144000 -- (-843.957) [-842.120] (-843.719) (-846.310) * (-844.399) (-842.061) [-843.918] (-845.751) -- 0:00:53
144500 -- (-843.821) (-842.327) (-842.955) [-844.199] * [-845.209] (-844.848) (-847.563) (-844.798) -- 0:00:53
145000 -- (-845.484) (-846.485) [-844.908] (-842.712) * (-843.179) (-843.257) [-843.063] (-845.999) -- 0:00:53
Average standard deviation of split frequencies: 0.016323
145500 -- (-843.794) [-847.303] (-845.622) (-843.634) * (-844.850) (-842.891) [-844.587] (-844.933) -- 0:00:52
146000 -- [-845.508] (-851.342) (-845.702) (-845.829) * [-843.440] (-843.162) (-843.521) (-845.240) -- 0:00:52
146500 -- [-845.695] (-849.702) (-844.817) (-855.267) * (-848.714) (-844.607) [-844.643] (-845.344) -- 0:00:52
147000 -- (-843.953) [-843.780] (-844.654) (-847.832) * (-844.024) (-847.470) (-847.026) [-844.659] -- 0:00:52
147500 -- (-845.238) (-843.470) [-843.535] (-846.168) * (-845.966) [-843.879] (-845.237) (-844.462) -- 0:00:52
148000 -- (-845.394) [-844.258] (-842.191) (-843.563) * (-843.621) (-842.978) [-842.260] (-846.739) -- 0:00:51
148500 -- (-843.844) [-843.075] (-846.256) (-845.842) * (-841.895) (-848.978) (-842.673) [-845.992] -- 0:00:51
149000 -- [-843.823] (-844.064) (-842.941) (-844.066) * [-842.151] (-848.828) (-843.922) (-844.501) -- 0:00:51
149500 -- [-846.380] (-843.971) (-846.457) (-844.116) * (-842.117) (-848.466) (-845.775) [-843.651] -- 0:00:51
150000 -- (-844.718) [-842.850] (-844.970) (-845.300) * (-843.901) (-848.631) [-846.804] (-842.294) -- 0:00:51
Average standard deviation of split frequencies: 0.019877
150500 -- (-846.752) (-844.505) [-842.998] (-845.202) * (-842.494) (-843.803) [-845.997] (-844.246) -- 0:00:50
151000 -- (-846.822) (-847.655) [-843.492] (-844.404) * (-842.716) (-844.905) (-848.471) [-843.809] -- 0:00:50
151500 -- [-845.148] (-845.435) (-843.730) (-844.322) * (-845.644) (-844.360) (-842.715) [-843.631] -- 0:00:56
152000 -- (-844.616) (-844.481) (-843.793) [-844.878] * (-844.008) (-846.051) [-844.476] (-845.665) -- 0:00:55
152500 -- (-847.051) (-843.681) (-843.401) [-843.836] * [-843.914] (-844.155) (-843.614) (-846.704) -- 0:00:55
153000 -- (-847.501) (-843.707) [-844.105] (-843.676) * (-843.783) (-844.411) [-842.844] (-843.174) -- 0:00:55
153500 -- [-847.889] (-844.116) (-843.310) (-842.806) * (-845.448) (-842.568) [-844.220] (-843.072) -- 0:00:55
154000 -- (-843.558) [-843.028] (-842.213) (-844.242) * [-843.260] (-843.466) (-842.344) (-842.750) -- 0:00:54
154500 -- [-844.582] (-846.357) (-842.509) (-846.755) * (-846.773) (-844.056) [-844.105] (-848.770) -- 0:00:54
155000 -- [-847.007] (-843.913) (-842.419) (-845.141) * [-845.983] (-845.205) (-843.843) (-842.597) -- 0:00:54
Average standard deviation of split frequencies: 0.018664
155500 -- (-845.516) [-843.881] (-848.121) (-843.151) * [-842.617] (-844.980) (-844.567) (-844.554) -- 0:00:54
156000 -- (-848.752) [-842.789] (-842.286) (-842.086) * (-849.659) (-843.288) [-842.941] (-843.996) -- 0:00:54
156500 -- (-849.205) (-844.347) (-844.938) [-844.598] * [-842.067] (-843.778) (-844.646) (-849.879) -- 0:00:53
157000 -- (-846.445) (-843.194) (-845.302) [-843.113] * (-842.067) [-844.208] (-846.014) (-844.074) -- 0:00:53
157500 -- [-846.200] (-845.484) (-843.885) (-844.594) * [-845.461] (-842.184) (-843.330) (-842.061) -- 0:00:53
158000 -- (-843.998) [-843.724] (-846.067) (-843.460) * (-844.594) (-843.898) [-845.667] (-844.037) -- 0:00:53
158500 -- (-846.604) (-843.501) (-843.659) [-842.235] * (-845.743) [-843.701] (-845.761) (-843.892) -- 0:00:53
159000 -- (-843.253) [-844.950] (-843.480) (-845.000) * (-842.941) [-844.568] (-848.666) (-842.873) -- 0:00:52
159500 -- (-845.874) (-845.148) [-844.179] (-843.457) * (-841.890) (-846.524) (-846.907) [-845.234] -- 0:00:52
160000 -- (-845.413) [-843.107] (-845.795) (-845.451) * (-844.986) (-843.505) [-845.993] (-843.040) -- 0:00:52
Average standard deviation of split frequencies: 0.016215
160500 -- (-845.930) [-842.788] (-844.723) (-844.409) * (-847.317) [-843.420] (-843.230) (-848.723) -- 0:00:52
161000 -- [-844.961] (-845.196) (-843.973) (-845.954) * (-843.305) (-846.472) [-843.834] (-844.096) -- 0:00:52
161500 -- (-843.186) [-846.180] (-846.311) (-845.856) * (-842.086) [-845.313] (-843.126) (-844.682) -- 0:00:51
162000 -- (-842.656) (-848.842) [-847.353] (-847.779) * (-842.022) (-844.673) (-844.903) [-843.237] -- 0:00:51
162500 -- (-843.132) [-848.755] (-844.398) (-844.694) * (-843.365) [-845.149] (-845.693) (-843.742) -- 0:00:51
163000 -- (-843.501) [-843.381] (-847.513) (-844.380) * [-841.998] (-851.466) (-844.185) (-844.409) -- 0:00:51
163500 -- (-844.966) [-845.510] (-847.469) (-843.768) * (-844.292) (-845.131) [-844.210] (-844.054) -- 0:00:51
164000 -- (-850.075) (-844.012) [-843.127] (-847.778) * (-847.298) (-849.101) (-846.274) [-845.173] -- 0:00:50
164500 -- (-847.791) [-843.811] (-842.616) (-845.384) * [-842.892] (-842.718) (-847.370) (-846.310) -- 0:00:50
165000 -- (-846.855) [-842.540] (-842.104) (-845.144) * [-845.029] (-842.510) (-844.488) (-843.465) -- 0:00:50
Average standard deviation of split frequencies: 0.016441
165500 -- (-842.854) (-843.069) (-843.854) [-842.482] * (-844.715) (-842.117) (-843.361) [-843.221] -- 0:00:50
166000 -- (-844.126) (-844.447) (-843.291) [-842.578] * [-843.128] (-842.338) (-844.126) (-842.209) -- 0:00:50
166500 -- (-842.317) [-843.643] (-842.405) (-843.506) * (-847.793) (-845.207) (-843.718) [-843.007] -- 0:00:50
167000 -- (-842.244) [-845.272] (-842.971) (-842.819) * (-844.015) [-842.426] (-843.632) (-842.206) -- 0:00:49
167500 -- (-842.034) (-848.560) [-842.572] (-844.514) * [-843.942] (-843.226) (-844.757) (-842.388) -- 0:00:49
168000 -- (-842.237) (-846.967) (-843.423) [-842.905] * (-845.664) [-842.994] (-844.045) (-843.875) -- 0:00:54
168500 -- [-846.216] (-844.453) (-842.456) (-846.902) * [-844.869] (-842.838) (-844.260) (-845.201) -- 0:00:54
169000 -- (-845.512) (-842.978) (-842.264) [-845.322] * (-844.075) (-843.576) [-843.644] (-843.283) -- 0:00:54
169500 -- [-844.314] (-846.808) (-842.847) (-843.911) * (-846.931) (-843.838) [-843.093] (-842.605) -- 0:00:53
170000 -- [-844.283] (-847.119) (-842.669) (-842.742) * (-849.191) [-843.504] (-844.090) (-842.618) -- 0:00:53
Average standard deviation of split frequencies: 0.017800
170500 -- (-842.800) (-845.034) (-844.402) [-842.629] * (-847.718) (-844.594) (-843.665) [-845.820] -- 0:00:53
171000 -- [-844.660] (-851.794) (-843.025) (-844.629) * (-845.774) [-846.093] (-843.114) (-843.808) -- 0:00:53
171500 -- (-844.073) (-846.022) [-842.825] (-842.096) * [-847.250] (-847.604) (-846.957) (-844.153) -- 0:00:53
172000 -- (-844.777) [-843.753] (-843.130) (-842.325) * [-843.295] (-843.203) (-844.985) (-846.069) -- 0:00:52
172500 -- (-844.828) (-847.627) [-844.622] (-845.236) * (-843.631) [-846.716] (-843.412) (-843.665) -- 0:00:52
173000 -- (-843.070) [-844.442] (-845.156) (-844.362) * (-844.943) (-842.440) (-844.725) [-844.117] -- 0:00:52
173500 -- (-844.356) (-843.205) [-845.324] (-844.741) * (-843.265) (-842.610) (-846.793) [-843.479] -- 0:00:52
174000 -- (-845.069) (-843.241) [-843.980] (-843.750) * (-845.836) [-843.664] (-842.646) (-844.605) -- 0:00:52
174500 -- (-845.427) [-842.533] (-845.580) (-842.885) * (-845.778) [-845.932] (-844.011) (-844.156) -- 0:00:52
175000 -- [-843.487] (-841.999) (-848.078) (-843.766) * (-844.672) (-842.854) [-843.288] (-844.273) -- 0:00:51
Average standard deviation of split frequencies: 0.017112
175500 -- (-842.936) [-843.208] (-852.029) (-845.501) * (-846.982) [-844.386] (-843.434) (-845.686) -- 0:00:51
176000 -- (-843.031) (-843.194) (-847.738) [-845.829] * (-842.925) (-843.996) (-843.568) [-842.762] -- 0:00:51
176500 -- (-844.420) [-843.574] (-843.177) (-846.018) * (-845.670) (-845.582) [-842.492] (-844.974) -- 0:00:51
177000 -- (-844.332) (-841.886) [-843.204] (-844.591) * (-845.111) (-844.067) [-843.604] (-843.472) -- 0:00:51
177500 -- (-843.535) (-843.597) (-844.697) [-842.539] * (-844.910) (-844.629) [-842.317] (-845.139) -- 0:00:50
178000 -- (-842.913) (-844.210) [-842.339] (-842.539) * (-851.065) (-843.699) [-846.111] (-845.163) -- 0:00:50
178500 -- (-842.650) [-843.311] (-842.287) (-842.166) * (-851.038) (-844.712) (-843.754) [-844.245] -- 0:00:50
179000 -- (-843.361) (-846.572) (-841.908) [-844.444] * [-842.534] (-842.764) (-843.085) (-842.588) -- 0:00:50
179500 -- (-842.385) [-843.524] (-843.864) (-843.225) * (-843.945) (-846.879) (-842.292) [-842.622] -- 0:00:50
180000 -- [-843.296] (-848.024) (-844.776) (-845.796) * (-846.590) (-849.432) [-843.135] (-844.212) -- 0:00:50
Average standard deviation of split frequencies: 0.017250
180500 -- [-842.420] (-844.398) (-842.134) (-851.222) * [-843.985] (-843.808) (-842.318) (-843.510) -- 0:00:49
181000 -- [-842.291] (-846.188) (-841.898) (-845.045) * (-845.931) (-844.131) [-843.581] (-846.151) -- 0:00:49
181500 -- [-844.857] (-844.400) (-842.215) (-845.089) * (-846.052) (-849.366) [-844.305] (-843.787) -- 0:00:49
182000 -- [-843.156] (-845.483) (-842.359) (-845.458) * (-845.783) (-847.951) [-845.817] (-844.066) -- 0:00:49
182500 -- [-842.456] (-846.203) (-844.546) (-845.550) * (-843.011) (-848.208) (-846.480) [-842.448] -- 0:00:49
183000 -- [-842.983] (-844.657) (-845.622) (-847.699) * (-842.926) (-843.346) (-846.671) [-842.256] -- 0:00:49
183500 -- [-842.579] (-844.844) (-842.160) (-842.101) * [-846.491] (-842.668) (-846.538) (-843.617) -- 0:00:48
184000 -- (-842.634) (-853.045) (-843.739) [-843.043] * [-843.830] (-843.571) (-847.560) (-844.237) -- 0:00:48
184500 -- (-842.582) (-847.075) [-845.600] (-843.212) * (-844.350) (-844.071) (-845.819) [-844.078] -- 0:00:48
185000 -- (-842.541) (-846.941) [-846.560] (-843.211) * (-845.902) (-844.738) [-849.267] (-844.452) -- 0:00:52
Average standard deviation of split frequencies: 0.016333
185500 -- (-842.410) (-842.278) [-843.713] (-842.380) * (-845.401) (-843.691) (-847.915) [-846.884] -- 0:00:52
186000 -- (-843.058) [-843.535] (-843.649) (-847.839) * (-847.288) [-843.118] (-842.053) (-843.374) -- 0:00:52
186500 -- (-849.847) (-844.387) (-843.213) [-847.167] * [-842.620] (-842.535) (-843.369) (-842.231) -- 0:00:52
187000 -- (-842.623) (-843.336) [-843.180] (-847.496) * (-847.747) (-843.986) [-842.810] (-842.889) -- 0:00:52
187500 -- [-847.464] (-851.203) (-844.574) (-843.186) * [-842.792] (-843.363) (-847.276) (-843.436) -- 0:00:52
188000 -- (-842.807) (-847.672) [-846.886] (-843.619) * (-842.652) (-844.909) (-843.706) [-846.067] -- 0:00:51
188500 -- (-843.892) (-854.507) (-844.924) [-843.587] * (-842.186) (-848.861) [-842.848] (-845.637) -- 0:00:51
189000 -- (-841.880) (-844.465) [-843.840] (-844.245) * [-844.026] (-845.092) (-843.168) (-843.592) -- 0:00:51
189500 -- [-843.212] (-850.120) (-842.636) (-844.633) * (-844.072) (-846.519) [-843.332] (-845.268) -- 0:00:51
190000 -- (-843.814) (-844.733) [-843.788] (-844.191) * (-842.405) (-844.137) [-845.268] (-844.028) -- 0:00:51
Average standard deviation of split frequencies: 0.015225
190500 -- (-844.351) [-843.380] (-843.027) (-844.191) * (-844.554) (-845.870) [-843.245] (-844.760) -- 0:00:50
191000 -- (-847.931) (-844.994) (-843.658) [-843.885] * (-842.846) (-843.792) (-843.966) [-844.764] -- 0:00:50
191500 -- (-843.191) (-844.180) (-845.990) [-843.810] * (-846.079) [-846.589] (-843.848) (-843.042) -- 0:00:50
192000 -- (-847.281) (-845.237) (-843.947) [-843.211] * (-845.244) [-848.700] (-843.918) (-843.174) -- 0:00:50
192500 -- (-844.001) (-844.849) [-843.487] (-845.028) * (-844.452) (-844.407) [-845.120] (-842.554) -- 0:00:50
193000 -- [-844.075] (-845.868) (-843.548) (-850.574) * (-845.661) [-844.866] (-842.912) (-844.377) -- 0:00:50
193500 -- (-842.745) (-844.768) [-844.836] (-844.099) * (-842.770) [-847.865] (-843.514) (-844.380) -- 0:00:50
194000 -- (-843.619) (-845.491) [-846.145] (-842.446) * (-843.880) (-846.313) [-844.548] (-848.297) -- 0:00:49
194500 -- [-846.690] (-847.657) (-846.966) (-842.421) * (-847.631) [-844.928] (-842.849) (-844.857) -- 0:00:49
195000 -- (-848.347) (-845.995) [-846.288] (-842.170) * (-843.861) (-848.117) (-845.481) [-842.674] -- 0:00:49
Average standard deviation of split frequencies: 0.015901
195500 -- (-846.005) [-843.848] (-847.280) (-845.286) * [-844.529] (-850.430) (-847.047) (-842.301) -- 0:00:49
196000 -- (-843.796) [-843.467] (-847.149) (-842.287) * (-845.182) [-849.095] (-844.954) (-843.148) -- 0:00:49
196500 -- (-845.152) (-844.182) (-845.361) [-842.594] * [-843.807] (-843.642) (-847.412) (-842.910) -- 0:00:49
197000 -- (-845.654) (-843.879) (-848.196) [-842.409] * [-846.409] (-843.596) (-846.894) (-842.575) -- 0:00:48
197500 -- (-843.190) [-843.467] (-844.039) (-843.115) * [-845.764] (-843.652) (-842.275) (-843.306) -- 0:00:48
198000 -- (-844.571) [-844.048] (-842.433) (-845.105) * (-843.749) (-843.338) (-843.132) [-846.192] -- 0:00:48
198500 -- (-843.529) (-845.423) [-846.584] (-843.459) * (-843.211) (-844.150) [-843.580] (-847.276) -- 0:00:48
199000 -- (-850.491) [-848.399] (-845.476) (-844.887) * [-841.895] (-845.454) (-843.084) (-845.174) -- 0:00:48
199500 -- (-843.144) (-842.773) [-843.096] (-843.772) * (-843.184) (-845.019) (-845.319) [-846.715] -- 0:00:48
200000 -- (-844.947) (-843.024) (-845.075) [-843.300] * (-844.963) [-843.246] (-843.844) (-844.287) -- 0:00:48
Average standard deviation of split frequencies: 0.015710
200500 -- (-843.886) (-843.052) (-845.386) [-843.025] * (-843.431) [-843.916] (-843.082) (-844.610) -- 0:00:47
201000 -- (-845.017) (-843.457) [-844.183] (-843.805) * (-854.656) (-842.379) [-844.842] (-844.529) -- 0:00:51
201500 -- (-848.767) (-846.680) (-843.912) [-842.024] * (-849.064) (-841.770) [-844.039] (-844.689) -- 0:00:51
202000 -- [-842.023] (-846.746) (-845.683) (-842.479) * [-845.962] (-843.735) (-843.097) (-847.180) -- 0:00:51
202500 -- (-846.091) (-848.560) [-843.874] (-843.359) * [-848.280] (-843.228) (-845.133) (-847.521) -- 0:00:51
203000 -- (-844.195) (-848.436) [-845.078] (-847.560) * (-846.107) [-842.586] (-845.360) (-845.598) -- 0:00:51
203500 -- (-842.407) (-847.001) [-845.461] (-844.417) * (-845.943) [-843.374] (-846.150) (-846.739) -- 0:00:50
204000 -- [-843.452] (-846.201) (-844.490) (-841.899) * (-845.824) [-844.314] (-844.776) (-847.809) -- 0:00:50
204500 -- [-843.788] (-844.306) (-846.188) (-843.479) * [-842.849] (-844.464) (-845.823) (-847.985) -- 0:00:50
205000 -- (-845.844) (-843.974) [-848.670] (-843.252) * (-844.570) (-843.036) (-844.384) [-845.909] -- 0:00:50
Average standard deviation of split frequencies: 0.015346
205500 -- (-847.656) (-843.296) (-845.495) [-842.971] * (-845.968) (-844.935) [-843.919] (-843.526) -- 0:00:50
206000 -- [-842.881] (-843.935) (-843.563) (-844.605) * (-845.244) (-848.250) (-842.976) [-843.748] -- 0:00:50
206500 -- [-844.226] (-843.079) (-845.782) (-846.881) * (-843.274) (-843.750) [-846.240] (-843.929) -- 0:00:49
207000 -- (-845.590) (-843.603) [-844.209] (-851.070) * (-847.886) (-844.215) (-845.306) [-844.637] -- 0:00:49
207500 -- (-843.291) (-845.826) [-846.867] (-842.597) * [-843.158] (-843.629) (-844.515) (-844.493) -- 0:00:49
208000 -- (-843.211) [-842.818] (-845.812) (-844.874) * [-844.292] (-845.322) (-844.413) (-844.609) -- 0:00:49
208500 -- [-843.807] (-843.798) (-843.062) (-845.043) * [-847.252] (-842.423) (-843.771) (-844.875) -- 0:00:49
209000 -- (-843.899) [-843.351] (-842.400) (-843.573) * [-846.108] (-843.863) (-847.066) (-844.957) -- 0:00:49
209500 -- (-842.737) (-843.351) (-842.928) [-843.730] * (-843.479) [-843.048] (-843.651) (-844.647) -- 0:00:49
210000 -- (-848.104) (-845.631) [-843.776] (-845.692) * (-843.939) (-843.046) (-843.018) [-843.131] -- 0:00:48
Average standard deviation of split frequencies: 0.014296
210500 -- (-847.488) (-843.294) (-845.482) [-845.582] * (-843.305) (-842.386) (-844.402) [-842.155] -- 0:00:48
211000 -- (-845.576) [-843.237] (-844.567) (-844.168) * [-842.904] (-850.797) (-845.198) (-841.885) -- 0:00:48
211500 -- (-847.443) (-842.440) (-843.038) [-846.686] * (-843.858) (-847.758) (-842.878) [-845.902] -- 0:00:48
212000 -- [-843.485] (-842.800) (-842.809) (-843.989) * (-844.091) [-842.545] (-843.119) (-849.109) -- 0:00:48
212500 -- [-846.199] (-842.882) (-842.404) (-846.704) * (-843.705) (-842.799) (-844.313) [-843.598] -- 0:00:48
213000 -- [-844.399] (-842.422) (-842.691) (-846.056) * (-843.588) [-842.499] (-844.243) (-846.893) -- 0:00:48
213500 -- (-843.097) (-842.369) [-842.677] (-845.340) * (-846.189) (-842.967) (-846.498) [-846.099] -- 0:00:47
214000 -- [-848.705] (-842.959) (-843.081) (-846.371) * (-848.278) [-841.753] (-845.449) (-843.138) -- 0:00:47
214500 -- (-845.250) (-844.605) [-843.279] (-846.615) * [-842.753] (-843.568) (-842.420) (-841.845) -- 0:00:47
215000 -- [-845.328] (-843.465) (-843.463) (-844.721) * [-843.592] (-844.961) (-843.214) (-843.305) -- 0:00:47
Average standard deviation of split frequencies: 0.014186
215500 -- (-845.308) [-843.520] (-842.948) (-844.495) * (-844.379) (-845.880) (-845.642) [-847.134] -- 0:00:47
216000 -- (-845.099) (-846.583) [-843.930] (-845.559) * (-842.373) (-850.796) [-842.520] (-844.944) -- 0:00:47
216500 -- [-843.131] (-844.311) (-844.393) (-845.040) * (-843.244) (-850.695) (-842.671) [-844.249] -- 0:00:47
217000 -- [-843.175] (-843.611) (-843.458) (-848.013) * (-842.972) (-845.613) (-844.110) [-842.722] -- 0:00:46
217500 -- [-847.163] (-842.673) (-841.977) (-842.292) * (-844.119) (-844.557) [-842.785] (-844.256) -- 0:00:50
218000 -- (-842.580) (-843.711) [-843.244] (-843.492) * (-845.860) (-844.086) [-844.152] (-844.632) -- 0:00:50
218500 -- (-845.667) (-843.213) (-844.930) [-848.804] * [-849.439] (-845.138) (-844.685) (-848.665) -- 0:00:50
219000 -- (-841.997) [-842.117] (-848.341) (-845.751) * (-846.700) [-843.053] (-844.337) (-851.201) -- 0:00:49
219500 -- (-846.180) (-842.896) [-844.399] (-844.666) * (-843.157) (-848.158) (-843.593) [-843.681] -- 0:00:49
220000 -- [-844.764] (-843.239) (-847.849) (-842.972) * [-843.057] (-846.612) (-846.821) (-842.573) -- 0:00:49
Average standard deviation of split frequencies: 0.013055
220500 -- [-844.114] (-842.634) (-855.939) (-842.216) * (-843.646) (-844.986) (-844.262) [-842.088] -- 0:00:49
221000 -- (-844.163) (-844.447) [-844.849] (-844.138) * (-843.950) (-844.090) [-843.653] (-844.477) -- 0:00:49
221500 -- (-849.563) (-844.608) [-843.312] (-844.072) * (-849.044) [-846.667] (-843.429) (-844.179) -- 0:00:49
222000 -- (-843.140) (-843.857) [-844.353] (-847.409) * [-844.497] (-845.825) (-844.115) (-848.899) -- 0:00:49
222500 -- (-844.764) (-845.211) (-844.979) [-842.369] * (-843.600) (-842.360) [-844.080] (-849.226) -- 0:00:48
223000 -- (-845.051) (-845.025) [-844.939] (-843.695) * (-843.896) (-842.441) [-845.276] (-850.664) -- 0:00:48
223500 -- (-842.948) (-846.686) [-844.439] (-842.383) * [-845.102] (-842.580) (-847.239) (-850.191) -- 0:00:48
224000 -- (-849.319) (-846.422) [-843.286] (-842.686) * (-845.233) (-844.818) [-844.817] (-845.644) -- 0:00:48
224500 -- (-845.242) (-842.108) (-842.074) [-845.264] * (-844.789) [-844.412] (-844.692) (-847.466) -- 0:00:48
225000 -- (-843.207) [-842.345] (-842.781) (-843.035) * (-846.009) (-843.343) (-843.729) [-842.259] -- 0:00:48
Average standard deviation of split frequencies: 0.012515
225500 -- [-845.026] (-843.422) (-842.918) (-843.217) * (-843.163) (-843.950) (-847.008) [-842.259] -- 0:00:48
226000 -- (-843.436) (-844.407) [-844.285] (-845.508) * [-847.912] (-843.185) (-843.520) (-842.299) -- 0:00:47
226500 -- (-847.453) (-846.402) [-844.246] (-846.122) * (-844.385) (-842.434) (-848.220) [-844.953] -- 0:00:47
227000 -- (-850.851) (-842.311) [-843.955] (-845.874) * (-842.641) [-842.283] (-843.770) (-844.803) -- 0:00:47
227500 -- (-842.425) [-842.323] (-851.187) (-846.714) * (-845.801) (-843.076) (-843.815) [-846.281] -- 0:00:47
228000 -- [-843.360] (-843.867) (-843.490) (-844.627) * (-845.507) (-843.705) (-845.466) [-845.011] -- 0:00:47
228500 -- (-843.902) (-842.016) [-843.134] (-849.054) * (-848.184) (-844.717) [-845.093] (-843.456) -- 0:00:47
229000 -- [-844.500] (-847.683) (-843.276) (-844.378) * (-845.444) (-844.569) [-844.715] (-846.331) -- 0:00:47
229500 -- [-843.758] (-844.407) (-842.760) (-844.072) * (-848.151) (-847.508) [-842.987] (-843.190) -- 0:00:47
230000 -- (-846.402) [-842.208] (-844.336) (-846.104) * (-845.795) (-842.906) [-843.930] (-845.150) -- 0:00:46
Average standard deviation of split frequencies: 0.013738
230500 -- [-844.529] (-843.044) (-844.348) (-844.517) * (-844.329) (-846.690) (-844.790) [-843.906] -- 0:00:46
231000 -- (-844.166) [-843.244] (-844.265) (-847.223) * (-846.831) (-846.057) (-843.358) [-842.987] -- 0:00:46
231500 -- [-845.526] (-849.859) (-845.688) (-846.348) * [-843.036] (-846.798) (-842.109) (-849.577) -- 0:00:46
232000 -- (-848.156) (-845.640) [-846.956] (-845.317) * [-843.318] (-844.618) (-842.341) (-844.987) -- 0:00:46
232500 -- (-844.051) [-843.136] (-847.998) (-846.564) * (-843.291) (-845.664) [-845.004] (-844.545) -- 0:00:46
233000 -- [-842.502] (-844.442) (-846.584) (-851.740) * (-843.992) [-845.350] (-842.863) (-843.229) -- 0:00:46
233500 -- (-849.749) [-843.694] (-846.648) (-847.318) * (-842.673) (-850.508) (-842.673) [-842.971] -- 0:00:49
234000 -- (-847.639) [-843.883] (-847.645) (-845.921) * [-843.282] (-850.629) (-843.013) (-843.070) -- 0:00:49
234500 -- (-844.165) (-843.714) [-846.695] (-842.694) * (-842.259) (-848.227) [-842.374] (-845.068) -- 0:00:48
235000 -- (-842.123) (-844.691) (-845.189) [-842.130] * (-843.245) [-844.799] (-846.228) (-843.998) -- 0:00:48
Average standard deviation of split frequencies: 0.014537
235500 -- (-842.833) (-843.666) (-843.915) [-844.286] * (-843.579) (-842.865) (-843.653) [-845.356] -- 0:00:48
236000 -- [-841.820] (-844.115) (-843.914) (-842.766) * (-843.986) (-844.406) [-846.751] (-843.556) -- 0:00:48
236500 -- (-843.005) [-847.929] (-845.379) (-848.076) * (-843.976) [-844.157] (-847.497) (-843.334) -- 0:00:48
237000 -- (-843.512) (-845.613) [-845.605] (-848.408) * (-843.734) [-844.418] (-843.845) (-843.965) -- 0:00:48
237500 -- (-844.385) (-846.575) (-844.923) [-846.445] * (-843.285) (-842.429) (-848.168) [-843.142] -- 0:00:48
238000 -- (-846.581) (-842.325) [-842.932] (-848.882) * (-844.721) (-849.939) (-844.038) [-843.781] -- 0:00:48
238500 -- (-847.513) (-842.261) (-843.397) [-842.752] * (-849.430) [-843.560] (-846.807) (-843.194) -- 0:00:47
239000 -- (-845.432) (-842.314) [-843.623] (-842.317) * (-844.309) (-843.042) [-845.175] (-846.695) -- 0:00:47
239500 -- (-843.433) (-844.515) (-843.455) [-843.038] * (-846.361) (-845.607) (-843.366) [-845.504] -- 0:00:47
240000 -- (-847.785) (-844.404) (-844.395) [-843.148] * (-844.791) (-842.727) [-845.941] (-843.611) -- 0:00:47
Average standard deviation of split frequencies: 0.015440
240500 -- (-843.830) (-845.779) [-844.218] (-844.312) * [-843.112] (-845.250) (-845.846) (-844.581) -- 0:00:47
241000 -- (-845.779) (-843.610) [-842.318] (-842.716) * [-843.290] (-847.752) (-844.599) (-845.571) -- 0:00:47
241500 -- [-851.906] (-844.073) (-848.839) (-849.375) * (-843.240) (-844.477) (-844.633) [-843.529] -- 0:00:47
242000 -- (-848.560) [-844.486] (-845.542) (-849.797) * (-844.169) [-844.689] (-844.849) (-843.733) -- 0:00:46
242500 -- [-843.002] (-845.644) (-844.839) (-846.919) * (-842.662) (-843.250) [-842.292] (-846.322) -- 0:00:46
243000 -- (-842.820) (-845.391) [-845.562] (-846.331) * (-846.131) (-842.953) [-842.284] (-843.339) -- 0:00:46
243500 -- (-844.471) (-846.057) [-845.575] (-846.364) * [-843.087] (-845.887) (-842.286) (-842.548) -- 0:00:46
244000 -- (-847.229) (-846.316) [-846.380] (-843.793) * [-846.492] (-841.826) (-843.774) (-843.778) -- 0:00:46
244500 -- [-844.698] (-851.839) (-844.925) (-843.767) * [-844.344] (-842.218) (-843.877) (-843.479) -- 0:00:46
245000 -- [-842.901] (-849.342) (-847.279) (-846.278) * [-842.945] (-843.200) (-845.833) (-842.591) -- 0:00:46
Average standard deviation of split frequencies: 0.017034
245500 -- [-845.047] (-844.823) (-844.891) (-845.938) * [-844.875] (-842.230) (-846.698) (-844.465) -- 0:00:46
246000 -- (-843.380) [-842.416] (-845.207) (-844.278) * (-845.242) (-844.751) [-843.090] (-843.496) -- 0:00:45
246500 -- [-845.574] (-842.285) (-846.029) (-843.748) * (-842.938) [-842.260] (-843.088) (-844.350) -- 0:00:45
247000 -- (-843.997) (-844.196) [-843.299] (-842.720) * (-845.518) (-843.773) (-844.847) [-843.088] -- 0:00:45
247500 -- (-844.477) (-843.050) [-847.873] (-844.835) * (-846.240) [-842.124] (-845.394) (-846.122) -- 0:00:45
248000 -- [-845.922] (-844.149) (-849.730) (-845.905) * (-844.170) (-842.617) (-845.069) [-846.608] -- 0:00:45
248500 -- (-843.073) (-844.224) (-845.522) [-846.599] * (-843.273) (-841.953) (-844.190) [-842.945] -- 0:00:45
249000 -- (-843.241) (-847.188) (-845.344) [-843.136] * [-847.046] (-844.629) (-842.052) (-842.881) -- 0:00:45
249500 -- (-842.057) (-845.714) [-843.318] (-843.406) * (-843.994) (-848.534) [-842.212] (-843.377) -- 0:00:45
250000 -- (-843.200) (-846.503) [-844.136] (-845.743) * [-843.447] (-844.361) (-842.121) (-842.993) -- 0:00:48
Average standard deviation of split frequencies: 0.016716
250500 -- (-842.017) (-848.672) (-842.952) [-845.636] * (-842.167) (-846.135) [-845.301] (-842.642) -- 0:00:47
251000 -- (-846.049) [-845.750] (-844.275) (-845.054) * (-842.109) (-845.285) (-845.988) [-843.617] -- 0:00:47
251500 -- (-846.095) (-846.212) [-844.154] (-844.593) * [-842.355] (-842.848) (-843.514) (-843.797) -- 0:00:47
252000 -- (-843.605) (-846.312) (-843.581) [-843.287] * (-843.460) (-846.637) (-843.865) [-843.553] -- 0:00:47
252500 -- (-847.384) (-842.801) (-844.140) [-842.324] * (-844.892) [-846.088] (-843.836) (-842.787) -- 0:00:47
253000 -- (-844.668) (-849.065) (-845.039) [-844.443] * (-842.560) (-842.668) (-845.575) [-843.294] -- 0:00:47
253500 -- (-844.354) (-852.198) (-846.280) [-843.250] * (-845.388) (-843.922) (-843.731) [-843.092] -- 0:00:47
254000 -- (-844.412) (-855.541) (-845.340) [-842.480] * (-843.736) (-844.722) (-844.705) [-843.543] -- 0:00:46
254500 -- [-842.478] (-844.512) (-843.920) (-842.403) * (-843.444) (-843.706) (-844.069) [-842.954] -- 0:00:46
255000 -- [-843.281] (-844.693) (-842.871) (-845.465) * (-845.111) [-844.929] (-844.602) (-842.883) -- 0:00:46
Average standard deviation of split frequencies: 0.016368
255500 -- [-845.386] (-842.636) (-842.850) (-846.656) * (-844.476) [-842.188] (-845.309) (-845.089) -- 0:00:46
256000 -- [-848.349] (-846.490) (-845.050) (-845.974) * (-843.179) (-847.510) (-845.888) [-842.847] -- 0:00:46
256500 -- (-844.750) (-846.423) [-843.463] (-843.746) * (-843.507) (-848.857) (-843.132) [-844.330] -- 0:00:46
257000 -- (-842.110) [-842.403] (-844.599) (-846.209) * (-843.312) (-846.554) (-842.588) [-846.289] -- 0:00:46
257500 -- (-842.236) (-846.015) (-843.117) [-844.707] * (-843.071) (-844.471) (-842.988) [-844.848] -- 0:00:46
258000 -- [-849.182] (-845.879) (-842.956) (-845.876) * [-844.959] (-843.408) (-842.932) (-844.033) -- 0:00:46
258500 -- (-846.290) (-842.434) [-842.221] (-845.622) * (-843.904) (-842.582) (-842.776) [-842.999] -- 0:00:45
259000 -- (-843.662) [-846.695] (-842.936) (-844.760) * [-845.934] (-844.770) (-843.066) (-843.272) -- 0:00:45
259500 -- [-843.289] (-848.430) (-844.800) (-844.229) * (-844.447) (-843.697) (-842.696) [-843.876] -- 0:00:45
260000 -- (-843.113) [-847.872] (-844.853) (-844.095) * [-842.562] (-842.250) (-843.191) (-843.433) -- 0:00:45
Average standard deviation of split frequencies: 0.017553
260500 -- (-845.010) [-843.270] (-845.070) (-845.514) * [-842.119] (-841.961) (-842.181) (-842.918) -- 0:00:45
261000 -- (-843.328) [-843.954] (-843.520) (-843.026) * (-843.159) (-844.835) (-846.910) [-845.197] -- 0:00:45
261500 -- (-842.734) [-842.896] (-842.648) (-842.260) * (-843.005) (-845.538) [-843.967] (-845.222) -- 0:00:45
262000 -- (-846.091) [-843.212] (-842.190) (-842.317) * (-842.969) [-844.345] (-842.897) (-843.894) -- 0:00:45
262500 -- (-844.697) (-845.174) [-844.006] (-842.693) * [-843.309] (-842.646) (-846.285) (-842.640) -- 0:00:44
263000 -- (-843.407) (-846.467) [-842.310] (-842.958) * (-842.678) (-842.152) [-846.057] (-844.294) -- 0:00:44
263500 -- (-843.050) [-845.480] (-845.033) (-842.111) * (-845.969) (-842.707) [-845.897] (-844.017) -- 0:00:44
264000 -- (-842.456) (-844.561) [-843.328] (-843.394) * [-845.288] (-842.811) (-843.629) (-844.060) -- 0:00:44
264500 -- (-843.626) (-843.408) [-845.597] (-843.566) * (-846.457) (-843.402) (-844.570) [-844.283] -- 0:00:44
265000 -- [-844.774] (-842.544) (-846.449) (-843.492) * [-844.250] (-844.663) (-842.929) (-843.593) -- 0:00:44
Average standard deviation of split frequencies: 0.016575
265500 -- [-842.969] (-842.970) (-848.712) (-843.957) * (-844.341) (-845.026) [-842.849] (-844.068) -- 0:00:44
266000 -- (-843.341) (-842.779) [-843.027] (-843.435) * (-843.531) [-845.628] (-843.240) (-845.774) -- 0:00:46
266500 -- (-842.092) (-842.950) [-843.582] (-842.445) * (-844.488) (-844.315) [-844.137] (-844.253) -- 0:00:46
267000 -- (-846.854) [-844.765] (-842.917) (-845.654) * [-841.916] (-843.667) (-842.925) (-842.534) -- 0:00:46
267500 -- (-842.510) (-849.766) [-843.958] (-845.491) * (-843.759) [-841.791] (-845.038) (-843.207) -- 0:00:46
268000 -- (-844.052) (-848.049) (-842.247) [-845.085] * (-844.836) (-846.429) (-843.339) [-842.769] -- 0:00:46
268500 -- (-844.957) (-849.469) [-842.570] (-845.150) * (-846.479) [-842.984] (-842.416) (-842.950) -- 0:00:46
269000 -- (-844.376) (-847.115) [-842.950] (-843.348) * (-843.740) (-844.510) (-852.753) [-844.877] -- 0:00:46
269500 -- (-844.365) (-846.300) [-843.839] (-848.694) * [-844.763] (-851.837) (-854.460) (-850.758) -- 0:00:46
270000 -- (-846.375) (-850.088) (-843.295) [-842.147] * [-843.630] (-847.377) (-845.835) (-851.221) -- 0:00:45
Average standard deviation of split frequencies: 0.017007
270500 -- (-842.452) (-844.855) (-843.042) [-842.701] * (-842.590) (-843.432) [-845.468] (-845.497) -- 0:00:45
271000 -- (-844.045) (-844.314) (-843.789) [-846.265] * [-844.479] (-844.763) (-843.773) (-846.150) -- 0:00:45
271500 -- [-847.480] (-845.244) (-845.105) (-845.113) * (-844.860) (-843.709) (-845.469) [-844.366] -- 0:00:45
272000 -- (-843.870) (-843.389) [-845.635] (-849.726) * (-842.918) [-843.419] (-844.292) (-844.202) -- 0:00:45
272500 -- (-845.899) (-843.811) [-843.809] (-843.971) * [-842.285] (-844.822) (-843.411) (-844.564) -- 0:00:45
273000 -- (-843.270) [-842.263] (-844.819) (-844.380) * [-845.393] (-845.323) (-844.781) (-842.787) -- 0:00:45
273500 -- (-850.090) [-843.088] (-844.360) (-843.895) * (-842.442) [-843.122] (-842.579) (-845.322) -- 0:00:45
274000 -- (-842.124) (-842.805) [-846.214] (-843.546) * (-847.617) [-842.701] (-842.671) (-842.391) -- 0:00:45
274500 -- (-843.671) [-843.558] (-847.297) (-842.957) * (-843.628) (-842.477) [-845.785] (-843.210) -- 0:00:44
275000 -- (-843.863) [-843.112] (-850.400) (-842.922) * (-844.259) (-844.603) [-842.097] (-845.929) -- 0:00:44
Average standard deviation of split frequencies: 0.016578
275500 -- (-845.153) (-846.334) [-843.174] (-844.609) * (-845.169) [-842.547] (-846.645) (-844.229) -- 0:00:44
276000 -- (-845.244) (-842.956) [-843.442] (-842.093) * (-842.766) [-843.898] (-845.136) (-845.120) -- 0:00:44
276500 -- (-843.211) (-844.981) (-844.047) [-842.434] * (-844.564) (-845.824) [-844.761] (-842.628) -- 0:00:44
277000 -- (-842.488) (-850.132) (-845.228) [-841.852] * (-846.857) (-843.053) [-843.170] (-844.784) -- 0:00:44
277500 -- (-844.612) (-844.697) (-847.179) [-843.422] * [-843.794] (-842.723) (-844.233) (-846.878) -- 0:00:44
278000 -- (-845.661) (-850.510) (-844.386) [-843.264] * (-844.976) (-842.583) [-844.860] (-843.801) -- 0:00:44
278500 -- [-845.496] (-851.514) (-844.264) (-844.589) * (-843.257) [-843.621] (-845.889) (-843.579) -- 0:00:44
279000 -- (-843.422) (-854.389) (-842.152) [-845.090] * (-845.976) (-849.118) (-842.980) [-843.071] -- 0:00:43
279500 -- (-843.326) (-849.332) [-845.417] (-844.261) * (-845.643) [-845.108] (-843.594) (-844.396) -- 0:00:43
280000 -- (-845.091) [-844.224] (-846.351) (-842.289) * (-846.039) (-843.030) (-845.022) [-845.862] -- 0:00:43
Average standard deviation of split frequencies: 0.016796
280500 -- (-842.597) (-844.419) (-842.962) [-842.100] * [-843.861] (-842.622) (-843.625) (-842.542) -- 0:00:43
281000 -- [-846.986] (-842.348) (-842.768) (-845.734) * [-842.600] (-843.741) (-845.527) (-843.619) -- 0:00:43
281500 -- (-843.233) (-843.272) (-843.693) [-843.145] * (-844.908) (-844.277) [-842.742] (-842.851) -- 0:00:43
282000 -- (-843.786) [-846.856] (-843.897) (-845.390) * [-843.129] (-843.467) (-843.152) (-844.664) -- 0:00:43
282500 -- (-845.094) (-843.129) (-845.186) [-845.548] * (-848.762) (-843.556) [-843.373] (-842.362) -- 0:00:45
283000 -- (-844.879) [-842.348] (-844.902) (-844.625) * [-844.282] (-843.728) (-845.520) (-843.013) -- 0:00:45
283500 -- (-843.566) (-844.734) (-844.210) [-843.705] * (-842.455) (-847.200) (-846.953) [-847.753] -- 0:00:45
284000 -- (-844.369) (-847.314) (-844.525) [-843.783] * (-844.562) (-846.098) (-843.383) [-849.715] -- 0:00:45
284500 -- (-844.199) [-845.004] (-844.486) (-845.243) * (-846.284) (-844.574) [-842.401] (-844.908) -- 0:00:45
285000 -- (-843.687) (-846.854) [-845.274] (-843.322) * (-844.857) [-842.973] (-842.567) (-845.248) -- 0:00:45
Average standard deviation of split frequencies: 0.015842
285500 -- [-844.057] (-844.426) (-842.749) (-843.152) * [-842.627] (-842.834) (-846.092) (-844.315) -- 0:00:45
286000 -- [-845.014] (-843.154) (-842.459) (-843.323) * (-842.718) (-842.479) (-846.770) [-843.351] -- 0:00:44
286500 -- (-845.268) [-845.461] (-842.425) (-847.002) * (-842.729) [-845.426] (-843.650) (-843.528) -- 0:00:44
287000 -- (-848.641) [-844.797] (-842.486) (-844.825) * [-843.436] (-844.616) (-842.768) (-844.710) -- 0:00:44
287500 -- (-845.226) (-843.402) (-843.768) [-844.692] * (-843.631) (-844.934) (-842.983) [-844.819] -- 0:00:44
288000 -- [-844.848] (-844.432) (-844.039) (-847.030) * [-844.004] (-845.656) (-846.052) (-847.320) -- 0:00:44
288500 -- (-843.000) [-844.029] (-845.223) (-843.279) * (-843.925) [-843.781] (-846.305) (-848.263) -- 0:00:44
289000 -- (-843.604) (-843.453) (-849.002) [-843.766] * (-845.227) (-842.804) (-845.025) [-843.441] -- 0:00:44
289500 -- [-842.473] (-844.028) (-846.829) (-844.244) * [-842.965] (-843.621) (-842.841) (-846.366) -- 0:00:44
290000 -- (-846.029) [-844.110] (-846.980) (-847.434) * [-845.612] (-844.122) (-845.615) (-844.750) -- 0:00:44
Average standard deviation of split frequencies: 0.015227
290500 -- (-851.053) (-846.293) [-844.089] (-844.334) * (-846.630) (-851.113) [-844.888] (-844.964) -- 0:00:43
291000 -- (-845.745) [-843.916] (-843.769) (-844.909) * [-843.483] (-848.083) (-843.543) (-844.671) -- 0:00:43
291500 -- [-846.087] (-845.632) (-843.209) (-845.018) * (-842.011) (-846.120) [-845.447] (-844.305) -- 0:00:43
292000 -- [-844.289] (-846.207) (-846.359) (-845.379) * (-849.731) (-842.630) (-843.820) [-842.644] -- 0:00:43
292500 -- (-845.233) (-843.505) [-845.074] (-846.479) * [-845.928] (-842.776) (-846.038) (-846.028) -- 0:00:43
293000 -- (-843.940) (-844.160) (-845.129) [-844.013] * (-841.967) [-844.293] (-842.450) (-843.605) -- 0:00:43
293500 -- (-843.343) [-844.237] (-842.874) (-845.245) * [-843.307] (-844.457) (-848.077) (-844.322) -- 0:00:43
294000 -- (-844.782) [-843.324] (-842.444) (-844.318) * [-845.840] (-844.633) (-842.891) (-845.165) -- 0:00:43
294500 -- (-846.150) [-844.060] (-844.134) (-847.061) * (-844.858) (-845.093) (-845.123) [-845.863] -- 0:00:43
295000 -- [-843.091] (-842.786) (-841.980) (-843.777) * [-843.330] (-844.938) (-846.187) (-844.877) -- 0:00:43
Average standard deviation of split frequencies: 0.014068
295500 -- [-842.596] (-844.975) (-844.895) (-843.448) * (-844.832) (-842.348) (-845.531) [-843.116] -- 0:00:42
296000 -- (-843.535) [-844.012] (-844.190) (-845.946) * (-845.683) (-842.401) [-845.187] (-843.768) -- 0:00:42
296500 -- (-847.524) (-844.041) [-842.697] (-845.017) * (-846.752) (-842.565) [-843.407] (-844.213) -- 0:00:42
297000 -- (-847.114) (-845.101) (-845.096) [-846.068] * [-846.861] (-844.456) (-843.444) (-846.813) -- 0:00:42
297500 -- [-845.189] (-843.558) (-843.411) (-842.865) * (-844.920) [-845.040] (-845.705) (-844.283) -- 0:00:42
298000 -- (-846.613) (-843.043) (-843.500) [-841.965] * [-846.438] (-842.792) (-846.404) (-844.494) -- 0:00:42
298500 -- (-845.071) [-843.641] (-845.923) (-842.581) * [-845.549] (-842.336) (-843.405) (-844.243) -- 0:00:42
299000 -- (-842.604) (-844.341) (-843.258) [-843.104] * (-845.802) [-842.935] (-843.699) (-844.507) -- 0:00:44
299500 -- (-842.644) [-844.672] (-843.963) (-844.445) * (-845.677) (-846.454) [-843.686] (-844.150) -- 0:00:44
300000 -- (-844.078) (-845.584) [-843.232] (-844.886) * [-844.723] (-849.524) (-844.684) (-852.585) -- 0:00:44
Average standard deviation of split frequencies: 0.013926
300500 -- [-842.775] (-845.517) (-842.838) (-843.029) * (-843.809) [-844.355] (-844.213) (-846.159) -- 0:00:44
301000 -- (-845.467) [-842.190] (-842.385) (-846.571) * (-844.726) (-844.883) (-843.262) [-845.436] -- 0:00:44
301500 -- (-843.561) (-842.935) [-843.542] (-846.085) * (-844.929) [-845.058] (-842.832) (-847.446) -- 0:00:44
302000 -- (-848.497) [-842.979] (-844.851) (-846.061) * (-846.884) [-844.731] (-843.790) (-847.535) -- 0:00:43
302500 -- [-843.141] (-843.305) (-842.893) (-849.438) * (-845.115) (-845.842) [-843.271] (-847.972) -- 0:00:43
303000 -- (-842.953) (-845.343) (-844.793) [-846.050] * [-843.478] (-845.231) (-848.447) (-848.181) -- 0:00:43
303500 -- (-844.230) (-844.728) (-846.352) [-845.234] * [-849.266] (-844.243) (-847.189) (-843.919) -- 0:00:43
304000 -- [-844.363] (-844.806) (-844.110) (-844.225) * (-843.951) [-846.222] (-843.290) (-844.543) -- 0:00:43
304500 -- [-844.357] (-846.339) (-844.672) (-842.993) * [-843.459] (-845.608) (-842.480) (-847.202) -- 0:00:43
305000 -- (-844.544) (-846.251) (-844.544) [-845.239] * (-842.557) (-844.062) [-842.360] (-844.266) -- 0:00:43
Average standard deviation of split frequencies: 0.014952
305500 -- [-845.082] (-845.773) (-847.777) (-844.568) * (-845.179) (-844.907) (-846.032) [-845.125] -- 0:00:43
306000 -- (-847.425) (-843.674) [-845.682] (-846.481) * (-844.617) (-842.983) [-846.465] (-843.936) -- 0:00:43
306500 -- (-844.164) [-843.345] (-847.155) (-849.227) * [-844.282] (-843.440) (-843.996) (-843.512) -- 0:00:42
307000 -- (-843.416) [-843.484] (-845.976) (-843.666) * [-843.504] (-847.150) (-844.102) (-842.248) -- 0:00:42
307500 -- (-842.405) (-845.631) (-843.586) [-846.341] * (-842.236) (-842.053) (-842.551) [-843.909] -- 0:00:42
308000 -- (-844.787) [-845.070] (-848.798) (-844.618) * (-842.796) (-842.732) (-844.245) [-842.747] -- 0:00:42
308500 -- [-845.527] (-848.043) (-843.260) (-844.704) * [-845.697] (-843.364) (-844.287) (-845.399) -- 0:00:42
309000 -- (-847.866) (-845.821) [-842.948] (-843.040) * (-845.587) (-845.958) (-843.270) [-846.371] -- 0:00:42
309500 -- (-846.981) (-842.572) [-845.354] (-844.810) * (-853.938) (-847.319) (-843.035) [-848.603] -- 0:00:42
310000 -- [-842.323] (-845.668) (-843.486) (-844.967) * (-854.106) (-846.778) [-842.337] (-848.841) -- 0:00:42
Average standard deviation of split frequencies: 0.014638
310500 -- (-843.553) (-844.623) (-845.466) [-843.539] * (-850.009) (-843.751) [-843.844] (-845.508) -- 0:00:42
311000 -- (-842.530) (-844.321) (-844.787) [-847.182] * (-847.793) (-846.570) [-844.963] (-846.653) -- 0:00:42
311500 -- [-844.289] (-843.576) (-849.771) (-844.505) * [-844.353] (-845.623) (-847.448) (-845.993) -- 0:00:41
312000 -- [-843.848] (-844.004) (-843.780) (-844.023) * (-843.266) [-843.226] (-842.603) (-846.176) -- 0:00:41
312500 -- (-844.196) (-846.416) [-845.665] (-844.551) * (-844.381) (-843.802) [-841.923] (-848.330) -- 0:00:41
313000 -- (-846.532) (-844.771) [-843.475] (-850.832) * (-843.536) (-844.206) (-842.419) [-844.502] -- 0:00:41
313500 -- (-845.008) (-845.246) [-843.801] (-846.388) * (-845.260) [-845.625] (-843.561) (-845.827) -- 0:00:41
314000 -- (-843.260) (-848.631) [-843.246] (-843.081) * (-844.150) (-844.514) [-843.835] (-844.313) -- 0:00:41
314500 -- (-844.553) (-843.008) (-846.056) [-842.789] * (-844.545) (-846.046) (-853.624) [-847.395] -- 0:00:41
315000 -- [-848.619] (-842.535) (-843.270) (-844.037) * (-842.408) [-842.736] (-843.330) (-849.858) -- 0:00:41
Average standard deviation of split frequencies: 0.014304
315500 -- (-842.338) (-842.671) [-843.516] (-844.091) * (-843.075) (-846.383) [-843.106] (-844.240) -- 0:00:43
316000 -- [-842.441] (-842.221) (-843.982) (-844.094) * (-846.822) (-849.575) (-843.094) [-846.532] -- 0:00:43
316500 -- (-843.558) [-843.601] (-844.558) (-842.950) * (-843.525) (-843.702) [-842.027] (-843.758) -- 0:00:43
317000 -- (-844.915) [-845.769] (-843.837) (-844.098) * (-846.241) (-842.729) [-841.981] (-845.227) -- 0:00:43
317500 -- (-843.088) (-848.860) (-842.582) [-842.250] * (-844.051) (-844.283) [-841.937] (-845.247) -- 0:00:42
318000 -- (-845.522) [-845.329] (-843.773) (-843.722) * (-844.200) (-844.635) (-850.118) [-842.292] -- 0:00:42
318500 -- (-845.512) (-843.137) [-843.690] (-846.233) * [-848.949] (-845.135) (-846.461) (-845.726) -- 0:00:42
319000 -- [-845.180] (-843.762) (-846.026) (-842.585) * (-845.262) [-843.831] (-845.474) (-843.605) -- 0:00:42
319500 -- [-845.076] (-848.246) (-844.804) (-843.029) * (-844.714) [-846.214] (-844.241) (-842.757) -- 0:00:42
320000 -- (-846.000) (-843.376) [-843.892] (-843.521) * (-844.982) (-843.072) (-845.002) [-847.006] -- 0:00:42
Average standard deviation of split frequencies: 0.015652
320500 -- [-842.685] (-850.441) (-845.069) (-843.659) * (-845.138) (-842.703) (-846.292) [-843.973] -- 0:00:42
321000 -- [-842.887] (-846.716) (-848.763) (-843.740) * (-846.021) (-845.381) [-846.810] (-843.996) -- 0:00:42
321500 -- (-841.874) (-845.000) [-842.909] (-843.946) * [-844.088] (-848.118) (-843.436) (-843.062) -- 0:00:42
322000 -- [-845.184] (-843.439) (-842.590) (-845.923) * (-844.857) [-846.975] (-844.790) (-845.346) -- 0:00:42
322500 -- (-843.871) (-844.777) [-844.048] (-843.897) * (-844.532) (-847.983) [-842.251] (-843.003) -- 0:00:42
323000 -- (-842.910) (-844.690) [-844.603] (-847.789) * (-843.602) (-847.469) (-842.138) [-844.474] -- 0:00:41
323500 -- (-843.656) [-845.002] (-847.846) (-842.931) * [-843.089] (-846.589) (-842.005) (-842.956) -- 0:00:41
324000 -- (-848.301) (-843.411) [-845.376] (-843.768) * [-843.955] (-843.335) (-842.221) (-844.787) -- 0:00:41
324500 -- (-846.208) [-844.229] (-844.528) (-843.814) * (-843.038) (-844.223) [-844.929] (-843.378) -- 0:00:41
325000 -- (-847.546) (-844.942) (-846.051) [-847.015] * (-843.121) [-843.943] (-843.788) (-844.565) -- 0:00:41
Average standard deviation of split frequencies: 0.015566
325500 -- (-851.077) [-843.924] (-844.549) (-846.068) * (-845.490) [-847.823] (-843.421) (-845.388) -- 0:00:41
326000 -- [-852.304] (-844.349) (-843.583) (-847.614) * [-843.761] (-843.476) (-844.685) (-849.892) -- 0:00:41
326500 -- (-849.235) [-844.272] (-842.765) (-843.630) * [-842.831] (-844.072) (-845.837) (-847.484) -- 0:00:41
327000 -- (-845.084) [-846.540] (-842.426) (-842.089) * [-843.344] (-843.411) (-842.866) (-848.412) -- 0:00:41
327500 -- [-842.971] (-844.341) (-842.951) (-842.783) * (-845.059) (-842.398) [-842.552] (-844.078) -- 0:00:41
328000 -- (-841.880) (-844.175) [-843.287] (-844.302) * (-844.107) (-842.169) [-842.482] (-843.560) -- 0:00:40
328500 -- (-849.178) (-844.437) (-842.509) [-843.998] * (-842.562) (-842.587) [-843.548] (-843.435) -- 0:00:40
329000 -- [-843.784] (-843.034) (-842.643) (-845.390) * (-846.437) [-842.600] (-842.523) (-844.739) -- 0:00:40
329500 -- (-844.339) [-845.548] (-842.153) (-845.887) * (-848.438) [-842.616] (-842.295) (-843.223) -- 0:00:40
330000 -- (-849.791) [-843.735] (-842.064) (-843.074) * (-844.310) [-842.096] (-848.441) (-844.545) -- 0:00:40
Average standard deviation of split frequencies: 0.015598
330500 -- (-844.175) [-844.402] (-843.134) (-844.753) * (-844.745) [-845.071] (-844.856) (-844.742) -- 0:00:40
331000 -- (-845.269) (-845.490) [-842.357] (-846.081) * (-842.776) (-845.173) [-843.673] (-844.010) -- 0:00:40
331500 -- (-844.591) (-843.191) [-843.826] (-843.175) * (-843.648) (-844.083) (-844.637) [-846.870] -- 0:00:42
332000 -- (-842.997) (-844.957) [-843.268] (-844.117) * [-845.593] (-842.809) (-847.921) (-842.826) -- 0:00:42
332500 -- [-846.253] (-842.937) (-846.489) (-842.622) * (-845.650) [-842.454] (-842.373) (-846.563) -- 0:00:42
333000 -- (-844.001) [-842.676] (-844.997) (-843.900) * (-845.851) (-843.078) [-842.918] (-843.921) -- 0:00:42
333500 -- (-843.665) (-845.474) (-846.381) [-843.878] * [-846.444] (-848.870) (-846.214) (-845.643) -- 0:00:41
334000 -- (-843.076) (-843.097) (-845.751) [-843.619] * (-845.887) (-846.408) (-847.992) [-846.240] -- 0:00:41
334500 -- [-842.947] (-844.799) (-844.587) (-843.956) * (-845.914) (-844.961) (-845.993) [-843.766] -- 0:00:41
335000 -- (-844.453) [-842.468] (-844.950) (-844.193) * (-845.123) (-845.385) [-844.332] (-842.933) -- 0:00:41
Average standard deviation of split frequencies: 0.016753
335500 -- (-844.708) [-844.298] (-845.085) (-842.341) * (-843.005) (-844.134) (-845.533) [-844.079] -- 0:00:41
336000 -- [-845.603] (-846.159) (-843.127) (-842.042) * [-842.324] (-846.168) (-844.475) (-843.427) -- 0:00:41
336500 -- (-844.840) (-846.224) [-844.258] (-845.754) * [-845.237] (-844.167) (-845.758) (-843.634) -- 0:00:41
337000 -- (-849.118) (-844.629) (-844.490) [-845.125] * (-844.700) (-847.589) (-844.078) [-844.093] -- 0:00:41
337500 -- (-842.360) [-843.544] (-842.006) (-843.660) * (-846.641) [-842.484] (-844.261) (-846.737) -- 0:00:41
338000 -- (-844.052) (-845.703) (-844.236) [-845.282] * (-844.346) (-842.275) [-843.587] (-842.564) -- 0:00:41
338500 -- (-849.543) (-842.829) (-842.423) [-844.111] * (-843.191) (-845.169) [-842.099] (-845.350) -- 0:00:41
339000 -- [-845.171] (-846.239) (-842.389) (-844.423) * (-845.242) (-844.949) (-845.051) [-843.793] -- 0:00:40
339500 -- (-844.389) [-844.626] (-843.151) (-843.638) * (-843.359) (-842.455) (-844.146) [-844.807] -- 0:00:40
340000 -- [-842.891] (-844.611) (-844.256) (-844.215) * (-846.963) (-845.653) [-844.731] (-842.688) -- 0:00:40
Average standard deviation of split frequencies: 0.016605
340500 -- (-845.845) (-849.860) (-847.579) [-845.472] * [-846.839] (-845.706) (-843.910) (-846.650) -- 0:00:40
341000 -- (-846.238) (-843.861) [-843.475] (-846.980) * [-845.736] (-846.007) (-843.489) (-844.611) -- 0:00:40
341500 -- (-842.110) (-844.541) (-843.901) [-845.502] * (-846.057) (-844.855) (-843.394) [-843.538] -- 0:00:40
342000 -- (-844.472) (-847.655) [-843.252] (-846.644) * (-844.772) (-844.336) [-845.229] (-843.476) -- 0:00:40
342500 -- [-843.561] (-845.779) (-843.945) (-842.749) * (-845.079) (-845.346) [-845.280] (-846.751) -- 0:00:40
343000 -- (-844.994) [-844.042] (-847.439) (-843.041) * (-845.554) (-845.011) [-843.871] (-843.043) -- 0:00:40
343500 -- [-843.005] (-843.831) (-846.766) (-847.127) * (-843.511) (-844.342) (-846.160) [-843.108] -- 0:00:40
344000 -- (-845.709) [-844.140] (-845.944) (-847.049) * (-845.571) [-847.074] (-843.845) (-844.316) -- 0:00:40
344500 -- (-844.324) (-844.040) (-843.531) [-845.181] * (-842.130) [-842.634] (-845.449) (-844.750) -- 0:00:39
345000 -- [-843.491] (-843.569) (-845.303) (-845.022) * [-842.289] (-843.685) (-843.770) (-843.430) -- 0:00:39
Average standard deviation of split frequencies: 0.016109
345500 -- [-843.324] (-842.843) (-843.610) (-849.952) * (-844.966) [-843.793] (-843.176) (-845.242) -- 0:00:39
346000 -- (-843.979) (-844.500) [-843.581] (-844.213) * (-844.855) [-845.251] (-846.868) (-844.188) -- 0:00:39
346500 -- (-844.227) (-845.098) (-843.978) [-844.122] * (-845.268) (-844.564) (-843.542) [-844.632] -- 0:00:39
347000 -- [-844.332] (-842.576) (-844.634) (-845.823) * (-844.987) (-844.114) [-841.874] (-845.513) -- 0:00:39
347500 -- (-843.779) (-845.277) [-844.271] (-843.649) * (-843.460) [-843.720] (-845.258) (-844.431) -- 0:00:39
348000 -- [-845.338] (-843.484) (-844.130) (-844.810) * (-846.374) (-844.198) (-848.740) [-846.239] -- 0:00:41
348500 -- [-844.165] (-844.679) (-843.863) (-845.074) * (-844.938) [-843.150] (-845.682) (-842.944) -- 0:00:41
349000 -- (-843.405) (-846.693) [-842.651] (-842.446) * [-845.545] (-850.617) (-842.415) (-842.379) -- 0:00:41
349500 -- (-846.895) (-847.244) (-844.320) [-842.857] * [-845.343] (-848.739) (-844.795) (-844.419) -- 0:00:40
350000 -- (-848.341) (-846.751) (-844.101) [-843.878] * [-844.408] (-843.760) (-845.871) (-843.470) -- 0:00:40
Average standard deviation of split frequencies: 0.016764
350500 -- (-844.640) (-844.913) (-844.258) [-842.704] * (-845.677) (-843.417) [-842.523] (-842.699) -- 0:00:40
351000 -- (-843.254) (-845.032) (-844.542) [-842.573] * (-843.245) [-845.142] (-844.324) (-842.278) -- 0:00:40
351500 -- (-845.034) [-845.837] (-843.151) (-842.970) * (-844.055) (-851.679) [-843.193] (-844.303) -- 0:00:40
352000 -- (-848.255) (-845.315) [-843.213] (-842.995) * (-846.489) (-847.165) [-842.665] (-843.197) -- 0:00:40
352500 -- [-851.168] (-848.426) (-843.023) (-844.404) * (-843.512) (-843.390) [-844.735] (-842.686) -- 0:00:40
353000 -- [-844.663] (-848.161) (-843.500) (-843.025) * [-844.698] (-845.251) (-843.031) (-843.483) -- 0:00:40
353500 -- (-844.374) [-843.661] (-847.909) (-851.902) * [-845.773] (-845.687) (-844.461) (-844.915) -- 0:00:40
354000 -- [-843.369] (-844.036) (-845.356) (-849.272) * (-845.006) (-845.718) (-842.488) [-844.176] -- 0:00:40
354500 -- (-844.737) (-846.452) (-847.226) [-844.354] * (-844.983) [-845.776] (-843.354) (-847.251) -- 0:00:40
355000 -- [-845.747] (-844.044) (-851.079) (-843.249) * [-843.748] (-845.717) (-842.866) (-853.597) -- 0:00:39
Average standard deviation of split frequencies: 0.016747
355500 -- (-844.709) (-846.136) (-844.107) [-843.206] * (-843.723) [-844.096] (-842.645) (-845.202) -- 0:00:39
356000 -- (-843.765) [-844.015] (-845.887) (-847.771) * (-845.519) [-844.055] (-846.640) (-847.301) -- 0:00:39
356500 -- (-845.321) (-849.543) [-846.727] (-845.144) * (-845.552) (-843.337) [-844.704] (-845.007) -- 0:00:39
357000 -- (-845.321) (-844.707) [-843.100] (-844.096) * [-846.558] (-844.238) (-848.027) (-846.126) -- 0:00:39
357500 -- (-843.368) (-844.219) [-843.034] (-845.383) * (-843.482) (-843.541) [-845.440] (-843.265) -- 0:00:39
358000 -- (-845.754) (-844.358) (-843.551) [-845.070] * (-844.807) [-844.250] (-848.497) (-844.164) -- 0:00:39
358500 -- [-843.031] (-844.362) (-844.291) (-843.594) * (-843.144) (-845.355) [-845.733] (-845.708) -- 0:00:39
359000 -- (-843.676) (-843.924) [-842.939] (-843.285) * (-843.515) (-848.348) (-842.157) [-844.674] -- 0:00:39
359500 -- [-844.929] (-848.185) (-843.716) (-844.382) * (-842.919) (-844.259) [-843.828] (-843.671) -- 0:00:39
360000 -- [-844.227] (-845.622) (-842.211) (-844.528) * [-843.192] (-842.268) (-845.997) (-850.174) -- 0:00:39
Average standard deviation of split frequencies: 0.016838
360500 -- (-843.744) (-844.881) [-844.724] (-845.162) * [-845.828] (-842.268) (-843.719) (-849.475) -- 0:00:39
361000 -- (-844.614) (-845.981) (-844.829) [-843.227] * [-846.355] (-848.324) (-846.980) (-845.941) -- 0:00:38
361500 -- (-843.535) (-845.226) (-847.230) [-843.315] * (-844.054) (-846.996) [-844.952] (-842.476) -- 0:00:38
362000 -- (-842.588) (-845.379) [-846.050] (-843.020) * (-842.256) [-844.112] (-844.851) (-842.489) -- 0:00:38
362500 -- [-844.082] (-848.043) (-843.699) (-843.632) * (-843.015) (-843.590) [-844.792] (-847.917) -- 0:00:38
363000 -- (-844.852) (-844.348) [-844.239] (-845.239) * [-844.879] (-844.306) (-846.658) (-844.063) -- 0:00:38
363500 -- (-844.056) [-843.140] (-842.462) (-850.946) * (-846.456) (-843.254) (-844.455) [-843.301] -- 0:00:40
364000 -- (-846.382) (-844.694) (-844.822) [-846.672] * [-845.439] (-844.185) (-842.478) (-846.150) -- 0:00:40
364500 -- [-845.686] (-843.375) (-845.446) (-843.724) * [-842.734] (-845.198) (-842.834) (-844.565) -- 0:00:40
365000 -- (-843.816) [-843.467] (-844.153) (-845.776) * (-843.574) (-845.660) (-843.517) [-843.033] -- 0:00:40
Average standard deviation of split frequencies: 0.016062
365500 -- (-845.002) (-846.307) [-844.869] (-843.789) * (-844.437) [-843.657] (-844.058) (-846.282) -- 0:00:39
366000 -- (-847.721) (-842.660) (-847.019) [-846.903] * [-845.524] (-846.439) (-843.268) (-844.129) -- 0:00:39
366500 -- [-844.608] (-842.544) (-843.029) (-842.983) * (-843.447) [-842.213] (-844.406) (-844.328) -- 0:00:39
367000 -- (-844.699) [-844.026] (-844.638) (-844.044) * [-843.181] (-843.746) (-847.156) (-843.050) -- 0:00:39
367500 -- [-845.587] (-845.092) (-843.612) (-843.359) * (-842.919) (-843.532) [-842.176] (-843.621) -- 0:00:39
368000 -- (-846.123) (-843.993) (-843.215) [-847.894] * (-850.540) (-843.371) [-843.342] (-843.342) -- 0:00:39
368500 -- (-844.630) (-842.733) [-843.582] (-844.800) * (-845.554) (-843.295) (-842.414) [-843.534] -- 0:00:39
369000 -- [-848.332] (-845.013) (-842.755) (-843.456) * (-846.093) (-843.175) (-844.778) [-846.387] -- 0:00:39
369500 -- (-843.861) [-846.670] (-844.013) (-846.133) * (-845.274) (-847.712) [-842.452] (-842.513) -- 0:00:39
370000 -- [-842.763] (-843.667) (-842.614) (-844.709) * (-843.716) (-846.275) [-842.501] (-845.504) -- 0:00:39
Average standard deviation of split frequencies: 0.015710
370500 -- (-848.555) (-844.589) [-843.540] (-846.609) * [-846.695] (-846.055) (-847.575) (-846.034) -- 0:00:39
371000 -- (-844.488) (-844.126) (-846.769) [-849.594] * (-844.653) (-847.668) (-846.347) [-844.868] -- 0:00:38
371500 -- [-848.014] (-845.775) (-845.786) (-846.265) * [-842.420] (-847.203) (-845.031) (-845.702) -- 0:00:38
372000 -- (-843.576) (-847.607) (-844.668) [-844.744] * (-842.854) [-844.239] (-849.373) (-844.564) -- 0:00:38
372500 -- (-844.137) [-847.494] (-852.310) (-846.777) * (-844.270) (-844.079) [-847.341] (-843.046) -- 0:00:38
373000 -- (-844.323) [-845.474] (-851.942) (-845.769) * (-845.771) (-842.456) (-842.948) [-842.764] -- 0:00:38
373500 -- (-844.197) (-845.086) [-843.265] (-843.326) * (-848.314) (-842.735) [-843.819] (-843.002) -- 0:00:38
374000 -- (-844.123) (-843.139) [-843.863] (-845.178) * (-844.015) (-842.314) [-844.028] (-843.537) -- 0:00:38
374500 -- (-843.608) (-849.086) (-844.215) [-843.205] * [-847.289] (-843.647) (-843.626) (-842.516) -- 0:00:38
375000 -- [-846.939] (-843.509) (-845.989) (-842.786) * [-847.110] (-846.036) (-843.936) (-842.036) -- 0:00:38
Average standard deviation of split frequencies: 0.015930
375500 -- [-845.424] (-844.586) (-844.114) (-843.635) * (-844.759) (-843.304) (-845.610) [-843.422] -- 0:00:38
376000 -- (-844.234) [-844.107] (-849.425) (-846.665) * [-843.544] (-845.126) (-843.362) (-845.567) -- 0:00:38
376500 -- (-843.197) [-844.710] (-843.393) (-848.503) * (-842.821) [-846.185] (-844.359) (-845.157) -- 0:00:38
377000 -- (-844.322) (-843.070) [-844.586] (-845.937) * (-846.645) (-847.185) (-843.391) [-845.276] -- 0:00:38
377500 -- [-843.499] (-843.301) (-844.318) (-842.476) * (-845.836) (-845.193) [-841.948] (-844.049) -- 0:00:37
378000 -- [-842.198] (-844.666) (-843.679) (-844.912) * (-844.426) (-843.623) (-842.035) [-847.186] -- 0:00:37
378500 -- (-842.872) [-844.407] (-843.784) (-843.497) * (-844.255) [-843.345] (-842.040) (-850.145) -- 0:00:37
379000 -- (-844.165) (-842.946) (-843.923) [-843.726] * (-842.934) [-842.828] (-841.879) (-845.575) -- 0:00:37
379500 -- (-844.644) (-847.970) [-843.008] (-842.690) * (-845.060) (-844.067) [-843.178] (-844.957) -- 0:00:39
380000 -- (-844.376) (-844.255) [-845.095] (-847.694) * (-842.626) (-842.432) [-843.116] (-845.379) -- 0:00:39
Average standard deviation of split frequencies: 0.015880
380500 -- [-843.290] (-844.561) (-849.099) (-843.938) * [-844.744] (-842.263) (-844.840) (-845.886) -- 0:00:39
381000 -- (-844.133) (-844.248) (-845.609) [-845.595] * (-847.094) (-847.559) [-842.190] (-846.161) -- 0:00:38
381500 -- (-843.752) (-844.991) [-845.320] (-845.894) * (-846.525) (-846.131) (-842.991) [-845.647] -- 0:00:38
382000 -- (-845.295) (-845.022) (-843.960) [-845.215] * (-843.468) [-848.399] (-844.229) (-844.737) -- 0:00:38
382500 -- (-849.191) (-843.296) (-845.156) [-843.914] * (-842.816) (-847.743) (-849.438) [-844.524] -- 0:00:38
383000 -- (-844.415) (-847.774) [-842.573] (-846.430) * [-842.593] (-844.121) (-847.949) (-848.058) -- 0:00:38
383500 -- (-844.978) (-843.336) (-843.190) [-842.683] * (-845.530) [-844.011] (-846.860) (-845.069) -- 0:00:38
384000 -- (-847.334) [-842.797] (-842.698) (-845.576) * (-842.787) (-842.577) (-846.349) [-843.539] -- 0:00:38
384500 -- (-844.531) (-846.879) (-842.663) [-846.009] * [-843.036] (-843.216) (-844.486) (-844.569) -- 0:00:38
385000 -- (-845.468) [-843.352] (-841.868) (-846.017) * (-843.414) [-845.304] (-845.792) (-844.053) -- 0:00:38
Average standard deviation of split frequencies: 0.014583
385500 -- [-844.259] (-844.002) (-846.591) (-845.806) * (-844.882) [-844.617] (-845.452) (-843.444) -- 0:00:38
386000 -- (-843.685) [-843.675] (-845.827) (-849.502) * [-843.788] (-843.889) (-848.118) (-843.039) -- 0:00:38
386500 -- (-842.377) (-845.588) (-843.410) [-843.217] * (-846.416) (-845.443) (-844.225) [-842.409] -- 0:00:38
387000 -- [-847.757] (-847.561) (-843.174) (-844.514) * [-843.464] (-843.123) (-846.044) (-844.953) -- 0:00:38
387500 -- (-845.178) (-843.542) (-844.199) [-843.560] * (-852.496) (-845.039) [-842.814] (-843.536) -- 0:00:37
388000 -- (-844.095) (-843.319) [-845.241] (-844.730) * (-843.349) (-845.840) [-843.023] (-844.431) -- 0:00:37
388500 -- [-845.351] (-848.298) (-844.083) (-842.680) * (-844.231) (-844.932) (-842.849) [-842.644] -- 0:00:37
389000 -- (-844.743) [-843.910] (-844.565) (-842.456) * [-845.059] (-852.635) (-842.917) (-843.148) -- 0:00:37
389500 -- (-844.459) [-842.867] (-844.734) (-842.553) * (-842.580) (-852.537) [-844.170] (-843.626) -- 0:00:37
390000 -- (-844.182) [-844.714] (-843.574) (-842.650) * [-843.076] (-848.843) (-849.258) (-847.874) -- 0:00:37
Average standard deviation of split frequencies: 0.012821
390500 -- (-843.913) (-844.558) (-844.712) [-843.227] * (-842.765) (-846.650) (-846.812) [-844.962] -- 0:00:37
391000 -- (-842.611) (-843.336) [-843.959] (-843.055) * (-847.593) (-841.968) (-844.717) [-842.959] -- 0:00:37
391500 -- [-844.521] (-844.721) (-842.995) (-845.293) * (-843.674) (-842.430) [-843.426] (-845.419) -- 0:00:37
392000 -- (-845.501) (-842.265) (-843.734) [-841.868] * (-844.895) [-844.066] (-843.565) (-844.612) -- 0:00:37
392500 -- (-846.554) (-845.332) (-845.030) [-848.192] * (-843.564) (-843.410) [-848.751] (-844.667) -- 0:00:37
393000 -- (-844.206) [-844.294] (-843.321) (-844.781) * (-843.833) [-843.151] (-844.323) (-845.811) -- 0:00:37
393500 -- (-846.634) (-843.599) [-845.678] (-847.706) * [-843.815] (-845.192) (-842.679) (-845.468) -- 0:00:36
394000 -- (-844.539) [-846.411] (-844.350) (-843.400) * [-843.485] (-847.188) (-841.971) (-844.642) -- 0:00:36
394500 -- (-844.648) (-844.677) [-844.151] (-844.726) * (-843.547) (-843.811) (-841.794) [-843.846] -- 0:00:36
395000 -- (-845.889) (-844.034) [-842.842] (-845.286) * [-843.364] (-843.411) (-848.639) (-845.978) -- 0:00:36
Average standard deviation of split frequencies: 0.013025
395500 -- (-846.783) [-842.769] (-842.038) (-842.927) * (-845.202) [-845.445] (-846.233) (-843.124) -- 0:00:36
396000 -- (-846.954) (-843.533) (-842.548) [-842.984] * [-847.493] (-847.005) (-845.633) (-849.159) -- 0:00:38
396500 -- (-844.261) (-843.879) (-842.378) [-845.522] * (-843.206) (-846.830) (-846.266) [-843.305] -- 0:00:38
397000 -- (-843.784) [-842.228] (-846.216) (-844.291) * (-845.396) (-844.928) [-842.623] (-847.418) -- 0:00:37
397500 -- (-847.709) (-842.505) (-849.945) [-845.571] * (-845.219) (-845.060) (-847.058) [-846.558] -- 0:00:37
398000 -- [-843.482] (-843.761) (-844.769) (-848.586) * (-845.286) [-845.953] (-843.153) (-847.238) -- 0:00:37
398500 -- [-843.484] (-844.780) (-842.753) (-846.024) * (-843.813) (-842.976) (-844.694) [-847.482] -- 0:00:37
399000 -- [-843.324] (-846.636) (-846.220) (-847.179) * (-846.404) (-844.361) [-843.539] (-843.674) -- 0:00:37
399500 -- [-844.528] (-842.879) (-844.538) (-842.209) * [-842.548] (-846.549) (-846.619) (-846.985) -- 0:00:37
400000 -- (-845.575) [-842.396] (-849.036) (-843.637) * (-846.054) (-845.893) [-846.029] (-843.944) -- 0:00:37
Average standard deviation of split frequencies: 0.012354
400500 -- [-842.720] (-842.104) (-843.917) (-845.838) * (-843.747) [-848.236] (-846.437) (-842.804) -- 0:00:37
401000 -- (-844.424) (-844.930) (-844.027) [-843.985] * [-850.680] (-848.680) (-844.079) (-843.538) -- 0:00:37
401500 -- [-845.003] (-845.351) (-844.847) (-845.192) * (-842.605) (-844.954) [-844.298] (-842.585) -- 0:00:37
402000 -- [-850.166] (-843.825) (-847.421) (-846.677) * [-843.985] (-844.376) (-844.118) (-843.489) -- 0:00:37
402500 -- [-845.175] (-845.840) (-843.538) (-845.029) * [-842.124] (-842.584) (-844.929) (-843.510) -- 0:00:37
403000 -- (-847.576) (-843.641) [-843.537] (-845.089) * (-843.423) (-844.869) (-843.756) [-845.823] -- 0:00:37
403500 -- [-845.856] (-842.615) (-846.038) (-849.049) * (-843.456) (-844.498) [-844.481] (-848.218) -- 0:00:36
404000 -- (-844.084) [-842.797] (-843.135) (-848.374) * [-843.299] (-846.922) (-844.302) (-845.307) -- 0:00:36
404500 -- [-845.155] (-845.811) (-843.473) (-848.380) * (-846.199) (-844.441) [-845.133] (-848.349) -- 0:00:36
405000 -- (-847.043) (-843.160) (-844.995) [-842.479] * (-848.752) (-843.774) [-842.864] (-845.075) -- 0:00:36
Average standard deviation of split frequencies: 0.013318
405500 -- (-844.267) (-842.453) [-844.736] (-843.929) * (-847.311) (-844.500) (-846.546) [-845.080] -- 0:00:36
406000 -- (-844.082) (-842.719) (-846.287) [-844.536] * (-842.212) (-843.987) (-845.578) [-847.315] -- 0:00:36
406500 -- (-843.011) (-844.709) (-842.249) [-844.341] * (-844.597) [-844.321] (-845.737) (-846.215) -- 0:00:36
407000 -- (-844.068) (-843.611) [-844.772] (-842.999) * (-851.974) (-843.322) [-842.137] (-845.098) -- 0:00:36
407500 -- (-847.319) [-842.338] (-845.657) (-844.303) * (-845.302) (-845.431) (-842.234) [-843.690] -- 0:00:36
408000 -- (-843.480) (-843.987) (-849.707) [-846.758] * [-843.988] (-843.240) (-842.704) (-844.542) -- 0:00:36
408500 -- (-843.958) [-842.825] (-842.715) (-845.476) * [-848.071] (-844.204) (-842.270) (-844.328) -- 0:00:36
409000 -- (-842.870) [-843.873] (-848.020) (-844.379) * (-850.575) (-842.894) (-844.431) [-844.200] -- 0:00:36
409500 -- [-844.716] (-842.507) (-844.130) (-844.172) * [-843.970] (-842.581) (-847.326) (-842.686) -- 0:00:36
410000 -- (-844.024) [-843.232] (-842.987) (-843.000) * [-844.529] (-843.391) (-843.967) (-841.898) -- 0:00:35
Average standard deviation of split frequencies: 0.013977
410500 -- (-848.209) [-843.583] (-842.526) (-843.391) * [-844.279] (-843.303) (-843.810) (-843.058) -- 0:00:35
411000 -- (-845.111) (-844.819) (-845.245) [-842.813] * (-845.886) (-844.388) (-843.400) [-842.040] -- 0:00:35
411500 -- [-847.698] (-844.723) (-844.929) (-845.222) * (-846.587) (-842.921) [-843.786] (-842.322) -- 0:00:35
412000 -- (-851.915) [-844.722] (-846.328) (-843.524) * (-851.793) [-843.724] (-846.201) (-843.323) -- 0:00:37
412500 -- (-843.618) (-844.463) (-850.004) [-843.736] * (-843.971) [-844.034] (-842.120) (-844.455) -- 0:00:37
413000 -- [-843.729] (-847.644) (-844.597) (-845.084) * (-847.587) (-841.813) (-846.352) [-844.753] -- 0:00:36
413500 -- (-842.590) (-844.127) (-846.413) [-847.003] * (-844.191) [-844.486] (-845.034) (-844.176) -- 0:00:36
414000 -- (-844.792) (-843.540) (-847.330) [-846.846] * (-844.945) (-842.208) [-843.509] (-843.189) -- 0:00:36
414500 -- (-843.244) (-843.095) (-842.944) [-846.332] * (-850.540) [-845.928] (-843.531) (-848.811) -- 0:00:36
415000 -- (-845.560) (-843.984) [-844.081] (-844.092) * [-844.014] (-846.857) (-848.506) (-844.391) -- 0:00:36
Average standard deviation of split frequencies: 0.014065
415500 -- (-844.820) [-845.505] (-844.796) (-844.634) * (-843.172) (-842.084) [-844.814] (-845.112) -- 0:00:36
416000 -- (-843.859) (-843.158) [-845.532] (-844.458) * (-843.833) (-842.040) [-842.094] (-846.217) -- 0:00:36
416500 -- (-844.108) [-843.575] (-844.494) (-845.941) * (-843.003) (-844.536) (-842.573) [-843.114] -- 0:00:36
417000 -- (-846.952) (-843.073) [-844.504] (-846.017) * (-847.285) (-842.343) [-846.267] (-845.758) -- 0:00:36
417500 -- (-842.227) (-843.144) (-844.534) [-847.194] * (-844.163) (-842.175) [-844.493] (-844.588) -- 0:00:36
418000 -- [-845.153] (-846.060) (-846.851) (-845.916) * (-844.674) [-842.193] (-843.274) (-845.206) -- 0:00:36
418500 -- [-844.010] (-846.863) (-845.101) (-845.598) * (-844.254) (-843.952) (-845.145) [-844.756] -- 0:00:36
419000 -- (-845.378) [-842.772] (-843.202) (-847.949) * [-845.580] (-844.304) (-849.333) (-844.547) -- 0:00:36
419500 -- (-843.235) (-842.930) (-843.516) [-845.600] * [-843.749] (-843.558) (-846.542) (-843.429) -- 0:00:35
420000 -- (-844.021) (-842.963) (-846.673) [-843.009] * (-843.460) [-845.878] (-845.767) (-845.491) -- 0:00:35
Average standard deviation of split frequencies: 0.014370
420500 -- (-846.618) [-842.443] (-844.331) (-843.163) * (-842.071) [-846.235] (-844.322) (-842.745) -- 0:00:35
421000 -- (-843.710) [-843.449] (-843.825) (-845.824) * [-843.599] (-851.115) (-843.746) (-844.287) -- 0:00:35
421500 -- [-844.461] (-842.994) (-846.635) (-845.276) * (-845.740) (-848.873) (-845.972) [-843.609] -- 0:00:35
422000 -- (-845.103) (-847.860) [-843.712] (-842.045) * (-844.573) [-842.876] (-846.198) (-843.587) -- 0:00:35
422500 -- (-845.616) (-845.172) (-844.831) [-842.457] * (-843.469) (-847.376) (-842.851) [-842.470] -- 0:00:35
423000 -- (-842.668) (-846.505) (-844.817) [-843.068] * (-843.872) (-843.682) (-844.707) [-842.469] -- 0:00:35
423500 -- (-843.893) [-848.816] (-843.927) (-842.855) * (-847.583) (-843.238) [-844.589] (-844.180) -- 0:00:35
424000 -- (-843.743) (-844.159) [-845.150] (-843.758) * (-845.844) (-844.866) (-842.779) [-842.535] -- 0:00:35
424500 -- (-844.094) (-843.572) (-845.680) [-847.658] * (-845.334) (-847.685) (-842.732) [-843.726] -- 0:00:35
425000 -- (-843.700) [-844.222] (-844.570) (-847.085) * (-842.970) (-844.119) (-846.706) [-843.283] -- 0:00:35
Average standard deviation of split frequencies: 0.014776
425500 -- [-845.918] (-845.104) (-843.100) (-844.355) * (-842.659) (-843.624) (-843.158) [-843.550] -- 0:00:35
426000 -- (-844.442) (-844.787) [-843.440] (-842.235) * [-843.226] (-846.281) (-843.139) (-845.167) -- 0:00:35
426500 -- [-843.677] (-847.674) (-846.845) (-849.490) * (-846.560) (-846.260) (-843.285) [-845.374] -- 0:00:34
427000 -- [-847.395] (-846.213) (-843.677) (-846.110) * (-845.763) (-843.553) [-844.500] (-842.624) -- 0:00:34
427500 -- (-845.296) (-847.525) (-843.715) [-848.436] * (-842.966) (-844.089) [-846.024] (-846.212) -- 0:00:36
428000 -- [-847.595] (-842.618) (-844.793) (-847.273) * [-844.347] (-842.997) (-844.190) (-843.194) -- 0:00:36
428500 -- (-843.897) (-843.150) (-843.986) [-842.681] * [-847.205] (-845.438) (-843.585) (-843.228) -- 0:00:36
429000 -- (-845.269) (-846.405) (-846.510) [-843.097] * (-845.812) (-842.198) [-844.711] (-848.301) -- 0:00:35
429500 -- (-845.361) (-846.135) (-847.061) [-844.865] * (-847.229) [-846.214] (-844.376) (-843.315) -- 0:00:35
430000 -- (-847.101) (-848.044) (-849.270) [-844.337] * (-845.534) [-844.104] (-843.679) (-843.258) -- 0:00:35
Average standard deviation of split frequencies: 0.014745
430500 -- (-846.178) [-843.538] (-842.083) (-844.270) * (-843.099) (-845.443) (-846.080) [-849.966] -- 0:00:35
431000 -- [-842.671] (-845.463) (-844.781) (-845.657) * (-844.468) (-848.743) (-845.430) [-843.566] -- 0:00:35
431500 -- [-844.493] (-847.049) (-842.436) (-843.560) * (-848.535) (-844.837) (-846.820) [-842.016] -- 0:00:35
432000 -- (-842.816) [-846.544] (-845.478) (-842.915) * [-843.663] (-843.021) (-846.837) (-842.401) -- 0:00:35
432500 -- (-843.374) [-843.506] (-850.309) (-842.651) * (-845.172) (-842.663) (-843.423) [-843.506] -- 0:00:35
433000 -- [-845.330] (-846.242) (-843.373) (-842.462) * (-842.791) (-844.059) [-842.117] (-843.995) -- 0:00:35
433500 -- [-843.684] (-844.960) (-844.517) (-842.982) * [-844.956] (-844.019) (-843.195) (-852.613) -- 0:00:35
434000 -- [-844.004] (-844.758) (-845.071) (-843.140) * (-844.026) [-843.279] (-844.457) (-852.673) -- 0:00:35
434500 -- (-844.887) [-843.831] (-847.500) (-843.573) * (-847.333) (-846.766) [-844.871] (-853.685) -- 0:00:35
435000 -- [-844.499] (-842.177) (-847.015) (-845.454) * (-846.248) (-847.119) [-850.522] (-850.407) -- 0:00:35
Average standard deviation of split frequencies: 0.014374
435500 -- (-843.892) (-842.833) [-843.211] (-843.316) * [-845.227] (-843.378) (-845.189) (-844.278) -- 0:00:34
436000 -- (-845.964) [-842.494] (-843.552) (-842.797) * [-843.111] (-844.599) (-844.336) (-844.635) -- 0:00:34
436500 -- [-844.246] (-845.146) (-845.461) (-842.797) * (-842.315) [-844.436] (-844.071) (-842.786) -- 0:00:34
437000 -- (-845.815) (-843.655) (-855.676) [-842.657] * [-844.644] (-845.360) (-843.578) (-842.399) -- 0:00:34
437500 -- [-843.963] (-845.270) (-842.769) (-845.718) * [-843.217] (-843.558) (-845.108) (-844.122) -- 0:00:34
438000 -- (-846.656) [-843.631] (-843.366) (-843.480) * (-844.701) (-842.910) [-844.572] (-843.799) -- 0:00:34
438500 -- (-845.376) (-842.311) [-845.892] (-842.802) * (-846.797) (-843.729) (-848.317) [-845.026] -- 0:00:34
439000 -- (-844.474) [-841.894] (-845.800) (-844.556) * (-849.328) (-843.172) [-843.039] (-847.851) -- 0:00:34
439500 -- [-843.864] (-842.298) (-845.614) (-842.895) * (-844.086) (-847.150) [-841.765] (-844.427) -- 0:00:34
440000 -- (-845.163) (-847.628) [-845.727] (-847.711) * (-844.301) [-843.035] (-846.561) (-842.236) -- 0:00:34
Average standard deviation of split frequencies: 0.015165
440500 -- (-845.830) [-843.561] (-842.470) (-843.761) * [-843.011] (-842.147) (-848.199) (-842.286) -- 0:00:34
441000 -- (-843.017) [-843.257] (-843.476) (-848.760) * (-847.597) [-845.970] (-846.660) (-845.004) -- 0:00:34
441500 -- (-842.583) (-845.860) (-850.334) [-844.995] * [-844.830] (-844.052) (-845.482) (-845.147) -- 0:00:34
442000 -- (-844.919) (-848.572) (-845.583) [-844.382] * (-845.302) (-843.683) [-846.359] (-843.156) -- 0:00:34
442500 -- (-842.466) (-847.979) [-847.562] (-843.654) * (-843.492) (-844.375) (-842.582) [-846.868] -- 0:00:34
443000 -- (-842.274) (-844.591) [-844.497] (-847.673) * [-843.220] (-842.937) (-843.769) (-846.865) -- 0:00:33
443500 -- [-844.171] (-844.285) (-845.255) (-843.722) * (-845.357) (-843.973) [-844.300] (-849.077) -- 0:00:33
444000 -- (-845.364) [-846.396] (-843.849) (-842.296) * (-845.570) [-845.186] (-849.641) (-843.734) -- 0:00:35
444500 -- (-844.785) (-843.087) [-844.808] (-842.231) * [-844.837] (-844.346) (-846.489) (-844.170) -- 0:00:34
445000 -- (-843.884) [-843.186] (-845.563) (-845.970) * [-843.240] (-843.061) (-844.589) (-846.939) -- 0:00:34
Average standard deviation of split frequencies: 0.015357
445500 -- (-844.268) (-843.263) (-845.796) [-844.340] * (-843.062) (-843.525) [-846.686] (-843.115) -- 0:00:34
446000 -- (-844.182) (-843.669) (-844.907) [-846.582] * (-843.507) (-850.176) [-843.385] (-842.706) -- 0:00:34
446500 -- (-844.165) (-845.411) [-846.739] (-843.762) * [-843.377] (-844.071) (-850.846) (-847.805) -- 0:00:34
447000 -- (-843.863) (-844.367) [-844.038] (-843.691) * (-845.652) (-842.977) (-847.389) [-846.052] -- 0:00:34
447500 -- (-851.655) (-843.701) (-843.106) [-846.394] * (-844.620) (-844.211) [-847.043] (-844.937) -- 0:00:34
448000 -- [-844.808] (-842.761) (-844.728) (-843.172) * (-844.111) [-843.647] (-845.570) (-847.720) -- 0:00:34
448500 -- (-844.653) (-849.816) [-846.733] (-845.452) * (-847.054) (-844.461) (-845.336) [-843.128] -- 0:00:34
449000 -- (-853.535) (-846.841) [-845.345] (-844.366) * [-845.274] (-845.172) (-848.568) (-844.359) -- 0:00:34
449500 -- [-847.186] (-849.103) (-845.854) (-841.911) * (-845.220) [-842.913] (-846.023) (-843.335) -- 0:00:34
450000 -- (-844.292) [-845.994] (-846.798) (-841.938) * (-846.412) [-843.927] (-842.520) (-848.032) -- 0:00:34
Average standard deviation of split frequencies: 0.014890
450500 -- (-845.162) [-845.033] (-844.132) (-845.425) * (-843.507) (-845.231) [-843.134] (-843.248) -- 0:00:34
451000 -- [-846.864] (-848.066) (-843.698) (-845.933) * (-845.386) [-844.586] (-843.503) (-845.201) -- 0:00:34
451500 -- (-848.360) (-847.846) [-842.367] (-844.721) * [-843.531] (-852.513) (-842.674) (-843.507) -- 0:00:34
452000 -- (-844.178) [-843.971] (-843.507) (-842.724) * (-847.149) (-845.024) (-845.552) [-847.177] -- 0:00:33
452500 -- [-842.040] (-848.685) (-845.011) (-848.670) * (-844.869) (-848.400) [-844.825] (-843.719) -- 0:00:33
453000 -- (-842.866) [-844.198] (-843.961) (-849.694) * (-844.803) [-847.080] (-847.580) (-843.673) -- 0:00:33
453500 -- (-843.052) (-846.790) [-847.646] (-844.531) * (-842.494) (-843.244) (-845.011) [-843.311] -- 0:00:33
454000 -- (-842.445) (-843.441) [-850.491] (-843.361) * [-843.831] (-845.538) (-845.461) (-846.472) -- 0:00:33
454500 -- [-842.480] (-844.594) (-847.880) (-842.401) * (-842.484) (-843.447) (-846.356) [-845.380] -- 0:00:33
455000 -- [-842.666] (-843.547) (-850.753) (-842.479) * [-843.545] (-845.891) (-846.275) (-845.134) -- 0:00:33
Average standard deviation of split frequencies: 0.013865
455500 -- (-842.888) (-843.765) [-845.294] (-844.139) * [-843.290] (-845.973) (-845.516) (-842.337) -- 0:00:33
456000 -- [-841.886] (-842.315) (-844.085) (-845.607) * (-843.159) (-847.099) (-846.342) [-843.872] -- 0:00:33
456500 -- (-842.183) (-847.005) [-844.429] (-842.519) * (-843.663) (-843.743) [-847.438] (-844.690) -- 0:00:33
457000 -- [-845.143] (-847.611) (-844.786) (-842.927) * (-843.911) (-844.822) (-843.218) [-844.174] -- 0:00:33
457500 -- (-845.259) (-844.435) [-843.974] (-845.548) * (-843.070) [-843.713] (-841.993) (-843.064) -- 0:00:33
458000 -- (-843.205) (-845.212) (-844.356) [-843.178] * (-843.710) (-845.645) (-844.290) [-843.634] -- 0:00:33
458500 -- (-844.387) (-843.423) (-844.124) [-844.738] * (-844.904) (-842.282) [-844.483] (-843.734) -- 0:00:33
459000 -- (-845.277) [-843.584] (-843.637) (-844.674) * (-843.911) (-844.352) [-843.542] (-842.269) -- 0:00:33
459500 -- (-845.746) [-843.056] (-842.270) (-842.412) * (-850.021) (-847.545) [-843.126] (-842.880) -- 0:00:32
460000 -- (-847.891) [-843.215] (-843.555) (-842.271) * (-847.867) (-844.707) [-842.765] (-843.401) -- 0:00:32
Average standard deviation of split frequencies: 0.014025
460500 -- (-847.777) (-844.141) (-843.737) [-845.055] * (-845.121) (-844.278) (-843.166) [-842.376] -- 0:00:33
461000 -- [-845.542] (-843.982) (-845.467) (-842.236) * [-844.299] (-842.329) (-849.567) (-846.329) -- 0:00:33
461500 -- (-842.254) [-847.919] (-844.358) (-844.312) * (-842.837) [-842.860] (-847.261) (-849.661) -- 0:00:33
462000 -- (-845.795) (-844.516) [-845.383] (-843.372) * [-842.566] (-842.280) (-842.235) (-843.967) -- 0:00:33
462500 -- (-843.540) (-846.507) (-843.765) [-844.647] * (-846.022) (-843.806) [-842.735] (-845.162) -- 0:00:33
463000 -- (-846.958) (-845.427) [-845.004] (-842.619) * [-843.505] (-846.476) (-844.130) (-842.701) -- 0:00:33
463500 -- (-845.529) (-851.690) (-845.990) [-842.385] * (-842.368) (-845.113) [-843.288] (-843.256) -- 0:00:33
464000 -- (-844.513) [-842.685] (-846.465) (-846.906) * (-847.627) (-842.764) [-842.857] (-842.211) -- 0:00:33
464500 -- (-844.685) [-843.502] (-845.335) (-846.333) * [-843.797] (-843.840) (-843.757) (-844.507) -- 0:00:33
465000 -- (-846.781) (-843.744) (-842.255) [-845.541] * (-844.175) (-843.456) [-842.664] (-848.169) -- 0:00:33
Average standard deviation of split frequencies: 0.014579
465500 -- (-842.098) [-843.393] (-845.678) (-844.415) * (-850.575) (-844.035) [-843.128] (-850.558) -- 0:00:33
466000 -- (-844.979) [-842.569] (-847.392) (-843.340) * [-844.316] (-849.158) (-842.126) (-845.945) -- 0:00:33
466500 -- (-852.667) (-845.420) (-844.881) [-842.741] * (-844.108) (-843.947) (-842.076) [-844.184] -- 0:00:33
467000 -- (-848.792) (-848.366) (-847.550) [-843.171] * (-845.790) (-844.193) (-844.860) [-844.516] -- 0:00:33
467500 -- [-846.868] (-842.396) (-850.575) (-843.356) * (-845.071) (-844.489) (-843.302) [-843.354] -- 0:00:33
468000 -- (-844.520) [-843.583] (-846.229) (-847.560) * [-844.024] (-842.621) (-846.553) (-842.272) -- 0:00:32
468500 -- [-844.456] (-843.731) (-846.356) (-846.755) * (-844.208) (-842.980) [-843.326] (-845.340) -- 0:00:32
469000 -- (-843.903) (-844.167) (-846.498) [-846.114] * (-849.931) (-843.315) [-844.256] (-842.693) -- 0:00:32
469500 -- (-842.437) (-844.564) (-844.455) [-846.180] * (-846.965) [-842.183] (-844.953) (-842.830) -- 0:00:32
470000 -- (-842.137) (-843.200) (-847.999) [-845.081] * (-847.182) (-845.033) (-851.708) [-844.126] -- 0:00:32
Average standard deviation of split frequencies: 0.013433
470500 -- [-843.879] (-844.498) (-844.305) (-844.003) * (-845.432) (-845.449) [-843.586] (-844.676) -- 0:00:32
471000 -- (-852.228) (-847.676) [-844.511] (-843.930) * [-844.792] (-844.364) (-844.699) (-844.170) -- 0:00:32
471500 -- (-845.712) (-845.054) [-842.812] (-847.400) * (-845.857) (-845.144) (-844.433) [-844.597] -- 0:00:32
472000 -- (-842.757) (-843.810) (-844.845) [-845.510] * [-843.645] (-846.854) (-843.310) (-847.472) -- 0:00:32
472500 -- (-843.607) (-844.579) (-844.391) [-844.097] * [-843.824] (-844.993) (-845.608) (-842.443) -- 0:00:32
473000 -- (-843.537) (-848.176) [-843.350] (-843.539) * [-844.801] (-843.112) (-843.286) (-842.145) -- 0:00:32
473500 -- (-843.169) [-845.179] (-842.540) (-844.234) * (-847.589) (-845.479) (-844.060) [-843.801] -- 0:00:32
474000 -- (-843.700) [-843.884] (-842.540) (-843.520) * [-844.968] (-845.951) (-843.700) (-847.730) -- 0:00:32
474500 -- (-846.202) [-842.633] (-843.249) (-843.393) * (-842.949) (-845.114) (-848.415) [-844.246] -- 0:00:32
475000 -- (-844.435) [-843.470] (-843.674) (-844.549) * (-842.933) (-844.295) [-843.340] (-845.980) -- 0:00:32
Average standard deviation of split frequencies: 0.013049
475500 -- [-843.140] (-845.181) (-843.720) (-843.820) * (-844.780) [-843.485] (-844.732) (-846.615) -- 0:00:31
476000 -- [-844.641] (-843.503) (-843.567) (-843.178) * (-847.709) (-845.248) (-842.796) [-845.254] -- 0:00:31
476500 -- [-845.432] (-843.113) (-847.266) (-844.709) * (-843.869) [-844.305] (-842.386) (-843.647) -- 0:00:31
477000 -- (-844.359) (-844.781) [-845.250] (-845.428) * (-843.782) (-846.817) (-843.878) [-847.249] -- 0:00:31
477500 -- (-843.322) [-845.054] (-845.084) (-845.811) * (-848.652) (-845.804) [-845.188] (-846.273) -- 0:00:32
478000 -- (-843.774) (-843.912) (-848.242) [-843.679] * (-846.074) [-845.063] (-846.090) (-843.540) -- 0:00:32
478500 -- [-844.127] (-848.324) (-846.952) (-844.519) * [-844.122] (-843.112) (-845.919) (-844.584) -- 0:00:32
479000 -- (-844.632) (-847.532) (-844.307) [-844.488] * (-843.701) (-847.539) [-844.490] (-846.546) -- 0:00:32
479500 -- [-845.593] (-844.369) (-845.120) (-843.361) * [-842.566] (-846.764) (-844.480) (-843.331) -- 0:00:32
480000 -- [-845.270] (-847.443) (-844.185) (-845.222) * (-841.901) [-845.593] (-844.415) (-844.742) -- 0:00:32
Average standard deviation of split frequencies: 0.013730
480500 -- [-842.480] (-844.552) (-844.257) (-843.624) * (-842.447) (-844.104) (-842.872) [-842.857] -- 0:00:32
481000 -- (-842.909) [-846.727] (-847.934) (-844.857) * (-849.609) (-846.042) (-844.297) [-843.380] -- 0:00:32
481500 -- (-842.850) [-846.707] (-846.266) (-845.466) * [-844.054] (-842.091) (-843.785) (-842.962) -- 0:00:32
482000 -- (-842.310) (-850.583) [-842.758] (-843.181) * (-843.987) (-842.722) [-842.575] (-843.466) -- 0:00:32
482500 -- (-843.633) (-844.541) [-843.069] (-843.379) * (-845.072) [-842.738] (-844.682) (-842.964) -- 0:00:32
483000 -- [-842.800] (-844.092) (-843.020) (-844.257) * (-843.039) (-843.090) [-843.213] (-843.929) -- 0:00:32
483500 -- (-842.232) (-843.236) [-849.920] (-845.878) * (-842.249) (-844.919) [-843.777] (-844.471) -- 0:00:32
484000 -- (-844.243) (-845.732) [-845.462] (-843.668) * [-842.249] (-845.799) (-843.093) (-846.542) -- 0:00:31
484500 -- [-842.407] (-846.848) (-845.730) (-843.144) * (-843.242) (-850.662) (-847.698) [-843.529] -- 0:00:31
485000 -- (-844.599) (-842.850) [-848.583] (-846.516) * (-842.688) (-844.018) (-842.608) [-843.445] -- 0:00:31
Average standard deviation of split frequencies: 0.013522
485500 -- (-846.250) [-843.258] (-847.241) (-845.459) * (-845.716) (-844.078) [-843.133] (-843.719) -- 0:00:31
486000 -- (-842.653) (-845.060) (-846.783) [-842.348] * [-843.578] (-844.705) (-843.594) (-847.960) -- 0:00:31
486500 -- (-844.263) (-843.232) [-842.777] (-842.551) * (-843.751) (-844.180) [-846.311] (-848.051) -- 0:00:31
487000 -- (-843.955) [-842.628] (-843.131) (-842.233) * (-842.969) [-843.955] (-849.174) (-846.740) -- 0:00:31
487500 -- (-843.088) [-843.824] (-844.401) (-844.215) * [-843.523] (-843.951) (-846.795) (-843.881) -- 0:00:31
488000 -- (-842.702) (-844.854) [-844.181] (-844.476) * (-844.922) (-844.963) (-845.629) [-845.539] -- 0:00:31
488500 -- (-845.916) [-844.225] (-847.291) (-842.252) * (-843.052) [-846.883] (-848.535) (-844.923) -- 0:00:31
489000 -- (-846.603) (-845.375) [-847.173] (-844.435) * (-845.518) [-843.206] (-849.748) (-844.042) -- 0:00:31
489500 -- (-848.019) (-846.264) [-844.910] (-849.935) * (-845.376) (-845.820) (-853.573) [-843.657] -- 0:00:31
490000 -- (-844.165) (-846.301) [-844.761] (-846.403) * (-842.904) (-842.433) (-844.193) [-844.043] -- 0:00:31
Average standard deviation of split frequencies: 0.012716
490500 -- (-844.262) (-845.049) [-844.145] (-842.815) * [-842.288] (-842.777) (-845.440) (-843.701) -- 0:00:31
491000 -- (-842.422) (-845.580) (-842.273) [-843.409] * (-843.607) [-843.651] (-842.864) (-843.824) -- 0:00:31
491500 -- (-843.240) (-844.640) (-843.591) [-844.061] * [-843.600] (-844.824) (-844.534) (-844.099) -- 0:00:31
492000 -- [-845.996] (-846.594) (-846.088) (-844.052) * (-843.142) [-843.749] (-843.257) (-843.136) -- 0:00:30
492500 -- [-844.919] (-847.918) (-844.539) (-846.843) * (-845.287) [-842.575] (-842.364) (-844.281) -- 0:00:30
493000 -- [-845.968] (-844.813) (-844.644) (-847.097) * [-844.703] (-844.787) (-847.912) (-843.148) -- 0:00:30
493500 -- (-845.969) (-843.349) (-844.650) [-842.447] * (-846.224) (-844.341) (-844.606) [-846.697] -- 0:00:30
494000 -- (-843.442) (-844.156) [-846.590] (-843.716) * (-847.489) (-844.983) (-842.203) [-844.964] -- 0:00:31
494500 -- (-842.142) [-847.118] (-845.848) (-845.534) * (-844.571) (-843.828) [-847.163] (-845.551) -- 0:00:31
495000 -- [-843.352] (-843.529) (-842.331) (-842.152) * (-844.120) (-846.839) [-845.014] (-845.243) -- 0:00:31
Average standard deviation of split frequencies: 0.012467
495500 -- (-844.819) [-846.262] (-845.422) (-844.001) * (-843.711) (-843.233) (-843.099) [-843.325] -- 0:00:31
496000 -- (-846.218) [-843.615] (-844.483) (-842.397) * [-843.588] (-842.790) (-843.513) (-843.293) -- 0:00:31
496500 -- (-842.805) (-842.972) (-844.330) [-846.413] * [-845.060] (-843.186) (-847.692) (-843.296) -- 0:00:31
497000 -- [-844.066] (-844.416) (-842.896) (-847.084) * (-844.579) (-845.231) (-849.708) [-842.219] -- 0:00:31
497500 -- (-845.270) (-844.902) (-844.899) [-846.136] * (-845.177) [-846.846] (-843.622) (-844.019) -- 0:00:31
498000 -- (-844.470) (-842.342) (-847.805) [-846.713] * [-844.677] (-843.876) (-849.292) (-843.756) -- 0:00:31
498500 -- (-844.867) (-843.435) (-848.029) [-843.246] * (-844.254) (-846.002) [-845.757] (-843.981) -- 0:00:31
499000 -- [-843.509] (-845.034) (-848.283) (-845.833) * [-842.710] (-848.169) (-842.793) (-845.921) -- 0:00:31
499500 -- (-842.873) [-844.576] (-847.545) (-843.742) * [-843.165] (-845.123) (-845.149) (-843.095) -- 0:00:31
500000 -- (-842.225) (-845.014) (-848.155) [-848.780] * [-846.027] (-850.354) (-844.568) (-845.215) -- 0:00:31
Average standard deviation of split frequencies: 0.012849
500500 -- (-847.385) (-843.580) [-842.346] (-844.499) * (-845.256) (-845.190) [-843.837] (-842.443) -- 0:00:30
501000 -- (-846.788) [-842.784] (-845.603) (-845.838) * (-843.109) (-844.099) [-842.925] (-844.611) -- 0:00:30
501500 -- (-846.843) (-842.929) [-842.808] (-845.048) * (-842.879) (-842.623) (-844.813) [-845.161] -- 0:00:30
502000 -- (-843.046) (-844.072) [-842.463] (-843.653) * (-842.317) (-845.128) (-844.365) [-847.151] -- 0:00:30
502500 -- (-843.529) (-843.355) [-845.793] (-845.147) * (-848.655) (-847.275) [-845.436] (-845.352) -- 0:00:30
503000 -- (-846.011) [-846.407] (-848.336) (-842.564) * [-847.855] (-843.934) (-844.393) (-844.024) -- 0:00:30
503500 -- (-844.200) (-843.892) (-845.661) [-845.542] * (-848.604) (-845.810) [-843.572] (-844.489) -- 0:00:30
504000 -- (-845.612) (-844.050) [-843.303] (-844.787) * (-843.421) [-843.317] (-844.467) (-847.168) -- 0:00:30
504500 -- (-845.418) [-844.557] (-842.153) (-847.176) * (-842.755) (-842.791) (-842.136) [-848.127] -- 0:00:30
505000 -- (-843.651) (-844.272) [-845.368] (-843.597) * (-843.145) (-844.465) [-842.419] (-842.988) -- 0:00:30
Average standard deviation of split frequencies: 0.012111
505500 -- [-843.847] (-843.662) (-847.091) (-844.702) * [-843.576] (-842.005) (-845.465) (-843.155) -- 0:00:30
506000 -- (-844.545) (-845.177) (-847.689) [-843.473] * (-844.811) (-843.713) (-844.700) [-843.302] -- 0:00:30
506500 -- [-845.188] (-845.218) (-846.029) (-843.584) * [-843.938] (-842.467) (-843.339) (-843.271) -- 0:00:30
507000 -- [-843.013] (-844.330) (-845.818) (-847.504) * [-844.574] (-843.043) (-846.263) (-847.260) -- 0:00:30
507500 -- [-848.348] (-844.751) (-843.277) (-842.748) * (-843.753) [-842.480] (-843.497) (-847.798) -- 0:00:30
508000 -- (-845.133) [-846.329] (-843.479) (-844.092) * (-844.758) (-844.389) [-842.201] (-844.230) -- 0:00:30
508500 -- (-843.562) (-845.833) (-843.377) [-843.074] * (-845.892) (-844.482) [-842.753] (-844.587) -- 0:00:29
509000 -- [-844.880] (-846.012) (-847.938) (-843.255) * [-844.539] (-844.581) (-844.253) (-844.059) -- 0:00:29
509500 -- (-844.658) [-845.796] (-842.873) (-846.175) * [-843.859] (-845.827) (-843.037) (-844.186) -- 0:00:29
510000 -- (-845.452) (-843.645) [-844.356] (-846.420) * (-844.197) (-842.806) (-843.332) [-844.287] -- 0:00:30
Average standard deviation of split frequencies: 0.011366
510500 -- (-846.288) [-844.776] (-844.331) (-848.449) * (-843.310) [-845.939] (-842.826) (-845.203) -- 0:00:30
511000 -- (-843.137) (-843.340) (-844.740) [-844.299] * (-843.424) (-846.080) [-846.198] (-847.095) -- 0:00:30
511500 -- [-845.293] (-843.881) (-844.831) (-846.479) * (-846.159) (-844.954) [-846.377] (-844.204) -- 0:00:30
512000 -- (-845.494) (-844.415) [-847.431] (-843.173) * (-842.712) (-850.976) (-846.052) [-844.027] -- 0:00:30
512500 -- (-844.894) [-843.942] (-844.380) (-843.520) * (-842.199) [-842.482] (-845.037) (-844.088) -- 0:00:30
513000 -- (-843.693) (-841.892) (-846.167) [-845.035] * [-844.070] (-846.186) (-845.524) (-842.551) -- 0:00:30
513500 -- (-847.102) [-842.759] (-843.697) (-842.272) * (-845.527) [-843.296] (-844.750) (-843.580) -- 0:00:30
514000 -- (-845.356) (-842.942) [-845.968] (-851.544) * (-845.034) [-843.160] (-843.139) (-846.262) -- 0:00:30
514500 -- (-843.922) [-842.176] (-842.335) (-843.340) * (-842.607) (-842.021) (-843.628) [-845.173] -- 0:00:30
515000 -- (-843.802) [-850.563] (-842.390) (-844.935) * (-846.194) (-843.403) [-848.040] (-843.358) -- 0:00:30
Average standard deviation of split frequencies: 0.011534
515500 -- [-846.653] (-847.151) (-846.441) (-847.608) * (-845.841) (-843.250) (-845.633) [-843.173] -- 0:00:30
516000 -- [-846.105] (-859.269) (-845.062) (-844.020) * (-843.463) (-842.019) (-850.141) [-843.053] -- 0:00:30
516500 -- (-847.822) (-845.132) [-843.553] (-848.807) * (-843.084) (-845.565) (-851.747) [-844.514] -- 0:00:29
517000 -- (-844.366) (-843.613) [-842.716] (-842.296) * (-843.101) (-849.444) [-843.331] (-845.709) -- 0:00:29
517500 -- (-843.127) (-843.989) (-843.112) [-843.401] * (-846.271) [-851.350] (-842.848) (-844.023) -- 0:00:29
518000 -- (-843.786) (-844.195) (-844.499) [-842.424] * [-846.387] (-845.403) (-843.150) (-845.547) -- 0:00:29
518500 -- (-843.205) [-844.065] (-844.438) (-846.040) * [-843.157] (-843.425) (-843.065) (-848.237) -- 0:00:29
519000 -- [-844.258] (-847.001) (-845.831) (-843.226) * (-845.407) [-844.616] (-844.800) (-843.946) -- 0:00:29
519500 -- (-843.527) (-850.425) [-842.418] (-845.973) * (-845.389) (-842.863) [-843.474] (-842.685) -- 0:00:29
520000 -- (-842.384) (-844.174) [-843.399] (-846.333) * (-845.235) (-843.142) [-844.536] (-843.494) -- 0:00:29
Average standard deviation of split frequencies: 0.011544
520500 -- (-842.870) (-842.841) [-843.560] (-845.909) * (-843.068) [-846.757] (-843.889) (-845.285) -- 0:00:29
521000 -- [-844.194] (-843.622) (-844.231) (-844.714) * (-846.084) (-846.235) [-842.937] (-845.050) -- 0:00:29
521500 -- (-844.364) (-846.445) (-843.699) [-843.322] * (-842.695) (-844.546) (-844.531) [-842.692] -- 0:00:29
522000 -- (-843.863) [-845.696] (-844.183) (-846.161) * (-844.821) [-842.934] (-845.223) (-847.737) -- 0:00:29
522500 -- (-842.996) [-847.561] (-842.833) (-843.955) * (-846.150) (-844.884) (-845.770) [-843.186] -- 0:00:29
523000 -- (-842.864) (-844.836) (-843.209) [-844.007] * (-843.267) [-844.389] (-845.244) (-845.054) -- 0:00:29
523500 -- [-843.542] (-843.576) (-845.313) (-845.289) * (-843.230) (-844.194) (-850.428) [-843.316] -- 0:00:29
524000 -- (-843.215) (-845.290) (-843.697) [-843.080] * (-843.310) (-842.258) [-844.510] (-843.747) -- 0:00:29
524500 -- (-848.038) (-842.334) (-844.724) [-843.121] * (-842.529) (-844.538) [-844.409] (-842.836) -- 0:00:29
525000 -- (-843.808) (-842.788) (-843.283) [-845.057] * (-842.468) [-842.711] (-843.200) (-846.970) -- 0:00:28
Average standard deviation of split frequencies: 0.011598
525500 -- (-843.745) [-845.713] (-844.209) (-844.169) * (-846.813) [-844.667] (-843.476) (-846.849) -- 0:00:28
526000 -- (-848.528) (-844.390) (-844.110) [-843.402] * (-842.685) (-843.890) (-842.967) [-847.137] -- 0:00:28
526500 -- (-846.365) (-842.350) [-844.219] (-843.904) * [-843.364] (-847.098) (-847.329) (-844.844) -- 0:00:29
527000 -- (-845.582) [-843.515] (-845.096) (-845.729) * (-847.308) (-845.739) (-848.025) [-846.058] -- 0:00:29
527500 -- (-845.136) (-842.607) [-842.983] (-842.930) * (-846.386) [-844.284] (-845.386) (-845.086) -- 0:00:29
528000 -- (-846.269) (-842.761) (-842.480) [-842.696] * (-846.436) [-844.521] (-844.374) (-846.372) -- 0:00:29
528500 -- (-842.459) [-842.811] (-845.136) (-843.477) * (-846.899) (-846.208) [-843.959] (-847.250) -- 0:00:29
529000 -- (-842.813) [-842.613] (-843.762) (-842.533) * [-843.129] (-843.683) (-843.283) (-845.102) -- 0:00:29
529500 -- (-843.118) [-843.790] (-843.544) (-846.243) * [-843.057] (-845.116) (-842.734) (-843.494) -- 0:00:29
530000 -- (-844.548) (-844.245) (-843.104) [-843.729] * [-846.019] (-843.202) (-843.060) (-844.913) -- 0:00:29
Average standard deviation of split frequencies: 0.011937
530500 -- (-841.937) (-842.348) (-843.450) [-846.467] * (-846.913) (-842.457) (-842.009) [-845.614] -- 0:00:29
531000 -- (-843.990) [-841.947] (-845.550) (-846.298) * (-844.929) [-843.001] (-843.187) (-842.309) -- 0:00:29
531500 -- [-843.789] (-842.963) (-844.946) (-843.743) * (-845.885) [-843.567] (-844.035) (-843.976) -- 0:00:29
532000 -- (-844.836) (-845.106) [-842.858] (-845.959) * [-843.623] (-845.547) (-843.928) (-844.609) -- 0:00:29
532500 -- (-844.774) [-845.106] (-843.188) (-843.638) * (-843.875) (-843.118) (-849.481) [-846.855] -- 0:00:28
533000 -- (-845.357) (-846.594) (-843.996) [-844.709] * (-847.771) [-842.875] (-844.285) (-842.545) -- 0:00:28
533500 -- [-844.883] (-846.080) (-844.419) (-843.085) * (-845.223) (-843.101) (-845.369) [-843.910] -- 0:00:28
534000 -- [-847.652] (-847.954) (-844.207) (-844.303) * [-843.238] (-843.623) (-842.538) (-844.287) -- 0:00:28
534500 -- [-847.259] (-852.572) (-843.410) (-843.230) * (-843.060) (-843.214) (-843.967) [-843.344] -- 0:00:28
535000 -- [-844.598] (-846.724) (-845.501) (-845.335) * (-842.540) (-843.474) [-845.810] (-843.682) -- 0:00:28
Average standard deviation of split frequencies: 0.011589
535500 -- [-842.596] (-847.153) (-843.961) (-842.632) * (-842.547) [-844.582] (-844.573) (-843.042) -- 0:00:28
536000 -- (-845.672) (-847.055) [-844.108] (-843.383) * [-843.816] (-845.821) (-842.615) (-844.958) -- 0:00:28
536500 -- (-843.618) (-847.813) [-842.717] (-848.020) * (-845.717) (-843.960) (-844.190) [-843.106] -- 0:00:28
537000 -- (-847.078) (-842.579) [-845.415] (-844.895) * [-843.825] (-846.520) (-847.753) (-843.035) -- 0:00:28
537500 -- (-844.855) (-846.536) [-844.174] (-846.150) * (-847.396) [-847.248] (-842.463) (-842.342) -- 0:00:28
538000 -- (-844.463) (-845.265) (-843.788) [-842.402] * [-845.005] (-844.867) (-846.591) (-843.121) -- 0:00:28
538500 -- (-845.264) (-845.324) (-847.667) [-842.757] * (-847.322) [-842.332] (-844.540) (-842.555) -- 0:00:28
539000 -- (-849.296) (-843.958) (-843.785) [-845.020] * (-842.882) (-847.757) (-842.967) [-842.801] -- 0:00:28
539500 -- (-843.417) (-849.000) [-842.602] (-844.229) * (-842.380) (-843.204) (-848.441) [-845.827] -- 0:00:28
540000 -- (-843.429) (-842.853) (-843.557) [-843.410] * (-847.952) [-844.350] (-845.683) (-849.521) -- 0:00:28
Average standard deviation of split frequencies: 0.012479
540500 -- (-847.223) (-842.507) (-844.536) [-843.976] * [-843.561] (-844.019) (-843.345) (-847.996) -- 0:00:28
541000 -- (-848.282) (-843.680) (-845.475) [-845.438] * (-843.771) (-844.627) [-842.607] (-846.251) -- 0:00:27
541500 -- [-844.981] (-843.543) (-844.195) (-842.688) * (-844.643) (-843.519) [-842.755] (-849.135) -- 0:00:27
542000 -- (-845.526) (-842.563) [-843.664] (-845.107) * (-843.914) [-845.361] (-844.152) (-847.504) -- 0:00:27
542500 -- (-847.151) [-842.628] (-844.286) (-845.085) * [-842.421] (-843.546) (-845.325) (-847.338) -- 0:00:27
543000 -- (-845.180) (-842.885) [-846.238] (-845.077) * (-844.952) (-842.853) [-842.918] (-847.394) -- 0:00:28
543500 -- (-844.293) (-844.113) [-846.612] (-845.747) * (-843.236) (-842.913) (-843.956) [-846.232] -- 0:00:28
544000 -- (-844.279) [-844.495] (-845.680) (-844.757) * (-842.689) [-843.515] (-849.478) (-843.210) -- 0:00:28
544500 -- (-845.845) [-843.070] (-845.622) (-842.897) * [-842.116] (-844.377) (-844.772) (-844.279) -- 0:00:28
545000 -- (-842.393) [-842.671] (-842.043) (-842.866) * [-842.683] (-845.365) (-843.748) (-844.847) -- 0:00:28
Average standard deviation of split frequencies: 0.011833
545500 -- (-844.695) [-843.247] (-842.392) (-842.240) * (-848.109) (-845.558) [-846.604] (-844.966) -- 0:00:28
546000 -- [-843.970] (-844.114) (-842.695) (-847.321) * (-844.884) (-844.993) (-846.080) [-844.609] -- 0:00:28
546500 -- [-844.157] (-842.450) (-843.883) (-842.693) * (-843.862) (-844.251) (-845.971) [-843.401] -- 0:00:28
547000 -- (-842.306) (-844.607) [-844.542] (-850.025) * (-845.361) [-844.085] (-844.417) (-845.656) -- 0:00:28
547500 -- (-842.849) [-842.823] (-846.742) (-844.072) * (-843.839) (-844.950) (-844.215) [-842.729] -- 0:00:28
548000 -- (-842.122) (-843.336) (-845.046) [-842.435] * (-842.637) (-846.509) [-843.341] (-842.882) -- 0:00:28
548500 -- (-843.057) [-843.571] (-846.532) (-849.376) * (-846.022) (-846.875) (-842.653) [-843.965] -- 0:00:27
549000 -- (-846.141) (-844.207) (-845.299) [-847.484] * (-844.242) (-846.153) [-845.025] (-843.326) -- 0:00:27
549500 -- (-844.767) [-843.594] (-843.283) (-845.494) * (-843.590) (-845.048) (-844.675) [-843.432] -- 0:00:27
550000 -- (-845.695) (-842.922) [-844.686] (-844.454) * (-847.887) (-845.957) (-845.872) [-842.705] -- 0:00:27
Average standard deviation of split frequencies: 0.011078
550500 -- (-844.764) [-844.935] (-847.422) (-843.775) * (-844.614) (-843.487) [-847.478] (-843.071) -- 0:00:27
551000 -- (-843.221) [-844.552] (-846.796) (-846.447) * [-844.746] (-843.896) (-847.989) (-845.431) -- 0:00:27
551500 -- (-841.928) [-844.560] (-845.402) (-842.921) * (-842.949) [-844.392] (-842.525) (-847.068) -- 0:00:27
552000 -- (-842.106) (-845.704) (-845.511) [-847.497] * [-843.152] (-844.048) (-843.762) (-843.909) -- 0:00:27
552500 -- [-847.140] (-843.819) (-843.445) (-844.585) * (-843.680) (-844.236) (-846.715) [-843.255] -- 0:00:27
553000 -- (-846.671) (-844.144) (-842.880) [-843.566] * [-844.753] (-842.598) (-843.521) (-843.050) -- 0:00:27
553500 -- (-850.082) (-842.550) [-841.945] (-843.988) * [-843.300] (-843.729) (-843.016) (-844.166) -- 0:00:27
554000 -- (-843.132) [-842.453] (-843.094) (-845.351) * [-843.153] (-843.231) (-843.246) (-843.462) -- 0:00:27
554500 -- (-848.735) (-846.159) [-844.386] (-843.465) * [-847.795] (-845.369) (-844.591) (-842.720) -- 0:00:27
555000 -- (-848.136) (-845.898) (-844.354) [-842.708] * (-848.626) (-843.364) [-844.124] (-842.924) -- 0:00:27
Average standard deviation of split frequencies: 0.010545
555500 -- [-842.981] (-845.790) (-843.883) (-841.916) * (-843.243) (-844.210) (-846.521) [-842.358] -- 0:00:27
556000 -- (-845.507) (-844.031) (-843.467) [-844.318] * (-845.427) [-842.307] (-845.135) (-845.080) -- 0:00:27
556500 -- (-842.302) [-846.460] (-845.313) (-844.519) * (-844.078) [-847.238] (-843.777) (-843.062) -- 0:00:27
557000 -- (-843.954) (-842.027) (-845.128) [-845.040] * [-843.288] (-842.981) (-843.603) (-843.164) -- 0:00:27
557500 -- (-842.969) (-844.365) (-848.106) [-843.204] * (-846.686) (-843.405) (-843.331) [-842.091] -- 0:00:26
558000 -- [-845.905] (-843.905) (-842.546) (-843.086) * (-843.789) [-845.783] (-842.838) (-844.412) -- 0:00:26
558500 -- (-843.244) [-844.675] (-847.247) (-846.435) * (-846.708) (-844.382) [-842.536] (-844.451) -- 0:00:26
559000 -- (-843.890) (-844.606) [-843.803] (-845.633) * (-845.476) (-843.307) [-844.551] (-842.055) -- 0:00:26
559500 -- (-843.209) (-842.916) (-842.965) [-846.497] * [-843.846] (-842.667) (-843.536) (-844.711) -- 0:00:27
560000 -- [-843.407] (-843.376) (-843.628) (-846.700) * [-843.909] (-847.163) (-844.256) (-843.649) -- 0:00:27
Average standard deviation of split frequencies: 0.010878
560500 -- [-842.244] (-842.784) (-848.821) (-843.349) * (-844.691) [-845.854] (-847.336) (-844.278) -- 0:00:27
561000 -- (-846.887) (-844.212) (-845.119) [-845.247] * (-845.401) (-844.113) [-844.354] (-843.582) -- 0:00:27
561500 -- (-843.156) (-843.684) (-845.555) [-843.100] * (-845.244) [-843.294] (-843.532) (-845.994) -- 0:00:27
562000 -- (-843.395) (-843.328) [-843.996] (-842.586) * (-842.219) (-843.108) (-844.477) [-847.578] -- 0:00:27
562500 -- [-843.475] (-846.449) (-844.387) (-842.864) * (-843.088) (-847.685) [-842.212] (-845.619) -- 0:00:27
563000 -- (-847.266) (-843.935) (-843.158) [-843.750] * (-843.188) (-844.040) (-842.017) [-842.682] -- 0:00:27
563500 -- (-846.998) (-842.579) (-844.290) [-843.308] * (-844.243) [-844.163] (-844.167) (-844.785) -- 0:00:27
564000 -- (-842.238) [-843.263] (-843.263) (-845.310) * (-844.280) (-843.619) (-843.316) [-843.868] -- 0:00:27
564500 -- (-844.591) (-842.293) [-843.177] (-844.156) * (-843.027) (-844.072) [-847.207] (-842.013) -- 0:00:27
565000 -- (-844.643) (-843.423) (-843.294) [-846.363] * (-844.311) (-843.468) [-843.683] (-845.293) -- 0:00:26
Average standard deviation of split frequencies: 0.009847
565500 -- (-843.355) (-844.190) [-846.625] (-848.118) * [-842.782] (-845.825) (-845.532) (-845.674) -- 0:00:26
566000 -- (-846.546) [-845.921] (-846.983) (-844.882) * (-842.944) (-843.420) (-845.776) [-843.317] -- 0:00:26
566500 -- (-846.747) [-845.691] (-849.424) (-843.384) * [-844.061] (-842.719) (-844.095) (-843.846) -- 0:00:26
567000 -- [-845.067] (-843.418) (-847.164) (-848.879) * (-844.597) [-843.802] (-845.304) (-845.047) -- 0:00:26
567500 -- [-842.791] (-850.851) (-845.341) (-847.040) * (-845.316) (-844.727) [-843.367] (-846.661) -- 0:00:26
568000 -- [-843.731] (-847.136) (-848.927) (-844.282) * [-844.225] (-848.094) (-845.523) (-843.889) -- 0:00:26
568500 -- [-845.753] (-847.166) (-845.143) (-843.133) * (-844.192) (-844.135) (-844.103) [-844.573] -- 0:00:26
569000 -- [-842.361] (-842.983) (-843.759) (-843.698) * (-846.292) [-846.224] (-842.898) (-844.435) -- 0:00:26
569500 -- (-842.777) [-843.681] (-843.256) (-846.079) * [-842.176] (-844.122) (-842.869) (-846.410) -- 0:00:26
570000 -- (-843.198) [-843.021] (-844.882) (-844.162) * [-842.705] (-844.463) (-842.979) (-846.058) -- 0:00:26
Average standard deviation of split frequencies: 0.010016
570500 -- [-846.122] (-843.995) (-843.257) (-842.505) * (-844.286) (-844.286) [-846.122] (-844.969) -- 0:00:26
571000 -- (-842.915) (-844.990) (-846.432) [-843.519] * (-842.496) (-845.609) (-847.178) [-845.004] -- 0:00:26
571500 -- [-843.181] (-843.783) (-849.983) (-845.807) * [-843.574] (-848.018) (-847.260) (-845.008) -- 0:00:26
572000 -- (-849.914) (-844.846) [-842.207] (-852.748) * (-845.953) [-843.798] (-843.824) (-843.983) -- 0:00:26
572500 -- (-844.488) (-846.205) (-844.260) [-848.203] * (-846.726) (-842.595) (-847.626) [-843.985] -- 0:00:26
573000 -- (-849.151) [-844.881] (-844.165) (-843.201) * (-845.559) [-843.948] (-845.445) (-844.120) -- 0:00:26
573500 -- (-841.997) (-848.006) [-842.764] (-844.211) * (-846.079) (-842.453) [-842.435] (-842.645) -- 0:00:26
574000 -- [-844.481] (-848.048) (-843.590) (-847.688) * (-843.344) (-843.586) (-842.493) [-842.913] -- 0:00:25
574500 -- [-845.481] (-844.015) (-844.267) (-846.431) * (-843.980) (-843.657) [-843.423] (-845.082) -- 0:00:25
575000 -- [-844.141] (-846.385) (-845.215) (-843.828) * [-844.064] (-844.306) (-844.247) (-843.337) -- 0:00:25
Average standard deviation of split frequencies: 0.009923
575500 -- [-848.155] (-845.577) (-843.738) (-843.941) * [-847.776] (-843.869) (-845.670) (-842.967) -- 0:00:26
576000 -- (-843.529) (-843.288) [-851.357] (-845.077) * [-845.387] (-844.206) (-846.130) (-843.719) -- 0:00:26
576500 -- (-845.629) (-847.049) [-845.374] (-844.629) * (-843.900) (-847.809) (-849.521) [-843.166] -- 0:00:26
577000 -- [-844.566] (-847.386) (-845.037) (-845.403) * (-843.157) [-844.177] (-851.066) (-845.722) -- 0:00:26
577500 -- (-843.334) (-843.160) [-843.869] (-844.196) * (-843.723) [-843.078] (-844.566) (-844.350) -- 0:00:26
578000 -- [-843.461] (-842.186) (-843.819) (-843.414) * (-844.605) [-843.637] (-847.102) (-844.024) -- 0:00:26
578500 -- (-844.917) (-843.712) (-843.722) [-844.122] * (-842.946) [-844.645] (-844.264) (-844.736) -- 0:00:26
579000 -- (-842.482) [-846.747] (-843.851) (-844.680) * (-844.280) (-845.582) (-849.556) [-843.722] -- 0:00:26
579500 -- (-842.499) [-845.221] (-845.383) (-844.011) * (-844.246) (-845.252) (-844.187) [-843.753] -- 0:00:26
580000 -- (-846.170) (-844.503) [-847.296] (-845.153) * (-844.982) (-847.166) (-845.032) [-843.864] -- 0:00:26
Average standard deviation of split frequencies: 0.009945
580500 -- (-844.862) [-843.630] (-843.804) (-843.251) * (-844.284) (-843.993) [-842.837] (-844.182) -- 0:00:26
581000 -- (-845.277) [-843.811] (-846.735) (-849.588) * (-848.112) [-842.629] (-845.831) (-842.551) -- 0:00:25
581500 -- (-844.119) (-844.251) (-845.030) [-843.660] * (-843.026) (-844.322) [-842.803] (-842.951) -- 0:00:25
582000 -- (-843.333) (-847.676) (-843.037) [-845.793] * [-848.056] (-843.887) (-845.436) (-843.555) -- 0:00:25
582500 -- (-846.010) [-844.778] (-843.151) (-846.153) * (-845.524) [-842.899] (-844.350) (-844.383) -- 0:00:25
583000 -- (-843.616) [-844.698] (-843.185) (-842.868) * (-843.465) [-845.924] (-844.723) (-842.755) -- 0:00:25
583500 -- (-843.697) (-849.446) (-845.136) [-843.687] * (-842.922) (-843.897) (-846.134) [-844.431] -- 0:00:25
584000 -- [-847.178] (-847.643) (-844.278) (-842.897) * (-844.250) (-846.322) (-845.986) [-843.272] -- 0:00:25
584500 -- (-843.787) (-842.721) [-845.984] (-843.223) * (-843.500) (-844.326) (-847.218) [-843.247] -- 0:00:25
585000 -- (-849.074) [-844.374] (-846.845) (-847.685) * (-846.977) [-844.129] (-845.414) (-844.250) -- 0:00:25
Average standard deviation of split frequencies: 0.009653
585500 -- (-846.654) [-842.802] (-849.005) (-843.227) * (-845.084) [-845.108] (-844.552) (-846.760) -- 0:00:25
586000 -- (-844.003) (-843.620) [-847.439] (-843.906) * (-853.954) (-845.985) [-843.696] (-845.196) -- 0:00:25
586500 -- (-842.877) (-842.043) [-846.968] (-843.136) * (-843.724) (-847.418) [-842.603] (-842.147) -- 0:00:25
587000 -- (-843.087) (-842.101) (-843.459) [-844.109] * (-844.668) (-844.888) [-848.160] (-842.156) -- 0:00:25
587500 -- (-842.369) (-842.510) [-842.920] (-845.092) * (-843.533) (-845.087) [-844.106] (-844.750) -- 0:00:25
588000 -- [-846.111] (-843.792) (-843.858) (-846.007) * [-844.071] (-844.698) (-847.139) (-844.861) -- 0:00:25
588500 -- (-847.427) [-846.023] (-844.504) (-847.984) * [-842.144] (-845.066) (-846.015) (-846.884) -- 0:00:25
589000 -- (-842.547) (-844.122) [-849.890] (-843.951) * (-842.809) [-846.456] (-845.815) (-844.525) -- 0:00:25
589500 -- [-842.395] (-847.052) (-844.117) (-843.848) * (-842.427) (-845.419) (-845.377) [-844.823] -- 0:00:25
590000 -- (-845.092) (-850.499) (-843.925) [-842.276] * (-842.562) (-844.356) [-843.940] (-845.369) -- 0:00:25
Average standard deviation of split frequencies: 0.009876
590500 -- (-847.917) (-843.230) [-845.719] (-843.202) * (-844.859) (-843.179) [-842.331] (-846.576) -- 0:00:24
591000 -- (-846.526) [-851.479] (-844.262) (-843.319) * (-845.071) [-842.105] (-842.707) (-842.419) -- 0:00:24
591500 -- (-844.727) (-847.114) [-844.388] (-844.934) * (-843.263) (-842.710) [-845.056] (-845.317) -- 0:00:24
592000 -- (-843.636) [-844.841] (-846.019) (-842.749) * (-845.470) (-849.512) [-844.095] (-849.825) -- 0:00:25
592500 -- (-845.010) (-844.813) (-842.637) [-843.537] * (-843.296) (-846.159) (-844.804) [-846.660] -- 0:00:25
593000 -- (-843.088) (-845.672) (-843.224) [-842.444] * (-843.952) (-845.968) (-843.702) [-843.908] -- 0:00:25
593500 -- (-843.158) [-844.005] (-843.142) (-844.892) * (-842.668) (-843.353) [-844.185] (-842.438) -- 0:00:25
594000 -- (-842.597) (-845.584) (-844.304) [-844.460] * (-844.553) (-843.002) [-843.284] (-843.908) -- 0:00:25
594500 -- (-844.218) (-843.786) [-842.781] (-847.083) * [-845.206] (-844.777) (-842.853) (-844.724) -- 0:00:25
595000 -- [-844.026] (-844.549) (-846.166) (-845.874) * (-844.670) [-844.021] (-846.089) (-845.731) -- 0:00:25
Average standard deviation of split frequencies: 0.009294
595500 -- (-845.437) (-842.848) [-843.939] (-845.237) * [-848.482] (-842.605) (-847.515) (-846.591) -- 0:00:25
596000 -- (-843.313) [-844.653] (-842.657) (-844.614) * (-847.196) (-846.424) (-842.479) [-843.756] -- 0:00:25
596500 -- (-844.118) (-843.326) [-843.312] (-843.213) * (-845.660) (-843.010) [-842.909] (-843.898) -- 0:00:25
597000 -- (-842.988) [-845.694] (-843.438) (-843.257) * (-845.535) (-845.196) [-843.641] (-843.826) -- 0:00:24
597500 -- (-842.116) (-844.178) [-844.212] (-841.777) * (-843.615) (-842.876) (-846.602) [-845.037] -- 0:00:24
598000 -- (-843.806) (-845.014) [-842.179] (-844.702) * (-842.499) (-844.074) [-844.418] (-847.103) -- 0:00:24
598500 -- [-845.329] (-853.613) (-843.368) (-843.165) * [-845.241] (-845.008) (-848.120) (-846.249) -- 0:00:24
599000 -- (-843.433) (-844.780) [-842.955] (-842.905) * (-844.243) (-846.391) (-846.065) [-844.756] -- 0:00:24
599500 -- (-843.615) (-843.469) (-846.213) [-842.740] * [-847.809] (-844.657) (-844.480) (-844.808) -- 0:00:24
600000 -- (-842.535) [-842.922] (-846.401) (-843.681) * (-844.952) [-842.334] (-842.945) (-843.901) -- 0:00:24
Average standard deviation of split frequencies: 0.009908
600500 -- [-842.581] (-843.406) (-846.869) (-843.695) * (-846.205) (-846.244) (-842.775) [-847.748] -- 0:00:24
601000 -- [-843.067] (-843.436) (-842.868) (-844.505) * (-845.107) (-852.980) [-842.075] (-843.562) -- 0:00:24
601500 -- (-846.207) (-844.746) [-847.276] (-842.202) * [-842.975] (-848.392) (-844.313) (-847.238) -- 0:00:24
602000 -- [-843.299] (-843.394) (-846.396) (-842.674) * (-843.237) [-845.030] (-845.251) (-845.668) -- 0:00:24
602500 -- (-842.922) (-844.676) (-846.040) [-843.149] * [-842.913] (-846.403) (-844.302) (-849.695) -- 0:00:24
603000 -- (-842.247) (-845.822) (-843.372) [-845.596] * (-844.726) (-845.188) [-844.088] (-845.363) -- 0:00:24
603500 -- (-844.576) (-847.141) (-844.013) [-848.782] * (-845.206) (-845.515) (-843.521) [-843.394] -- 0:00:24
604000 -- (-846.623) [-844.247] (-848.031) (-845.069) * (-843.859) [-844.216] (-842.465) (-842.043) -- 0:00:24
604500 -- (-846.591) (-842.859) [-847.980] (-842.024) * [-844.092] (-848.245) (-845.644) (-847.322) -- 0:00:24
605000 -- (-851.128) (-844.443) (-844.139) [-842.658] * (-843.736) (-848.799) (-842.604) [-845.135] -- 0:00:24
Average standard deviation of split frequencies: 0.009481
605500 -- (-846.131) [-843.537] (-843.800) (-842.827) * [-846.868] (-842.435) (-844.553) (-845.626) -- 0:00:24
606000 -- (-843.957) (-843.645) [-844.066] (-845.711) * (-846.482) [-841.989] (-844.786) (-847.755) -- 0:00:24
606500 -- (-842.273) (-845.019) (-844.121) [-844.353] * (-847.623) (-842.504) (-843.147) [-843.385] -- 0:00:24
607000 -- (-844.623) (-844.520) [-846.520] (-843.332) * [-846.106] (-842.498) (-843.671) (-843.142) -- 0:00:23
607500 -- (-844.021) [-843.081] (-843.506) (-843.389) * (-844.466) (-843.694) [-847.034] (-845.727) -- 0:00:23
608000 -- [-843.156] (-844.494) (-842.452) (-846.051) * (-842.627) [-843.405] (-850.469) (-845.094) -- 0:00:23
608500 -- (-843.551) (-843.537) [-843.901] (-843.547) * (-844.109) [-846.374] (-845.895) (-845.135) -- 0:00:24
609000 -- (-843.357) (-844.715) (-842.990) [-843.452] * (-843.437) (-841.881) (-848.822) [-843.652] -- 0:00:24
609500 -- (-844.453) (-843.743) (-843.070) [-843.445] * [-847.337] (-842.507) (-848.540) (-843.599) -- 0:00:24
610000 -- (-844.293) (-844.236) (-842.312) [-842.373] * [-846.380] (-844.022) (-843.244) (-846.843) -- 0:00:24
Average standard deviation of split frequencies: 0.009746
610500 -- (-848.600) (-846.072) [-844.377] (-842.999) * (-849.869) [-841.971] (-842.124) (-844.077) -- 0:00:24
611000 -- (-845.451) [-848.619] (-841.960) (-845.389) * (-844.471) (-843.446) [-844.144] (-846.387) -- 0:00:24
611500 -- (-843.102) (-844.791) [-843.129] (-843.530) * (-848.411) [-844.990] (-842.990) (-845.262) -- 0:00:24
612000 -- [-844.929] (-842.702) (-842.922) (-842.572) * (-846.626) (-844.050) [-843.124] (-844.006) -- 0:00:24
612500 -- (-843.228) [-842.319] (-844.037) (-845.861) * [-846.676] (-843.983) (-842.787) (-848.143) -- 0:00:24
613000 -- (-842.685) (-844.005) [-843.071] (-846.234) * (-845.550) [-844.059] (-843.536) (-845.881) -- 0:00:23
613500 -- (-842.785) [-844.263] (-842.536) (-841.872) * [-842.981] (-842.874) (-846.791) (-850.687) -- 0:00:23
614000 -- (-842.961) (-846.284) (-842.879) [-843.880] * (-845.141) [-842.770] (-850.484) (-842.854) -- 0:00:23
614500 -- (-845.707) (-851.455) [-843.116] (-843.489) * (-845.532) (-843.557) [-845.848] (-843.387) -- 0:00:23
615000 -- [-845.910] (-843.161) (-845.118) (-843.096) * [-842.850] (-843.017) (-847.648) (-842.704) -- 0:00:23
Average standard deviation of split frequencies: 0.009279
615500 -- (-844.854) (-848.084) (-842.228) [-842.440] * [-842.970] (-847.769) (-843.937) (-842.410) -- 0:00:23
616000 -- (-844.345) (-844.018) (-841.943) [-843.074] * (-844.552) (-845.066) (-843.837) [-844.404] -- 0:00:23
616500 -- (-843.349) (-845.617) [-842.987] (-844.915) * (-843.967) (-845.276) (-842.602) [-843.812] -- 0:00:23
617000 -- (-845.908) (-848.095) (-844.015) [-843.957] * (-843.852) (-844.241) [-843.728] (-842.773) -- 0:00:23
617500 -- (-844.688) (-846.230) (-844.989) [-844.223] * (-844.451) (-843.352) (-845.336) [-843.955] -- 0:00:23
618000 -- (-843.117) (-847.585) [-845.725] (-843.768) * (-843.248) (-843.791) [-843.012] (-845.000) -- 0:00:23
618500 -- [-845.680] (-846.618) (-845.088) (-847.641) * [-846.877] (-844.070) (-845.360) (-847.409) -- 0:00:23
619000 -- (-844.194) (-844.564) [-843.755] (-847.465) * (-846.088) (-844.237) (-843.942) [-844.416] -- 0:00:23
619500 -- (-843.764) [-842.855] (-843.139) (-844.447) * (-850.909) [-843.908] (-844.264) (-845.641) -- 0:00:23
620000 -- (-844.244) [-842.976] (-844.351) (-842.655) * (-851.194) (-844.377) [-843.104] (-842.837) -- 0:00:23
Average standard deviation of split frequencies: 0.008639
620500 -- (-842.650) (-844.028) [-842.689] (-843.904) * (-843.565) (-844.964) [-843.364] (-842.537) -- 0:00:23
621000 -- (-842.813) (-843.130) (-843.793) [-845.459] * (-844.227) [-844.166] (-844.386) (-844.074) -- 0:00:23
621500 -- [-844.767] (-844.263) (-842.841) (-843.335) * (-845.171) (-844.287) (-843.512) [-845.974] -- 0:00:23
622000 -- (-844.514) [-844.037] (-847.394) (-848.699) * (-844.149) (-842.516) (-843.861) [-845.871] -- 0:00:23
622500 -- (-846.837) (-844.596) [-842.152] (-847.159) * (-842.277) (-842.488) [-842.905] (-844.526) -- 0:00:23
623000 -- (-847.242) (-845.261) [-841.999] (-846.679) * (-843.044) [-843.652] (-847.814) (-845.982) -- 0:00:22
623500 -- (-845.287) (-845.900) [-842.375] (-846.607) * [-845.271] (-847.705) (-849.087) (-845.325) -- 0:00:22
624000 -- (-843.070) (-852.256) (-845.135) [-845.475] * (-844.077) [-844.101] (-843.049) (-843.734) -- 0:00:22
624500 -- [-843.270] (-843.524) (-844.479) (-843.307) * (-844.320) (-842.826) [-843.273] (-846.049) -- 0:00:23
625000 -- (-846.764) (-843.568) [-843.094] (-844.783) * (-844.345) (-843.653) [-842.067] (-847.537) -- 0:00:23
Average standard deviation of split frequencies: 0.008848
625500 -- (-843.489) [-843.577] (-845.390) (-845.661) * (-843.818) (-844.245) (-842.771) [-842.204] -- 0:00:23
626000 -- (-843.709) (-847.081) [-845.278] (-846.971) * (-845.529) (-844.257) [-843.381] (-843.951) -- 0:00:23
626500 -- [-843.246] (-845.788) (-843.782) (-849.093) * (-846.201) (-843.005) [-845.126] (-846.286) -- 0:00:23
627000 -- (-842.215) [-846.542] (-843.448) (-846.496) * (-843.924) [-842.383] (-847.529) (-843.426) -- 0:00:23
627500 -- (-843.824) (-849.044) (-846.962) [-845.014] * [-842.946] (-844.627) (-846.800) (-845.217) -- 0:00:23
628000 -- (-844.404) (-843.671) [-843.500] (-844.579) * (-842.660) (-844.658) (-844.879) [-844.775] -- 0:00:23
628500 -- [-844.075] (-843.764) (-844.509) (-848.307) * (-843.469) [-843.150] (-842.988) (-849.715) -- 0:00:23
629000 -- (-843.340) (-846.098) [-843.680] (-843.416) * (-842.669) (-846.950) [-844.837] (-844.630) -- 0:00:23
629500 -- (-844.615) [-844.064] (-844.226) (-847.728) * (-845.786) (-845.810) (-847.411) [-844.636] -- 0:00:22
630000 -- (-844.722) [-844.321] (-843.393) (-842.657) * [-842.110] (-843.546) (-848.533) (-844.588) -- 0:00:22
Average standard deviation of split frequencies: 0.009277
630500 -- [-842.526] (-843.521) (-843.082) (-843.177) * (-842.278) (-843.727) [-847.563] (-843.577) -- 0:00:22
631000 -- (-847.591) (-847.008) (-843.856) [-842.504] * (-843.404) [-842.332] (-842.392) (-842.142) -- 0:00:22
631500 -- (-844.930) [-844.836] (-842.446) (-842.157) * (-843.595) [-841.859] (-843.368) (-846.405) -- 0:00:22
632000 -- [-846.636] (-842.976) (-843.827) (-847.651) * (-842.309) [-843.624] (-843.956) (-844.697) -- 0:00:22
632500 -- [-843.589] (-844.086) (-846.596) (-844.648) * (-842.859) [-842.656] (-842.226) (-844.785) -- 0:00:22
633000 -- [-844.635] (-843.939) (-843.445) (-843.069) * [-843.075] (-846.650) (-844.508) (-847.850) -- 0:00:22
633500 -- [-844.047] (-847.023) (-844.417) (-842.128) * (-846.870) (-842.531) [-842.952] (-847.941) -- 0:00:22
634000 -- (-846.208) [-844.378] (-844.101) (-847.331) * (-844.519) [-843.482] (-842.698) (-845.154) -- 0:00:22
634500 -- (-846.979) (-846.434) (-842.873) [-842.711] * (-844.429) [-843.733] (-842.862) (-844.767) -- 0:00:22
635000 -- (-842.716) (-846.520) [-842.762] (-845.822) * (-848.776) (-845.731) (-843.683) [-842.553] -- 0:00:22
Average standard deviation of split frequencies: 0.008894
635500 -- [-844.269] (-849.736) (-843.618) (-842.352) * (-850.522) (-850.601) [-842.922] (-843.183) -- 0:00:22
636000 -- [-844.618] (-845.505) (-845.054) (-842.356) * (-843.983) [-846.819] (-842.997) (-843.427) -- 0:00:22
636500 -- [-843.572] (-844.630) (-844.040) (-842.762) * (-842.649) (-844.883) (-846.616) [-844.693] -- 0:00:22
637000 -- [-847.630] (-844.945) (-844.155) (-843.216) * (-848.039) (-842.415) [-844.083] (-845.234) -- 0:00:22
637500 -- (-844.031) (-842.800) (-846.984) [-842.366] * (-846.520) (-846.364) [-845.843] (-844.354) -- 0:00:22
638000 -- (-844.832) [-842.512] (-847.935) (-844.221) * (-843.779) [-843.343] (-842.791) (-844.441) -- 0:00:22
638500 -- (-845.703) [-843.637] (-842.545) (-844.803) * (-844.905) (-844.308) [-845.627] (-843.347) -- 0:00:22
639000 -- [-844.527] (-843.609) (-845.013) (-843.521) * [-844.072] (-842.660) (-845.252) (-846.340) -- 0:00:22
639500 -- (-843.292) (-843.490) [-843.566] (-844.172) * (-844.081) (-842.151) [-845.598] (-845.976) -- 0:00:21
640000 -- (-844.090) (-842.236) (-843.815) [-844.326] * (-846.101) [-843.329] (-849.778) (-844.571) -- 0:00:21
Average standard deviation of split frequencies: 0.007772
640500 -- (-843.648) (-842.556) (-844.126) [-843.870] * (-845.490) [-842.512] (-845.563) (-843.891) -- 0:00:21
641000 -- (-843.251) [-843.800] (-843.899) (-843.823) * (-845.486) (-845.724) [-845.983] (-842.190) -- 0:00:22
641500 -- (-846.917) [-842.566] (-842.531) (-842.134) * (-843.447) (-844.983) (-846.199) [-842.706] -- 0:00:22
642000 -- (-843.459) (-843.182) (-845.844) [-843.512] * (-845.483) [-844.501] (-844.143) (-843.327) -- 0:00:22
642500 -- (-842.707) (-843.583) (-844.785) [-843.394] * (-842.579) (-844.463) (-844.198) [-843.319] -- 0:00:22
643000 -- (-842.965) (-842.448) [-843.232] (-842.724) * (-843.999) (-843.751) (-851.725) [-844.011] -- 0:00:22
643500 -- (-843.819) [-842.417] (-843.347) (-844.412) * (-842.838) (-843.128) [-848.130] (-843.780) -- 0:00:22
644000 -- [-844.341] (-843.259) (-843.706) (-843.726) * (-844.246) (-844.736) [-848.110] (-845.242) -- 0:00:22
644500 -- [-844.298] (-849.052) (-847.890) (-845.597) * [-842.189] (-844.186) (-843.674) (-844.937) -- 0:00:22
645000 -- (-843.500) (-848.382) (-845.369) [-842.931] * (-849.328) (-842.307) [-843.150] (-843.330) -- 0:00:22
Average standard deviation of split frequencies: 0.007936
645500 -- (-845.768) [-843.007] (-843.713) (-844.291) * (-849.385) [-843.313] (-843.087) (-844.672) -- 0:00:21
646000 -- (-845.298) (-843.952) [-843.154] (-844.942) * (-843.651) (-847.473) [-845.551] (-844.134) -- 0:00:21
646500 -- (-844.532) (-842.614) [-842.082] (-847.408) * [-846.062] (-843.621) (-845.574) (-843.690) -- 0:00:21
647000 -- [-847.068] (-843.621) (-843.507) (-846.384) * (-849.182) [-843.421] (-848.409) (-842.168) -- 0:00:21
647500 -- (-843.073) [-845.760] (-846.433) (-847.427) * (-843.605) [-846.198] (-844.851) (-841.950) -- 0:00:21
648000 -- [-844.116] (-845.210) (-844.768) (-847.542) * [-844.280] (-843.060) (-849.058) (-843.316) -- 0:00:21
648500 -- (-843.878) (-842.523) [-843.104] (-844.240) * [-843.047] (-845.986) (-844.756) (-843.908) -- 0:00:21
649000 -- (-844.468) [-846.971] (-843.007) (-843.782) * [-842.072] (-846.058) (-843.887) (-844.700) -- 0:00:21
649500 -- (-842.201) (-844.954) (-843.730) [-843.070] * (-844.490) (-845.855) [-844.375] (-845.047) -- 0:00:21
650000 -- (-843.644) [-842.759] (-842.725) (-844.186) * (-845.638) [-842.458] (-845.456) (-845.904) -- 0:00:21
Average standard deviation of split frequencies: 0.007652
650500 -- [-844.225] (-845.194) (-842.368) (-844.592) * (-845.235) (-842.751) [-846.798] (-845.192) -- 0:00:21
651000 -- (-847.117) (-842.048) (-845.294) [-845.419] * (-846.155) (-846.255) [-844.023] (-843.564) -- 0:00:21
651500 -- (-850.332) [-848.393] (-845.190) (-842.968) * (-844.405) (-846.613) (-845.389) [-843.754] -- 0:00:21
652000 -- (-845.769) (-849.255) (-843.721) [-842.206] * [-843.294] (-843.083) (-843.075) (-845.238) -- 0:00:21
652500 -- (-844.276) (-848.925) (-842.140) [-842.665] * (-843.089) [-842.366] (-842.977) (-845.392) -- 0:00:21
653000 -- (-844.458) [-841.919] (-845.320) (-843.902) * [-843.335] (-843.552) (-843.105) (-845.427) -- 0:00:21
653500 -- (-843.292) [-844.933] (-843.065) (-847.169) * (-843.495) (-842.363) [-848.628] (-843.155) -- 0:00:21
654000 -- (-844.709) (-843.340) (-846.108) [-843.846] * (-849.527) [-842.861] (-842.456) (-842.925) -- 0:00:21
654500 -- (-842.628) (-843.892) (-844.074) [-842.962] * (-843.871) [-842.925] (-843.789) (-843.451) -- 0:00:21
655000 -- [-843.003] (-846.959) (-844.090) (-846.271) * [-845.322] (-843.620) (-846.087) (-846.393) -- 0:00:21
Average standard deviation of split frequencies: 0.007276
655500 -- (-842.488) (-844.988) (-844.196) [-842.543] * (-844.304) (-842.184) (-843.602) [-849.440] -- 0:00:21
656000 -- (-848.360) (-844.552) (-843.975) [-843.173] * (-843.915) (-843.780) (-843.473) [-850.664] -- 0:00:20
656500 -- [-842.746] (-844.052) (-842.917) (-846.297) * (-845.195) (-843.075) [-844.100] (-845.582) -- 0:00:20
657000 -- [-849.716] (-846.319) (-843.163) (-846.294) * (-842.516) (-844.882) [-844.338] (-845.685) -- 0:00:20
657500 -- (-844.182) (-846.552) (-843.946) [-842.521] * [-842.257] (-843.900) (-842.667) (-847.060) -- 0:00:20
658000 -- (-845.490) (-850.842) [-843.340] (-842.969) * (-842.343) (-845.322) [-842.654] (-843.801) -- 0:00:21
658500 -- (-845.771) (-842.826) [-842.118] (-843.124) * (-843.976) (-842.269) (-848.431) [-842.703] -- 0:00:21
659000 -- (-844.290) [-843.534] (-843.195) (-844.162) * (-844.655) (-842.606) [-846.091] (-843.856) -- 0:00:21
659500 -- (-842.806) [-844.578] (-847.714) (-844.179) * (-847.343) (-843.516) (-844.293) [-842.237] -- 0:00:21
660000 -- [-844.060] (-843.251) (-843.165) (-842.440) * (-845.829) (-843.548) [-843.453] (-845.142) -- 0:00:21
Average standard deviation of split frequencies: 0.007723
660500 -- (-843.676) [-842.208] (-842.928) (-849.348) * (-847.168) [-843.252] (-845.316) (-842.837) -- 0:00:21
661000 -- (-844.914) (-843.283) [-844.198] (-843.373) * (-843.469) [-843.176] (-844.049) (-843.126) -- 0:00:21
661500 -- [-844.372] (-844.385) (-842.473) (-842.651) * (-844.431) (-849.680) [-843.556] (-843.312) -- 0:00:20
662000 -- (-846.201) [-842.850] (-846.625) (-852.912) * (-842.255) (-845.457) [-847.458] (-842.921) -- 0:00:20
662500 -- (-845.870) [-845.982] (-846.005) (-843.862) * (-843.658) (-844.926) (-846.494) [-847.251] -- 0:00:20
663000 -- (-843.122) (-844.129) [-843.294] (-846.023) * (-843.979) (-845.025) [-843.850] (-848.498) -- 0:00:20
663500 -- [-845.754] (-845.217) (-843.103) (-842.726) * (-848.641) [-846.535] (-844.377) (-846.788) -- 0:00:20
664000 -- (-843.931) [-842.992] (-845.111) (-843.134) * [-846.561] (-848.583) (-844.428) (-846.902) -- 0:00:20
664500 -- (-846.716) (-843.000) (-843.313) [-843.403] * [-843.388] (-849.325) (-845.009) (-843.864) -- 0:00:20
665000 -- (-843.012) (-846.208) (-843.384) [-843.622] * (-846.027) (-851.437) [-847.459] (-842.978) -- 0:00:20
Average standard deviation of split frequencies: 0.007286
665500 -- (-843.870) (-843.259) [-843.067] (-843.240) * (-846.430) [-843.065] (-846.046) (-845.818) -- 0:00:20
666000 -- (-843.311) (-846.265) (-845.275) [-843.726] * [-844.919] (-842.202) (-844.658) (-842.780) -- 0:00:20
666500 -- (-845.152) (-843.556) (-846.185) [-843.553] * (-846.659) (-843.402) [-842.231] (-843.243) -- 0:00:20
667000 -- [-843.609] (-842.932) (-846.086) (-843.572) * (-842.570) [-844.244] (-845.832) (-842.786) -- 0:00:20
667500 -- (-848.124) [-846.354] (-846.563) (-843.152) * (-841.843) [-845.043] (-842.850) (-843.570) -- 0:00:20
668000 -- (-848.556) (-844.521) [-846.141] (-843.272) * (-844.390) (-845.778) (-845.013) [-844.336] -- 0:00:20
668500 -- (-844.640) (-843.700) [-846.213] (-842.629) * (-845.584) (-842.807) [-844.421] (-842.899) -- 0:00:20
669000 -- (-843.573) (-847.729) [-842.358] (-842.411) * (-844.649) (-843.229) (-844.294) [-846.589] -- 0:00:20
669500 -- (-842.647) [-844.348] (-844.260) (-846.163) * (-843.209) [-842.665] (-843.512) (-842.177) -- 0:00:20
670000 -- [-843.230] (-846.400) (-843.920) (-847.324) * (-849.287) (-846.232) (-843.243) [-842.065] -- 0:00:20
Average standard deviation of split frequencies: 0.007194
670500 -- [-844.160] (-845.389) (-844.104) (-843.238) * (-845.951) [-843.551] (-846.045) (-844.316) -- 0:00:20
671000 -- (-843.073) (-845.702) (-844.748) [-844.301] * [-848.750] (-845.068) (-842.445) (-844.404) -- 0:00:20
671500 -- (-843.894) (-844.255) (-849.194) [-842.692] * (-845.600) (-846.582) (-844.543) [-842.540] -- 0:00:20
672000 -- (-845.709) [-843.002] (-843.607) (-845.740) * [-847.099] (-844.197) (-842.406) (-848.022) -- 0:00:20
672500 -- (-842.137) (-847.071) [-844.726] (-845.823) * (-846.253) (-843.689) [-842.861] (-845.064) -- 0:00:19
673000 -- (-844.837) (-842.629) (-843.011) [-843.760] * (-843.897) [-844.931] (-847.499) (-844.117) -- 0:00:19
673500 -- (-844.498) [-842.991] (-842.817) (-843.249) * [-843.416] (-843.717) (-843.669) (-845.173) -- 0:00:19
674000 -- (-847.363) (-843.573) [-843.369] (-842.097) * [-843.493] (-842.893) (-846.002) (-843.878) -- 0:00:19
674500 -- (-843.057) (-843.575) (-844.055) [-843.318] * (-843.010) (-843.724) [-844.552] (-843.373) -- 0:00:20
675000 -- (-846.768) (-844.789) [-846.986] (-843.080) * (-845.517) [-845.050] (-844.235) (-844.298) -- 0:00:20
Average standard deviation of split frequencies: 0.007191
675500 -- [-845.497] (-846.521) (-844.465) (-843.818) * (-845.348) (-847.025) [-845.830] (-844.579) -- 0:00:20
676000 -- (-848.150) [-844.079] (-843.674) (-843.514) * (-843.200) (-847.170) (-845.623) [-842.209] -- 0:00:20
676500 -- (-846.846) (-846.356) (-847.159) [-842.147] * (-847.532) (-844.564) [-843.436] (-841.811) -- 0:00:20
677000 -- [-844.307] (-843.448) (-849.366) (-843.932) * (-849.295) (-843.338) [-845.183] (-843.871) -- 0:00:20
677500 -- [-843.301] (-842.424) (-851.435) (-843.703) * (-845.629) (-844.485) (-844.038) [-844.477] -- 0:00:19
678000 -- (-844.093) (-843.141) [-841.967] (-851.887) * (-844.850) (-846.675) (-843.418) [-845.423] -- 0:00:19
678500 -- (-844.592) [-843.209] (-841.951) (-847.906) * (-845.242) (-844.305) [-843.872] (-843.890) -- 0:00:19
679000 -- (-843.932) (-844.129) [-842.741] (-845.502) * (-843.850) [-844.644] (-842.430) (-844.059) -- 0:00:19
679500 -- [-842.587] (-844.377) (-842.305) (-843.646) * [-845.536] (-842.782) (-845.996) (-842.197) -- 0:00:19
680000 -- (-843.807) (-844.423) [-844.800] (-844.239) * [-845.883] (-845.593) (-850.793) (-844.706) -- 0:00:19
Average standard deviation of split frequencies: 0.006969
680500 -- [-844.818] (-843.175) (-844.813) (-843.208) * [-843.669] (-844.085) (-846.754) (-844.451) -- 0:00:19
681000 -- (-845.585) [-845.248] (-844.324) (-845.208) * (-845.682) (-846.049) [-846.503] (-843.950) -- 0:00:19
681500 -- (-845.295) (-842.893) (-844.309) [-845.778] * (-844.342) [-843.442] (-843.151) (-844.090) -- 0:00:19
682000 -- (-847.317) (-843.792) (-842.924) [-845.135] * (-842.593) (-843.004) [-844.816] (-842.776) -- 0:00:19
682500 -- [-844.146] (-844.691) (-842.994) (-843.426) * (-842.191) (-846.631) [-844.300] (-843.121) -- 0:00:19
683000 -- [-846.434] (-845.826) (-844.431) (-843.606) * (-843.444) [-845.289] (-842.480) (-843.333) -- 0:00:19
683500 -- (-844.336) [-846.308] (-844.628) (-843.497) * [-843.656] (-844.569) (-845.468) (-844.060) -- 0:00:19
684000 -- (-842.864) [-846.543] (-843.279) (-845.995) * (-847.138) (-844.870) [-843.299] (-845.645) -- 0:00:19
684500 -- (-842.666) (-842.789) (-844.135) [-843.028] * (-842.685) (-847.176) (-842.898) [-844.327] -- 0:00:19
685000 -- (-842.698) (-842.471) (-845.622) [-843.322] * (-842.192) (-846.582) [-846.185] (-849.426) -- 0:00:19
Average standard deviation of split frequencies: 0.007357
685500 -- (-847.548) (-844.051) [-846.518] (-842.841) * (-842.160) (-844.857) [-845.204] (-847.854) -- 0:00:19
686000 -- [-844.769] (-843.857) (-844.127) (-842.091) * [-842.368] (-843.427) (-844.768) (-847.103) -- 0:00:19
686500 -- (-843.064) [-846.437] (-845.739) (-843.102) * [-841.912] (-846.584) (-843.917) (-844.155) -- 0:00:19
687000 -- (-844.094) (-843.343) [-843.290] (-842.503) * (-842.601) (-843.557) [-843.779] (-844.466) -- 0:00:19
687500 -- (-844.446) (-843.849) (-842.944) [-843.896] * [-845.712] (-843.269) (-847.130) (-843.909) -- 0:00:19
688000 -- (-844.775) (-843.162) (-843.282) [-842.650] * (-847.163) (-848.546) [-845.021] (-842.487) -- 0:00:19
688500 -- [-843.992] (-843.784) (-842.549) (-846.241) * (-842.685) [-843.280] (-849.122) (-844.829) -- 0:00:19
689000 -- [-844.658] (-842.465) (-843.762) (-845.379) * (-844.008) (-846.571) (-848.447) [-842.651] -- 0:00:18
689500 -- (-842.957) (-849.241) [-842.813] (-844.961) * (-845.004) (-844.228) [-849.454] (-843.852) -- 0:00:18
690000 -- (-847.059) [-848.212] (-845.580) (-843.975) * [-843.625] (-842.051) (-847.568) (-849.564) -- 0:00:18
Average standard deviation of split frequencies: 0.007508
690500 -- (-842.615) [-844.305] (-842.583) (-844.852) * (-844.777) (-843.716) [-844.769] (-843.278) -- 0:00:18
691000 -- (-842.645) (-845.932) [-843.336] (-844.787) * (-845.126) (-844.974) (-843.207) [-842.822] -- 0:00:19
691500 -- (-843.055) [-846.584] (-842.721) (-846.796) * [-842.534] (-844.234) (-843.827) (-845.760) -- 0:00:19
692000 -- [-845.618] (-846.545) (-844.993) (-845.897) * (-845.719) [-846.944] (-843.093) (-843.946) -- 0:00:19
692500 -- [-843.617] (-842.792) (-846.461) (-848.414) * (-846.199) (-850.329) [-843.311] (-848.523) -- 0:00:19
693000 -- (-845.902) (-844.408) [-842.721] (-842.880) * (-845.622) (-846.187) [-844.513] (-844.098) -- 0:00:19
693500 -- [-843.890] (-844.825) (-843.279) (-844.413) * [-842.463] (-845.300) (-843.532) (-843.774) -- 0:00:19
694000 -- [-844.174] (-845.220) (-842.380) (-844.543) * (-843.395) (-845.645) [-843.588] (-845.200) -- 0:00:18
694500 -- (-844.395) (-844.663) [-844.175] (-843.173) * (-843.978) (-842.869) [-843.594] (-845.156) -- 0:00:18
695000 -- (-843.440) (-847.510) (-842.598) [-842.798] * (-843.757) [-843.599] (-844.648) (-846.098) -- 0:00:18
Average standard deviation of split frequencies: 0.007849
695500 -- (-843.042) (-843.059) (-843.563) [-842.271] * (-842.404) [-846.801] (-847.356) (-843.683) -- 0:00:18
696000 -- (-842.529) [-842.374] (-841.915) (-842.227) * (-842.386) (-845.295) [-845.708] (-844.996) -- 0:00:18
696500 -- (-842.887) (-845.064) [-844.332] (-844.584) * [-844.017] (-844.200) (-854.462) (-843.122) -- 0:00:18
697000 -- (-845.113) (-848.618) [-846.526] (-842.914) * [-845.910] (-845.789) (-844.721) (-843.067) -- 0:00:18
697500 -- [-842.400] (-844.038) (-843.995) (-847.691) * [-843.614] (-844.219) (-844.639) (-846.221) -- 0:00:18
698000 -- (-845.534) (-842.772) [-842.881] (-844.037) * (-843.821) (-845.738) (-844.916) [-845.384] -- 0:00:18
698500 -- [-843.952] (-842.167) (-845.183) (-845.626) * [-843.009] (-846.375) (-843.056) (-844.013) -- 0:00:18
699000 -- (-847.881) (-842.744) (-845.789) [-842.370] * [-844.323] (-846.619) (-848.610) (-843.186) -- 0:00:18
699500 -- (-847.241) (-842.350) (-851.695) [-844.076] * (-843.877) (-844.751) [-845.027] (-843.607) -- 0:00:18
700000 -- (-844.265) [-843.953] (-848.692) (-844.866) * (-844.884) (-843.269) [-844.744] (-844.515) -- 0:00:18
Average standard deviation of split frequencies: 0.008034
700500 -- (-846.416) [-846.107] (-844.770) (-844.272) * (-846.164) [-844.198] (-845.224) (-847.710) -- 0:00:18
701000 -- (-848.342) (-844.918) [-843.812] (-844.880) * (-845.099) (-845.323) (-844.402) [-844.272] -- 0:00:18
701500 -- (-845.545) (-843.231) [-845.213] (-845.731) * (-845.030) (-846.662) [-843.520] (-843.784) -- 0:00:18
702000 -- (-844.926) (-845.082) [-842.390] (-846.711) * (-847.254) (-844.406) (-852.670) [-842.921] -- 0:00:18
702500 -- (-844.611) (-845.742) (-843.059) [-845.039] * (-847.845) [-842.862] (-847.290) (-844.795) -- 0:00:18
703000 -- [-842.930] (-848.166) (-846.496) (-846.500) * [-845.588] (-845.300) (-843.144) (-844.791) -- 0:00:18
703500 -- (-842.670) [-845.048] (-845.173) (-844.259) * (-845.250) [-843.050] (-843.572) (-844.078) -- 0:00:18
704000 -- [-842.054] (-842.869) (-844.149) (-842.282) * (-843.639) (-846.626) [-843.433] (-845.303) -- 0:00:18
704500 -- [-844.346] (-847.254) (-848.278) (-843.215) * (-846.757) [-843.553] (-842.306) (-845.120) -- 0:00:18
705000 -- (-846.707) (-845.186) [-843.833] (-843.666) * (-852.079) (-842.317) [-842.320] (-845.148) -- 0:00:17
Average standard deviation of split frequencies: 0.007934
705500 -- [-845.552] (-844.649) (-843.824) (-846.553) * (-842.351) [-843.277] (-845.382) (-844.243) -- 0:00:17
706000 -- [-844.294] (-844.572) (-845.771) (-844.837) * (-842.953) [-843.541] (-848.222) (-844.299) -- 0:00:17
706500 -- (-843.810) (-845.068) (-846.160) [-842.437] * (-842.776) [-843.277] (-845.901) (-843.737) -- 0:00:17
707000 -- [-842.987] (-843.303) (-845.952) (-842.269) * (-844.330) (-842.173) [-844.330] (-842.651) -- 0:00:17
707500 -- (-845.964) (-845.587) (-845.499) [-841.891] * [-842.837] (-845.138) (-843.860) (-844.122) -- 0:00:18
708000 -- (-844.669) (-842.477) [-843.922] (-846.446) * (-842.576) (-845.470) (-843.829) [-844.533] -- 0:00:18
708500 -- [-846.912] (-842.166) (-845.607) (-842.492) * [-843.763] (-844.992) (-843.591) (-844.674) -- 0:00:18
709000 -- (-846.246) (-846.085) [-843.826] (-842.624) * [-845.440] (-842.986) (-845.337) (-844.026) -- 0:00:18
709500 -- (-843.682) (-849.601) (-842.493) [-845.329] * (-847.394) [-843.001] (-845.531) (-845.184) -- 0:00:18
710000 -- (-843.466) (-844.504) (-845.380) [-843.036] * [-844.353] (-843.802) (-844.775) (-844.494) -- 0:00:17
Average standard deviation of split frequencies: 0.008584
710500 -- [-842.989] (-844.043) (-842.886) (-848.610) * (-846.934) [-843.454] (-847.524) (-844.471) -- 0:00:17
711000 -- [-843.984] (-843.745) (-847.793) (-847.583) * (-842.832) (-845.251) (-845.079) [-843.698] -- 0:00:17
711500 -- [-843.751] (-847.523) (-843.848) (-846.425) * (-844.867) [-843.402] (-843.167) (-842.850) -- 0:00:17
712000 -- (-843.144) [-843.012] (-845.354) (-843.644) * (-844.252) (-845.983) [-842.815] (-841.945) -- 0:00:17
712500 -- (-843.050) (-843.817) [-843.966] (-842.461) * (-844.882) (-848.116) [-846.994] (-843.284) -- 0:00:17
713000 -- (-847.312) (-843.474) (-844.627) [-842.781] * (-845.519) [-844.052] (-842.753) (-843.962) -- 0:00:17
713500 -- (-846.073) (-842.430) [-845.270] (-842.803) * (-843.412) (-845.129) [-844.745] (-842.851) -- 0:00:17
714000 -- (-842.570) (-842.937) (-845.628) [-843.764] * (-843.323) [-844.582] (-844.067) (-843.986) -- 0:00:17
714500 -- (-844.890) [-843.384] (-844.638) (-842.582) * (-843.082) (-844.114) (-844.520) [-843.203] -- 0:00:17
715000 -- (-845.083) (-844.184) (-849.069) [-842.181] * (-843.018) (-845.133) [-846.221] (-843.572) -- 0:00:17
Average standard deviation of split frequencies: 0.008791
715500 -- [-843.430] (-843.081) (-848.577) (-845.928) * (-842.917) (-847.408) (-848.819) [-847.979] -- 0:00:17
716000 -- (-845.514) (-842.965) (-846.643) [-844.459] * (-842.240) (-842.327) [-842.758] (-848.247) -- 0:00:17
716500 -- (-845.152) (-846.189) [-846.623] (-847.030) * [-842.585] (-842.650) (-844.521) (-845.654) -- 0:00:17
717000 -- [-844.465] (-844.751) (-844.553) (-845.282) * (-842.726) [-843.790] (-844.442) (-844.569) -- 0:00:17
717500 -- [-842.708] (-842.854) (-842.556) (-848.232) * (-849.797) (-847.580) [-844.323] (-846.550) -- 0:00:17
718000 -- [-844.227] (-843.714) (-842.651) (-842.149) * (-844.882) (-845.500) (-844.485) [-844.163] -- 0:00:17
718500 -- (-844.980) (-846.285) (-844.163) [-844.850] * (-845.717) [-843.642] (-845.554) (-843.502) -- 0:00:17
719000 -- (-843.619) (-843.110) [-842.663] (-842.162) * (-843.300) (-844.270) [-846.484] (-844.669) -- 0:00:17
719500 -- (-845.960) (-847.085) (-843.026) [-843.111] * (-844.204) (-847.665) (-844.249) [-843.182] -- 0:00:17
720000 -- [-843.222] (-848.777) (-845.494) (-842.925) * (-844.009) (-844.907) [-843.480] (-843.072) -- 0:00:17
Average standard deviation of split frequencies: 0.008734
720500 -- (-844.698) (-844.856) (-842.904) [-845.080] * [-846.218] (-846.146) (-842.807) (-844.596) -- 0:00:17
721000 -- [-844.501] (-849.072) (-846.036) (-846.092) * (-844.028) [-844.815] (-845.313) (-845.136) -- 0:00:17
721500 -- (-842.617) (-845.356) [-844.697] (-842.897) * [-843.151] (-842.213) (-847.249) (-844.674) -- 0:00:16
722000 -- (-845.641) [-843.766] (-843.773) (-843.363) * (-843.017) (-844.122) [-842.747] (-843.775) -- 0:00:16
722500 -- [-847.970] (-843.927) (-844.742) (-844.043) * [-845.557] (-843.461) (-843.933) (-845.510) -- 0:00:16
723000 -- (-849.846) (-843.997) (-845.856) [-842.492] * (-842.491) (-846.072) (-843.033) [-844.944] -- 0:00:16
723500 -- (-844.973) (-842.375) [-845.218] (-845.517) * (-842.682) [-843.259] (-845.002) (-845.865) -- 0:00:16
724000 -- [-842.366] (-844.090) (-843.017) (-845.876) * (-842.212) (-842.878) (-844.012) [-844.443] -- 0:00:17
724500 -- (-843.540) [-843.719] (-842.900) (-846.219) * (-846.459) (-845.585) (-843.867) [-844.071] -- 0:00:17
725000 -- [-845.211] (-844.675) (-842.176) (-843.300) * (-843.353) (-844.027) [-844.227] (-844.213) -- 0:00:17
Average standard deviation of split frequencies: 0.008785
725500 -- (-844.540) (-845.571) [-843.596] (-844.013) * (-843.947) (-844.080) [-845.840] (-845.224) -- 0:00:17
726000 -- (-844.821) (-844.210) (-842.561) [-845.575] * (-842.432) (-844.478) (-845.432) [-845.527] -- 0:00:16
726500 -- [-843.305] (-845.424) (-844.979) (-849.055) * [-842.635] (-846.239) (-852.183) (-842.162) -- 0:00:16
727000 -- (-848.032) [-848.098] (-848.028) (-843.946) * [-844.722] (-844.103) (-844.571) (-843.004) -- 0:00:16
727500 -- (-845.769) (-848.877) (-846.039) [-844.841] * (-850.247) [-842.465] (-844.589) (-842.634) -- 0:00:16
728000 -- (-848.250) [-847.758] (-845.350) (-843.725) * (-849.582) [-844.416] (-844.668) (-843.585) -- 0:00:16
728500 -- (-844.497) (-844.005) (-844.899) [-846.137] * (-843.806) (-844.076) [-842.298] (-843.897) -- 0:00:16
729000 -- (-844.228) [-843.134] (-844.335) (-843.986) * (-844.955) (-844.243) [-842.278] (-843.911) -- 0:00:16
729500 -- (-845.824) [-843.288] (-844.697) (-842.776) * (-843.911) (-846.713) [-842.289] (-842.533) -- 0:00:16
730000 -- (-845.463) (-842.022) (-842.802) [-842.779] * [-843.496] (-845.922) (-842.083) (-842.467) -- 0:00:16
Average standard deviation of split frequencies: 0.009488
730500 -- (-845.121) [-843.256] (-841.754) (-844.254) * (-842.717) (-844.434) [-842.868] (-843.314) -- 0:00:16
731000 -- [-843.341] (-846.092) (-842.726) (-843.293) * (-843.362) (-843.551) [-844.640] (-843.076) -- 0:00:16
731500 -- (-845.296) (-846.662) [-842.726] (-844.141) * [-843.966] (-842.847) (-843.645) (-844.018) -- 0:00:16
732000 -- (-844.358) (-845.021) (-842.303) [-844.180] * [-844.554] (-848.502) (-842.815) (-843.593) -- 0:00:16
732500 -- (-845.660) [-844.437] (-845.327) (-844.986) * (-850.519) (-842.563) [-843.480] (-842.884) -- 0:00:16
733000 -- (-844.391) (-847.049) (-842.294) [-847.170] * (-852.198) (-845.867) [-847.861] (-846.595) -- 0:00:16
733500 -- (-844.679) [-847.951] (-844.501) (-845.902) * (-845.274) (-844.293) [-847.134] (-843.364) -- 0:00:16
734000 -- [-843.456] (-844.690) (-845.707) (-843.650) * (-846.282) [-844.016] (-845.823) (-845.846) -- 0:00:16
734500 -- (-842.730) [-845.217] (-845.696) (-842.900) * (-843.386) (-845.299) (-843.359) [-842.868] -- 0:00:16
735000 -- (-845.172) (-848.217) [-842.760] (-846.980) * (-842.738) (-843.916) (-843.204) [-844.743] -- 0:00:16
Average standard deviation of split frequencies: 0.009570
735500 -- (-846.169) (-843.421) (-847.669) [-843.339] * (-843.974) (-842.835) (-844.200) [-844.010] -- 0:00:16
736000 -- [-844.891] (-842.308) (-843.475) (-843.473) * (-843.321) (-842.290) [-844.452] (-842.312) -- 0:00:16
736500 -- (-843.960) (-842.316) [-845.131] (-843.770) * (-841.973) (-845.644) [-844.692] (-845.819) -- 0:00:16
737000 -- (-848.949) (-842.808) [-844.177] (-842.168) * (-843.027) (-846.039) (-843.712) [-845.763] -- 0:00:16
737500 -- (-842.500) [-843.396] (-844.290) (-844.471) * (-843.240) (-848.476) [-843.250] (-843.218) -- 0:00:16
738000 -- [-843.923] (-844.378) (-845.181) (-843.152) * (-842.100) (-846.293) [-843.741] (-843.144) -- 0:00:15
738500 -- (-842.632) (-844.376) [-842.572] (-844.679) * [-843.173] (-844.138) (-845.914) (-844.610) -- 0:00:15
739000 -- (-846.842) (-842.952) (-843.535) [-841.831] * (-846.733) [-845.546] (-845.954) (-846.232) -- 0:00:15
739500 -- (-843.799) (-848.318) (-844.644) [-842.398] * [-846.455] (-844.732) (-845.396) (-844.674) -- 0:00:15
740000 -- [-843.851] (-848.786) (-843.099) (-843.726) * (-843.582) (-845.099) (-844.722) [-842.485] -- 0:00:15
Average standard deviation of split frequencies: 0.009659
740500 -- (-845.140) [-847.111] (-844.379) (-845.282) * [-842.692] (-844.259) (-844.382) (-844.074) -- 0:00:16
741000 -- (-842.622) [-843.493] (-844.361) (-842.954) * (-842.468) [-846.962] (-845.467) (-843.619) -- 0:00:16
741500 -- (-844.177) (-843.747) [-843.476] (-842.348) * (-846.060) [-846.955] (-843.743) (-845.841) -- 0:00:16
742000 -- (-847.985) [-843.400] (-846.042) (-844.289) * (-847.658) (-842.748) (-842.587) [-844.869] -- 0:00:15
742500 -- (-843.801) [-843.190] (-847.234) (-844.519) * (-845.113) [-843.347] (-848.043) (-846.549) -- 0:00:15
743000 -- (-842.857) [-843.892] (-843.490) (-843.688) * [-845.270] (-845.979) (-848.640) (-844.376) -- 0:00:15
743500 -- (-842.941) (-843.799) [-845.765] (-842.880) * (-846.206) (-844.354) (-848.140) [-843.109] -- 0:00:15
744000 -- [-843.559] (-843.710) (-846.886) (-842.545) * (-847.050) (-845.949) (-845.103) [-842.661] -- 0:00:15
744500 -- (-843.840) (-844.054) [-845.996] (-843.656) * (-845.033) [-843.899] (-843.001) (-842.464) -- 0:00:15
745000 -- (-847.676) (-844.147) (-844.937) [-842.738] * [-844.069] (-845.299) (-842.720) (-842.591) -- 0:00:15
Average standard deviation of split frequencies: 0.009627
745500 -- (-845.948) (-842.354) [-842.527] (-845.378) * (-843.875) (-842.264) (-843.254) [-843.800] -- 0:00:15
746000 -- [-843.144] (-842.604) (-843.080) (-843.790) * (-847.469) (-845.314) [-842.637] (-842.911) -- 0:00:15
746500 -- (-844.970) (-848.777) [-844.348] (-844.691) * (-842.330) [-842.564] (-845.170) (-845.432) -- 0:00:15
747000 -- (-845.633) [-844.781] (-844.809) (-846.097) * (-843.034) (-847.034) (-842.762) [-842.743] -- 0:00:15
747500 -- (-842.962) [-844.007] (-848.174) (-848.061) * (-843.165) (-845.316) [-845.646] (-844.190) -- 0:00:15
748000 -- [-842.697] (-843.430) (-844.613) (-844.408) * (-844.751) (-845.039) (-844.777) [-844.110] -- 0:00:15
748500 -- (-844.876) [-846.076] (-845.228) (-844.852) * (-843.376) (-842.459) [-842.263] (-843.107) -- 0:00:15
749000 -- (-845.400) (-851.674) [-844.446] (-844.416) * [-845.157] (-843.618) (-842.402) (-844.370) -- 0:00:15
749500 -- (-843.850) (-846.929) (-844.724) [-845.880] * [-843.082] (-843.595) (-845.303) (-845.107) -- 0:00:15
750000 -- (-843.350) (-845.981) (-845.093) [-842.770] * [-847.312] (-843.734) (-844.173) (-845.891) -- 0:00:15
Average standard deviation of split frequencies: 0.009752
750500 -- [-843.171] (-845.067) (-844.184) (-842.715) * (-845.174) [-843.362] (-844.299) (-843.661) -- 0:00:15
751000 -- [-843.533] (-846.810) (-843.574) (-843.978) * (-844.451) [-844.267] (-843.223) (-843.958) -- 0:00:15
751500 -- (-842.530) (-844.531) (-843.794) [-844.318] * [-845.187] (-842.711) (-842.769) (-842.695) -- 0:00:15
752000 -- (-842.530) (-843.397) [-842.736] (-844.519) * (-843.418) (-843.089) [-842.994] (-844.351) -- 0:00:15
752500 -- [-843.589] (-842.902) (-844.271) (-843.849) * (-844.550) [-843.113] (-844.761) (-847.821) -- 0:00:15
753000 -- [-843.912] (-845.656) (-843.978) (-848.296) * [-845.932] (-842.673) (-842.573) (-842.304) -- 0:00:15
753500 -- (-844.208) (-843.944) (-845.871) [-843.107] * (-843.223) [-843.459] (-842.093) (-843.368) -- 0:00:15
754000 -- [-843.680] (-844.222) (-843.574) (-850.052) * (-843.504) (-844.915) [-842.411] (-845.371) -- 0:00:15
754500 -- (-844.099) (-842.864) [-842.875] (-844.010) * (-844.166) [-844.167] (-843.122) (-844.682) -- 0:00:14
755000 -- (-842.307) (-851.152) (-842.533) [-842.911] * [-842.704] (-842.154) (-842.714) (-842.826) -- 0:00:14
Average standard deviation of split frequencies: 0.009353
755500 -- [-842.891] (-844.638) (-845.464) (-843.421) * (-847.164) [-843.712] (-843.411) (-842.969) -- 0:00:14
756000 -- [-843.688] (-847.619) (-847.129) (-842.675) * (-843.824) (-844.110) [-842.860] (-842.766) -- 0:00:14
756500 -- [-844.861] (-844.409) (-844.288) (-845.392) * (-845.155) [-845.741] (-842.080) (-842.413) -- 0:00:14
757000 -- [-843.579] (-844.416) (-843.993) (-845.377) * [-843.731] (-844.655) (-843.267) (-846.799) -- 0:00:15
757500 -- (-844.986) [-844.028] (-844.627) (-846.450) * (-844.243) [-842.618] (-845.031) (-843.972) -- 0:00:15
758000 -- (-844.767) (-845.376) (-843.532) [-844.288] * (-843.357) [-843.307] (-845.849) (-844.157) -- 0:00:15
758500 -- (-843.630) [-843.088] (-844.921) (-844.593) * (-842.637) (-842.735) (-843.913) [-849.826] -- 0:00:14
759000 -- (-845.013) [-844.214] (-843.904) (-844.435) * (-843.288) [-844.498] (-842.329) (-846.501) -- 0:00:14
759500 -- [-843.823] (-843.779) (-842.725) (-842.948) * (-844.147) (-842.854) (-845.920) [-843.787] -- 0:00:14
760000 -- (-846.832) [-842.638] (-842.398) (-843.540) * (-842.539) [-844.137] (-843.855) (-846.750) -- 0:00:14
Average standard deviation of split frequencies: 0.009141
760500 -- (-844.382) (-843.386) [-842.508] (-843.143) * (-845.667) (-842.129) [-843.353] (-844.300) -- 0:00:14
761000 -- [-846.887] (-842.879) (-842.562) (-850.293) * (-843.059) (-841.865) (-843.269) [-846.863] -- 0:00:14
761500 -- (-844.482) [-844.259] (-842.916) (-845.909) * (-847.501) [-843.778] (-844.932) (-843.521) -- 0:00:14
762000 -- (-844.835) [-844.470] (-844.050) (-847.175) * (-846.805) (-842.826) [-844.327] (-844.088) -- 0:00:14
762500 -- (-843.798) (-843.157) [-845.772] (-843.501) * (-844.989) (-847.677) [-843.495] (-844.742) -- 0:00:14
763000 -- (-844.228) [-843.048] (-845.393) (-842.695) * (-848.523) (-842.628) [-843.148] (-845.321) -- 0:00:14
763500 -- (-843.277) (-842.376) (-848.124) [-844.074] * (-844.954) (-846.151) (-843.403) [-842.195] -- 0:00:14
764000 -- (-842.892) (-842.785) (-844.658) [-844.524] * [-844.117] (-843.305) (-844.506) (-842.417) -- 0:00:14
764500 -- (-843.467) (-844.899) [-844.563] (-843.012) * (-848.767) (-843.879) [-843.203] (-843.431) -- 0:00:14
765000 -- [-846.023] (-843.333) (-845.316) (-843.004) * (-843.600) (-843.238) (-843.206) [-843.842] -- 0:00:14
Average standard deviation of split frequencies: 0.008693
765500 -- (-842.987) [-842.630] (-846.354) (-843.171) * (-843.777) (-844.028) (-842.648) [-843.331] -- 0:00:14
766000 -- (-846.173) (-843.415) (-842.733) [-844.337] * (-845.867) (-843.306) (-843.778) [-842.573] -- 0:00:14
766500 -- (-849.780) [-843.674] (-843.390) (-842.758) * (-844.250) (-842.702) (-844.619) [-849.548] -- 0:00:14
767000 -- (-845.215) [-842.906] (-845.730) (-843.369) * (-843.963) (-845.582) (-842.739) [-845.030] -- 0:00:14
767500 -- [-846.154] (-842.823) (-843.492) (-845.402) * (-846.238) (-845.493) (-846.601) [-844.483] -- 0:00:14
768000 -- (-847.907) [-844.238] (-844.089) (-844.960) * [-842.720] (-846.494) (-843.930) (-844.077) -- 0:00:14
768500 -- [-843.634] (-843.141) (-842.791) (-846.255) * (-842.314) (-843.673) (-843.921) [-843.419] -- 0:00:14
769000 -- (-843.603) (-843.273) [-844.878] (-844.066) * (-843.795) (-844.493) (-843.478) [-844.028] -- 0:00:14
769500 -- (-848.009) [-843.336] (-845.396) (-842.034) * (-845.006) (-848.315) [-845.471] (-843.026) -- 0:00:14
770000 -- (-844.658) (-842.257) [-845.393] (-842.166) * (-842.373) (-847.359) [-842.811] (-843.889) -- 0:00:14
Average standard deviation of split frequencies: 0.008640
770500 -- (-842.573) (-843.711) [-843.588] (-843.194) * [-843.901] (-848.933) (-846.117) (-844.315) -- 0:00:13
771000 -- (-843.954) (-843.270) [-843.041] (-847.308) * (-845.353) [-848.120] (-846.222) (-846.906) -- 0:00:13
771500 -- (-844.230) (-847.431) [-847.476] (-847.469) * [-844.353] (-847.374) (-843.229) (-842.513) -- 0:00:13
772000 -- (-844.699) (-847.746) (-842.928) [-844.050] * (-844.419) [-843.782] (-846.508) (-844.060) -- 0:00:13
772500 -- (-845.102) (-844.237) [-842.575] (-843.249) * (-843.808) (-844.642) (-843.848) [-843.551] -- 0:00:13
773000 -- (-846.191) (-842.582) (-843.220) [-848.414] * (-843.970) [-844.236] (-842.184) (-843.202) -- 0:00:13
773500 -- [-842.961] (-844.840) (-846.560) (-843.408) * (-843.785) (-843.865) (-842.639) [-843.980] -- 0:00:14
774000 -- (-843.592) (-842.669) [-845.371] (-844.059) * (-842.705) (-842.992) [-842.425] (-845.126) -- 0:00:14
774500 -- [-844.618] (-842.941) (-848.369) (-844.925) * (-842.951) (-847.714) (-845.146) [-847.889] -- 0:00:13
775000 -- (-845.748) (-843.702) [-846.047] (-843.339) * (-843.245) (-843.898) [-843.814] (-844.864) -- 0:00:13
Average standard deviation of split frequencies: 0.008998
775500 -- (-846.680) (-846.702) [-842.531] (-845.679) * (-843.171) (-844.979) [-845.846] (-849.525) -- 0:00:13
776000 -- [-843.763] (-844.506) (-844.299) (-844.300) * (-847.911) (-847.227) [-845.620] (-843.562) -- 0:00:13
776500 -- [-845.660] (-845.956) (-844.427) (-845.676) * (-845.902) (-846.219) (-844.015) [-842.522] -- 0:00:13
777000 -- [-842.980] (-844.912) (-842.516) (-843.927) * [-847.531] (-847.025) (-846.687) (-843.214) -- 0:00:13
777500 -- [-843.898] (-846.301) (-843.260) (-843.921) * (-848.195) [-844.361] (-845.678) (-846.918) -- 0:00:13
778000 -- (-845.154) (-843.291) (-844.250) [-844.180] * (-845.378) (-842.445) [-842.629] (-844.178) -- 0:00:13
778500 -- (-844.167) (-845.531) [-844.019] (-847.988) * (-851.552) [-842.823] (-842.881) (-846.253) -- 0:00:13
779000 -- (-843.161) [-844.154] (-843.572) (-847.020) * (-846.326) (-845.654) (-845.813) [-843.886] -- 0:00:13
779500 -- (-843.191) (-846.002) [-843.246] (-842.070) * (-845.774) (-845.208) (-845.084) [-842.951] -- 0:00:13
780000 -- (-843.151) [-844.388] (-843.632) (-842.673) * (-845.027) (-848.317) (-846.464) [-843.928] -- 0:00:13
Average standard deviation of split frequencies: 0.009133
780500 -- (-846.619) (-842.774) (-843.647) [-846.591] * (-846.454) (-846.209) [-844.622] (-845.732) -- 0:00:13
781000 -- [-845.219] (-845.171) (-842.432) (-844.957) * (-849.668) (-845.335) (-843.948) [-843.514] -- 0:00:13
781500 -- [-843.334] (-844.381) (-852.930) (-843.460) * (-845.746) (-844.655) (-848.978) [-845.948] -- 0:00:13
782000 -- (-844.060) (-843.061) (-843.859) [-842.605] * (-849.841) (-843.508) [-844.778] (-845.133) -- 0:00:13
782500 -- (-843.058) (-843.168) [-844.778] (-844.447) * (-842.804) (-843.854) [-842.836] (-843.184) -- 0:00:13
783000 -- (-844.809) (-845.061) (-843.956) [-843.516] * (-845.318) (-842.174) [-843.921] (-846.224) -- 0:00:13
783500 -- [-844.232] (-846.167) (-844.608) (-845.401) * (-842.721) [-843.525] (-842.710) (-845.321) -- 0:00:13
784000 -- (-842.428) (-845.368) (-845.010) [-843.867] * (-842.490) (-845.379) (-843.833) [-844.060] -- 0:00:13
784500 -- (-843.591) [-843.439] (-842.528) (-842.395) * [-842.186] (-847.053) (-843.063) (-843.824) -- 0:00:13
785000 -- (-844.031) [-842.912] (-843.715) (-843.828) * (-841.979) (-846.738) [-843.753] (-842.988) -- 0:00:13
Average standard deviation of split frequencies: 0.009371
785500 -- [-844.242] (-844.256) (-843.401) (-844.486) * (-845.094) [-843.579] (-843.160) (-848.890) -- 0:00:13
786000 -- (-845.241) [-843.949] (-843.667) (-842.637) * [-843.839] (-843.438) (-841.853) (-851.339) -- 0:00:13
786500 -- (-845.584) [-843.067] (-843.886) (-845.892) * (-844.515) (-849.323) [-845.037] (-848.508) -- 0:00:13
787000 -- [-843.350] (-844.485) (-843.066) (-845.980) * (-844.445) (-843.203) [-845.229] (-848.384) -- 0:00:12
787500 -- (-843.880) [-844.882] (-843.559) (-845.670) * (-846.831) [-844.492] (-843.584) (-846.363) -- 0:00:12
788000 -- [-845.644] (-844.713) (-845.391) (-846.536) * (-845.305) [-847.735] (-842.846) (-842.290) -- 0:00:12
788500 -- (-844.450) [-847.115] (-848.172) (-844.796) * (-846.122) (-843.214) (-844.429) [-842.969] -- 0:00:12
789000 -- (-843.284) (-843.529) (-846.123) [-843.379] * (-845.613) (-843.371) (-842.707) [-844.345] -- 0:00:12
789500 -- (-843.265) [-843.886] (-843.990) (-845.438) * (-844.906) (-846.320) [-843.022] (-844.672) -- 0:00:12
790000 -- [-843.573] (-846.181) (-842.613) (-849.771) * (-844.969) (-844.018) [-844.159] (-846.933) -- 0:00:12
Average standard deviation of split frequencies: 0.009167
790500 -- (-843.580) [-843.538] (-842.599) (-846.543) * (-844.918) [-844.557] (-844.184) (-845.425) -- 0:00:12
791000 -- (-843.810) (-843.817) (-848.211) [-844.115] * (-842.264) (-843.486) (-843.553) [-842.281] -- 0:00:12
791500 -- [-845.542] (-845.744) (-843.645) (-843.120) * (-842.275) (-845.406) [-843.789] (-842.266) -- 0:00:12
792000 -- (-844.336) [-843.686] (-845.167) (-843.344) * (-845.678) (-843.960) (-842.477) [-842.260] -- 0:00:12
792500 -- [-845.527] (-844.132) (-843.570) (-843.562) * (-846.904) (-845.328) (-845.278) [-844.028] -- 0:00:12
793000 -- (-843.855) (-844.688) [-843.451] (-850.132) * (-842.978) [-844.501] (-844.879) (-844.839) -- 0:00:12
793500 -- (-843.383) (-848.617) (-843.762) [-845.197] * [-842.158] (-843.635) (-842.696) (-845.504) -- 0:00:12
794000 -- (-843.501) (-846.304) [-844.142] (-847.991) * [-842.761] (-843.369) (-842.271) (-845.873) -- 0:00:12
794500 -- (-842.495) (-843.585) [-846.578] (-846.121) * (-842.842) (-847.820) (-846.231) [-844.389] -- 0:00:12
795000 -- (-846.547) (-842.675) (-842.629) [-844.553] * (-842.562) (-846.828) (-842.675) [-843.069] -- 0:00:12
Average standard deviation of split frequencies: 0.008994
795500 -- [-844.473] (-842.730) (-844.788) (-843.285) * (-844.568) (-847.310) (-844.772) [-846.915] -- 0:00:12
796000 -- (-842.643) (-842.174) (-844.676) [-844.066] * (-843.282) (-843.029) [-846.791] (-848.209) -- 0:00:12
796500 -- (-842.644) [-842.353] (-842.536) (-843.417) * (-844.383) (-847.490) (-848.826) [-843.165] -- 0:00:12
797000 -- (-846.310) [-843.330] (-842.533) (-844.023) * [-842.875] (-846.022) (-843.862) (-843.887) -- 0:00:12
797500 -- [-843.278] (-843.871) (-842.489) (-842.331) * (-842.328) [-848.010] (-846.074) (-849.954) -- 0:00:12
798000 -- (-846.336) [-844.595] (-843.893) (-843.733) * [-843.223] (-843.349) (-846.249) (-845.630) -- 0:00:12
798500 -- [-847.132] (-846.479) (-844.050) (-842.682) * [-843.380] (-843.654) (-843.919) (-847.624) -- 0:00:12
799000 -- (-848.454) (-845.004) (-843.320) [-842.798] * [-843.646] (-844.808) (-842.485) (-848.403) -- 0:00:12
799500 -- (-846.294) [-844.232] (-842.682) (-843.470) * (-844.003) [-843.125] (-843.135) (-848.422) -- 0:00:12
800000 -- (-844.142) [-843.501] (-842.849) (-847.164) * (-845.167) (-844.593) [-842.248] (-842.908) -- 0:00:12
Average standard deviation of split frequencies: 0.008758
800500 -- (-842.062) (-844.194) [-845.267] (-843.171) * [-843.127] (-844.375) (-842.096) (-843.356) -- 0:00:12
801000 -- (-844.273) (-843.387) [-845.308] (-846.735) * (-847.205) [-844.508] (-841.776) (-843.071) -- 0:00:12
801500 -- (-844.714) (-844.135) [-844.246] (-851.091) * (-843.304) [-844.372] (-847.756) (-845.508) -- 0:00:12
802000 -- (-843.680) [-843.216] (-844.760) (-846.321) * [-846.640] (-843.776) (-845.505) (-843.980) -- 0:00:12
802500 -- (-845.626) (-843.881) (-845.236) [-843.609] * (-845.506) (-844.126) [-845.869] (-843.463) -- 0:00:12
803000 -- (-844.423) (-843.918) (-843.675) [-846.893] * (-842.864) [-847.398] (-845.252) (-845.113) -- 0:00:12
803500 -- [-845.691] (-842.345) (-844.438) (-842.878) * (-844.227) [-846.148] (-847.667) (-845.065) -- 0:00:11
804000 -- (-843.308) [-843.672] (-844.828) (-846.983) * (-847.328) (-845.426) [-844.571] (-844.303) -- 0:00:11
804500 -- (-842.908) (-845.849) [-844.150] (-845.513) * [-842.905] (-842.912) (-844.090) (-845.099) -- 0:00:11
805000 -- [-844.818] (-845.424) (-844.084) (-842.921) * [-842.968] (-842.837) (-844.096) (-844.988) -- 0:00:11
Average standard deviation of split frequencies: 0.008773
805500 -- (-844.075) [-842.765] (-842.801) (-842.964) * [-843.522] (-844.609) (-843.847) (-844.630) -- 0:00:11
806000 -- (-844.086) (-843.453) [-843.038] (-844.445) * [-845.603] (-842.973) (-841.797) (-843.497) -- 0:00:11
806500 -- (-844.633) [-844.444] (-844.579) (-844.482) * (-846.263) (-845.514) (-848.868) [-842.528] -- 0:00:11
807000 -- (-844.667) (-848.121) (-843.125) [-843.767] * (-845.009) [-842.772] (-846.804) (-843.402) -- 0:00:11
807500 -- (-846.155) (-843.409) (-843.907) [-844.796] * (-843.457) [-842.822] (-844.999) (-847.978) -- 0:00:11
808000 -- (-843.859) [-847.596] (-845.962) (-842.502) * (-844.762) [-842.684] (-843.771) (-842.638) -- 0:00:11
808500 -- (-843.940) (-843.426) (-845.274) [-846.628] * (-844.256) [-842.825] (-844.766) (-843.259) -- 0:00:11
809000 -- [-843.377] (-844.706) (-845.857) (-843.153) * (-843.726) [-842.133] (-844.600) (-844.047) -- 0:00:11
809500 -- [-842.981] (-845.344) (-843.460) (-845.041) * (-847.444) (-842.867) [-848.137] (-843.187) -- 0:00:11
810000 -- (-845.932) (-847.797) [-843.023] (-842.770) * (-843.991) (-844.811) [-845.615] (-845.635) -- 0:00:11
Average standard deviation of split frequencies: 0.009050
810500 -- [-843.903] (-843.829) (-843.566) (-844.198) * (-848.080) [-842.609] (-843.862) (-844.446) -- 0:00:11
811000 -- [-844.827] (-845.167) (-844.708) (-843.459) * (-843.735) [-842.550] (-844.160) (-847.261) -- 0:00:11
811500 -- (-847.403) (-848.388) (-844.810) [-845.731] * (-843.643) (-843.022) (-842.938) [-843.420] -- 0:00:11
812000 -- (-845.914) [-849.903] (-846.059) (-843.025) * (-844.603) [-842.029] (-847.535) (-843.885) -- 0:00:11
812500 -- (-845.415) (-843.855) [-845.581] (-843.382) * (-843.194) (-842.783) [-844.734] (-843.479) -- 0:00:11
813000 -- (-845.470) (-846.938) [-844.321] (-844.077) * [-842.245] (-846.916) (-842.954) (-843.850) -- 0:00:11
813500 -- (-844.702) (-842.940) (-844.670) [-844.219] * (-843.773) [-847.154] (-843.508) (-846.453) -- 0:00:11
814000 -- (-844.793) (-842.754) (-845.579) [-844.208] * (-843.842) (-846.077) [-843.192] (-843.397) -- 0:00:11
814500 -- (-843.644) (-846.680) [-843.219] (-844.766) * (-842.327) (-845.619) [-845.384] (-842.268) -- 0:00:11
815000 -- (-845.776) [-843.671] (-846.064) (-844.951) * (-845.533) (-844.926) (-845.633) [-842.709] -- 0:00:11
Average standard deviation of split frequencies: 0.009027
815500 -- [-844.771] (-844.888) (-843.018) (-844.327) * (-843.169) (-844.845) (-843.742) [-844.724] -- 0:00:11
816000 -- (-842.504) [-842.878] (-845.265) (-843.310) * [-843.321] (-846.661) (-847.561) (-846.824) -- 0:00:11
816500 -- [-845.894] (-843.082) (-843.165) (-844.615) * (-846.566) (-845.257) (-845.842) [-843.096] -- 0:00:11
817000 -- (-847.009) [-847.313] (-843.582) (-845.205) * (-843.667) [-843.447] (-847.864) (-849.527) -- 0:00:11
817500 -- (-846.389) (-845.542) (-842.993) [-844.160] * (-843.238) (-847.904) [-849.160] (-844.063) -- 0:00:11
818000 -- (-848.239) (-842.649) (-844.242) [-843.698] * [-846.460] (-844.091) (-849.995) (-849.270) -- 0:00:11
818500 -- (-845.953) (-845.049) (-844.270) [-842.975] * (-848.944) [-842.861] (-844.915) (-843.730) -- 0:00:11
819000 -- [-845.136] (-844.193) (-844.008) (-843.777) * (-846.027) (-846.026) [-842.698] (-845.194) -- 0:00:11
819500 -- (-843.060) (-843.465) (-843.821) [-845.918] * [-846.023] (-848.187) (-843.261) (-846.882) -- 0:00:11
820000 -- [-844.131] (-843.031) (-842.549) (-842.611) * [-842.774] (-842.755) (-842.789) (-844.825) -- 0:00:10
Average standard deviation of split frequencies: 0.009334
820500 -- (-851.017) (-842.379) [-842.574] (-843.892) * (-842.890) (-849.166) [-843.360] (-846.027) -- 0:00:10
821000 -- (-843.478) [-848.116] (-843.402) (-844.067) * (-846.517) (-844.146) (-846.074) [-845.101] -- 0:00:10
821500 -- (-842.662) (-846.374) [-844.342] (-844.653) * [-847.685] (-846.565) (-846.772) (-845.255) -- 0:00:10
822000 -- (-843.035) (-846.107) [-843.322] (-845.433) * [-845.519] (-844.152) (-846.629) (-844.557) -- 0:00:10
822500 -- (-844.662) [-842.292] (-843.966) (-844.648) * (-844.729) [-844.863] (-845.038) (-844.976) -- 0:00:10
823000 -- (-847.873) (-842.274) [-846.070] (-843.770) * (-846.641) (-844.191) (-843.525) [-843.083] -- 0:00:10
823500 -- (-844.752) (-841.988) [-842.722] (-846.084) * [-844.765] (-845.084) (-843.914) (-843.387) -- 0:00:10
824000 -- (-843.130) (-842.623) [-842.873] (-843.084) * (-846.848) (-848.138) [-843.837] (-844.407) -- 0:00:10
824500 -- (-842.521) (-842.788) (-845.462) [-843.492] * (-844.356) (-843.916) (-844.294) [-845.177] -- 0:00:10
825000 -- (-842.910) (-842.957) [-843.902] (-845.412) * (-844.630) [-849.507] (-844.440) (-845.017) -- 0:00:10
Average standard deviation of split frequencies: 0.008882
825500 -- (-845.708) (-842.912) (-843.985) [-844.989] * (-846.187) (-842.985) (-846.240) [-844.955] -- 0:00:10
826000 -- (-844.445) (-846.718) [-844.282] (-845.209) * (-843.471) (-843.471) [-845.385] (-844.037) -- 0:00:10
826500 -- [-843.647] (-845.536) (-843.496) (-846.630) * (-844.612) (-845.063) [-842.194] (-843.587) -- 0:00:10
827000 -- [-842.902] (-844.786) (-842.443) (-843.572) * [-845.413] (-845.930) (-845.209) (-846.971) -- 0:00:10
827500 -- (-842.562) [-842.140] (-842.189) (-845.357) * (-844.083) [-842.615] (-843.961) (-843.206) -- 0:00:10
828000 -- (-842.238) [-842.154] (-845.900) (-843.425) * (-843.047) (-845.969) [-843.789] (-844.341) -- 0:00:10
828500 -- (-844.047) (-844.014) (-843.122) [-843.044] * (-845.667) [-843.289] (-844.315) (-843.740) -- 0:00:10
829000 -- (-846.247) [-842.595] (-844.266) (-843.981) * (-845.550) (-844.863) (-845.764) [-845.041] -- 0:00:10
829500 -- (-846.439) (-842.515) [-846.452] (-844.516) * (-845.270) (-844.927) [-846.339] (-848.992) -- 0:00:10
830000 -- (-845.981) (-843.483) [-847.059] (-846.581) * (-847.062) (-846.948) (-842.417) [-843.331] -- 0:00:10
Average standard deviation of split frequencies: 0.008371
830500 -- [-843.296] (-846.961) (-844.554) (-845.413) * (-842.948) (-847.466) [-842.354] (-844.144) -- 0:00:10
831000 -- (-846.040) (-843.946) (-843.528) [-843.766] * (-843.326) (-843.271) [-842.815] (-844.418) -- 0:00:10
831500 -- (-844.005) (-842.779) [-843.570] (-846.269) * (-843.782) (-844.047) (-843.057) [-848.791] -- 0:00:10
832000 -- (-845.354) (-842.945) [-842.912] (-848.086) * (-848.145) (-846.771) (-843.709) [-844.755] -- 0:00:10
832500 -- (-842.884) [-844.966] (-844.030) (-842.624) * (-843.283) (-847.504) [-844.451] (-845.336) -- 0:00:10
833000 -- (-845.962) (-846.926) [-843.158] (-844.900) * (-846.145) (-844.534) (-846.261) [-846.390] -- 0:00:10
833500 -- [-844.856] (-844.614) (-844.411) (-845.698) * [-846.424] (-844.637) (-847.117) (-846.003) -- 0:00:10
834000 -- [-845.436] (-847.688) (-844.213) (-847.249) * (-842.324) [-845.655] (-844.638) (-847.198) -- 0:00:10
834500 -- [-845.786] (-843.358) (-843.423) (-843.635) * [-843.262] (-846.558) (-848.742) (-844.318) -- 0:00:10
835000 -- (-843.503) (-843.903) (-843.178) [-842.899] * [-844.134] (-843.421) (-843.914) (-844.598) -- 0:00:10
Average standard deviation of split frequencies: 0.008157
835500 -- (-843.249) (-843.741) (-843.719) [-844.338] * (-844.766) [-843.610] (-844.631) (-843.276) -- 0:00:10
836000 -- (-844.041) (-843.473) [-844.915] (-844.385) * [-842.890] (-846.854) (-842.866) (-846.154) -- 0:00:10
836500 -- (-844.721) (-844.478) [-842.476] (-843.091) * (-843.103) (-844.697) (-844.745) [-843.617] -- 0:00:09
837000 -- [-843.981] (-842.053) (-845.045) (-843.283) * [-846.015] (-846.389) (-846.868) (-843.787) -- 0:00:09
837500 -- (-844.603) (-842.185) (-845.658) [-842.646] * (-846.701) (-845.192) [-843.135] (-843.018) -- 0:00:09
838000 -- (-842.477) (-845.778) [-843.237] (-844.688) * [-848.384] (-845.350) (-843.906) (-842.986) -- 0:00:09
838500 -- [-843.166] (-844.473) (-842.641) (-844.356) * (-844.534) (-844.751) [-849.894] (-846.716) -- 0:00:09
839000 -- (-842.157) [-842.421] (-842.653) (-845.197) * (-843.308) (-843.533) [-847.719] (-842.918) -- 0:00:09
839500 -- (-842.837) (-844.589) [-843.764] (-845.675) * (-847.177) (-844.563) [-843.342] (-844.868) -- 0:00:09
840000 -- (-842.636) (-844.851) [-848.948] (-843.373) * (-843.544) (-842.993) (-850.953) [-844.206] -- 0:00:09
Average standard deviation of split frequencies: 0.008867
840500 -- (-846.175) (-845.433) (-842.824) [-843.779] * [-843.202] (-846.729) (-855.845) (-844.412) -- 0:00:09
841000 -- (-842.632) [-842.518] (-847.368) (-844.295) * (-847.017) (-843.243) (-849.629) [-844.984] -- 0:00:09
841500 -- (-846.866) (-844.448) [-843.565] (-847.249) * (-843.601) (-843.781) [-845.051] (-845.552) -- 0:00:09
842000 -- (-844.714) (-846.843) [-843.565] (-844.165) * [-844.125] (-844.751) (-843.223) (-846.031) -- 0:00:09
842500 -- (-842.592) [-849.194] (-847.402) (-849.473) * (-843.858) (-842.790) [-844.455] (-843.980) -- 0:00:09
843000 -- (-845.177) (-844.928) (-846.233) [-842.439] * (-848.371) (-846.753) [-844.037] (-847.270) -- 0:00:09
843500 -- (-843.476) (-844.278) (-845.217) [-842.299] * (-844.461) (-845.010) [-842.656] (-848.309) -- 0:00:09
844000 -- [-844.471] (-844.342) (-845.200) (-843.495) * (-843.635) [-843.346] (-844.560) (-843.794) -- 0:00:09
844500 -- (-844.185) (-844.442) [-844.062] (-847.210) * [-846.523] (-845.103) (-843.935) (-843.592) -- 0:00:09
845000 -- (-843.783) (-847.216) [-843.994] (-849.458) * (-846.479) (-845.904) [-843.170] (-842.859) -- 0:00:09
Average standard deviation of split frequencies: 0.008532
845500 -- (-844.242) (-845.822) (-845.773) [-843.748] * [-844.517] (-842.946) (-843.571) (-846.327) -- 0:00:09
846000 -- (-843.546) (-846.173) [-844.901] (-847.641) * [-845.040] (-848.390) (-843.507) (-843.639) -- 0:00:09
846500 -- (-843.617) (-847.121) [-843.942] (-844.407) * (-844.635) [-845.336] (-844.072) (-845.517) -- 0:00:09
847000 -- (-843.940) (-844.195) (-841.994) [-846.479] * [-843.626] (-847.795) (-845.225) (-845.643) -- 0:00:09
847500 -- (-843.368) (-843.069) [-845.757] (-843.812) * (-846.512) [-842.212] (-843.560) (-842.508) -- 0:00:09
848000 -- (-843.702) (-843.545) [-843.107] (-845.189) * (-846.450) [-843.363] (-845.002) (-842.684) -- 0:00:09
848500 -- (-842.446) [-845.444] (-843.051) (-842.844) * [-844.160] (-842.882) (-846.104) (-843.624) -- 0:00:09
849000 -- (-842.091) (-844.435) [-844.115] (-845.687) * [-842.090] (-843.352) (-844.299) (-842.575) -- 0:00:09
849500 -- (-844.631) (-845.061) [-844.847] (-845.437) * [-846.856] (-843.646) (-846.898) (-845.256) -- 0:00:09
850000 -- [-842.250] (-846.315) (-845.811) (-842.113) * [-843.567] (-843.325) (-842.957) (-843.693) -- 0:00:09
Average standard deviation of split frequencies: 0.007647
850500 -- (-842.250) [-841.982] (-843.261) (-844.509) * (-844.957) (-847.156) (-845.034) [-844.414] -- 0:00:09
851000 -- [-845.245] (-845.129) (-844.055) (-843.100) * [-844.738] (-843.118) (-843.915) (-843.676) -- 0:00:09
851500 -- (-846.395) (-843.830) [-842.750] (-843.392) * [-843.268] (-845.162) (-843.279) (-844.258) -- 0:00:09
852000 -- (-845.073) (-843.985) [-845.193] (-843.397) * (-843.596) [-846.251] (-842.585) (-843.555) -- 0:00:09
852500 -- (-842.460) (-843.645) (-845.838) [-844.143] * [-842.620] (-843.981) (-842.176) (-843.624) -- 0:00:08
853000 -- (-845.196) (-845.172) [-843.920] (-843.053) * [-842.675] (-843.904) (-843.225) (-844.167) -- 0:00:08
853500 -- (-843.927) [-843.844] (-846.355) (-844.603) * (-845.148) (-844.784) (-846.063) [-842.802] -- 0:00:08
854000 -- (-843.077) [-846.281] (-844.400) (-842.010) * (-844.791) (-845.315) (-844.807) [-845.338] -- 0:00:08
854500 -- (-844.096) (-846.338) (-847.767) [-844.760] * [-844.147] (-843.103) (-847.373) (-846.344) -- 0:00:08
855000 -- (-842.600) (-842.452) [-843.551] (-844.984) * (-842.925) (-842.862) (-846.849) [-843.333] -- 0:00:08
Average standard deviation of split frequencies: 0.007379
855500 -- [-842.841] (-844.117) (-842.895) (-842.553) * [-842.279] (-844.779) (-848.801) (-841.945) -- 0:00:08
856000 -- (-846.097) [-845.565] (-846.932) (-842.271) * (-842.894) (-845.665) [-842.896] (-842.237) -- 0:00:08
856500 -- (-843.651) (-843.037) [-842.689] (-843.082) * [-842.778] (-849.699) (-843.878) (-844.725) -- 0:00:08
857000 -- [-842.389] (-842.586) (-848.373) (-842.707) * (-844.702) [-843.550] (-843.650) (-842.432) -- 0:00:08
857500 -- (-844.002) (-843.142) [-843.615] (-842.131) * (-845.177) [-844.356] (-845.665) (-845.555) -- 0:00:08
858000 -- (-842.412) (-844.480) [-845.426] (-843.143) * (-846.276) (-843.319) [-844.309] (-843.060) -- 0:00:08
858500 -- (-847.805) (-845.168) (-843.486) [-844.068] * (-846.755) (-844.182) [-843.225] (-842.124) -- 0:00:08
859000 -- [-844.633] (-845.910) (-847.645) (-845.243) * (-845.256) (-844.796) [-842.930] (-844.227) -- 0:00:08
859500 -- (-843.164) [-845.098] (-845.261) (-842.583) * (-845.137) (-844.316) [-844.651] (-843.894) -- 0:00:08
860000 -- (-843.432) (-846.982) [-845.962] (-847.624) * (-843.330) (-842.624) (-844.032) [-845.505] -- 0:00:08
Average standard deviation of split frequencies: 0.007339
860500 -- (-843.348) [-841.828] (-842.697) (-842.187) * (-842.871) (-843.137) [-847.469] (-843.962) -- 0:00:08
861000 -- (-842.884) (-843.162) (-844.200) [-842.702] * (-843.665) [-844.047] (-844.672) (-844.911) -- 0:00:08
861500 -- (-843.346) [-844.565] (-849.407) (-843.927) * (-843.954) [-843.676] (-844.317) (-842.993) -- 0:00:08
862000 -- [-844.375] (-844.708) (-847.264) (-845.784) * (-843.515) (-844.564) (-843.968) [-843.004] -- 0:00:08
862500 -- (-843.287) (-842.457) [-843.391] (-844.445) * (-842.798) (-844.369) (-843.236) [-843.147] -- 0:00:08
863000 -- (-842.565) [-844.034] (-845.220) (-843.302) * (-843.793) (-844.293) [-845.081] (-843.157) -- 0:00:08
863500 -- (-843.229) (-843.046) [-843.128] (-843.570) * (-845.756) (-843.357) [-843.357] (-842.079) -- 0:00:08
864000 -- [-844.037] (-844.781) (-845.456) (-844.145) * (-842.242) (-846.259) (-843.622) [-843.036] -- 0:00:08
864500 -- (-843.864) (-842.769) (-844.585) [-845.962] * (-842.257) [-843.155] (-844.025) (-842.165) -- 0:00:08
865000 -- (-846.749) (-845.398) (-844.146) [-841.810] * (-843.102) (-844.370) (-844.028) [-843.444] -- 0:00:08
Average standard deviation of split frequencies: 0.007367
865500 -- (-846.200) (-844.139) [-843.172] (-841.805) * (-844.059) (-845.477) [-842.840] (-844.013) -- 0:00:08
866000 -- (-842.196) (-843.179) [-845.141] (-842.595) * (-845.970) (-843.607) [-845.679] (-843.116) -- 0:00:08
866500 -- [-844.408] (-845.517) (-845.022) (-842.762) * [-842.812] (-842.898) (-846.117) (-842.410) -- 0:00:08
867000 -- (-843.619) [-844.122] (-844.624) (-842.435) * (-842.979) (-846.574) (-843.285) [-843.586] -- 0:00:08
867500 -- [-843.399] (-842.883) (-845.897) (-842.026) * (-843.469) [-845.521] (-845.651) (-846.430) -- 0:00:08
868000 -- [-845.603] (-846.281) (-848.083) (-843.114) * (-843.465) [-845.213] (-845.763) (-844.478) -- 0:00:08
868500 -- [-843.816] (-846.504) (-849.185) (-846.097) * (-844.588) (-846.894) [-843.203] (-844.339) -- 0:00:08
869000 -- (-844.829) (-846.540) [-843.910] (-845.410) * (-845.415) (-848.014) (-843.180) [-843.170] -- 0:00:07
869500 -- [-846.000] (-850.399) (-843.497) (-846.429) * (-850.100) [-844.272] (-842.334) (-842.025) -- 0:00:07
870000 -- (-847.826) [-847.006] (-844.106) (-845.593) * (-844.771) (-842.822) [-843.099] (-842.595) -- 0:00:07
Average standard deviation of split frequencies: 0.007760
870500 -- (-845.377) (-846.107) [-843.047] (-846.742) * (-843.991) (-845.893) [-842.516] (-845.009) -- 0:00:07
871000 -- (-843.094) [-844.095] (-845.182) (-843.962) * (-847.411) (-842.754) (-843.340) [-842.572] -- 0:00:07
871500 -- [-842.661] (-845.004) (-845.985) (-846.214) * (-844.971) (-842.173) [-843.122] (-846.283) -- 0:00:07
872000 -- [-842.870] (-842.923) (-843.866) (-843.606) * (-845.496) (-843.669) (-845.380) [-843.118] -- 0:00:07
872500 -- [-843.728] (-844.994) (-846.287) (-846.423) * (-846.667) (-844.792) [-844.008] (-841.895) -- 0:00:07
873000 -- [-843.851] (-848.656) (-846.602) (-843.258) * (-844.381) (-842.596) (-844.016) [-844.238] -- 0:00:07
873500 -- (-845.519) (-846.736) [-844.038] (-844.624) * (-846.081) (-842.353) [-845.906] (-844.837) -- 0:00:07
874000 -- (-845.011) [-843.633] (-848.171) (-846.219) * (-844.159) [-844.251] (-844.383) (-844.310) -- 0:00:07
874500 -- (-846.707) (-842.498) (-845.511) [-844.536] * (-843.639) (-842.615) (-849.226) [-843.931] -- 0:00:07
875000 -- (-842.688) (-844.300) [-845.292] (-848.358) * [-842.315] (-848.518) (-845.250) (-845.310) -- 0:00:07
Average standard deviation of split frequencies: 0.007426
875500 -- (-842.452) [-845.426] (-847.978) (-848.569) * [-842.390] (-848.690) (-842.759) (-843.577) -- 0:00:07
876000 -- [-845.539] (-843.331) (-842.743) (-849.270) * (-843.765) (-846.154) (-844.985) [-842.745] -- 0:00:07
876500 -- [-845.797] (-844.038) (-843.684) (-843.906) * (-846.259) [-846.122] (-843.365) (-843.112) -- 0:00:07
877000 -- (-847.102) (-846.790) (-843.618) [-845.819] * (-849.073) (-845.718) [-841.932] (-842.226) -- 0:00:07
877500 -- (-843.122) (-846.320) [-845.231] (-843.781) * (-844.625) (-844.893) [-841.940] (-843.595) -- 0:00:07
878000 -- [-844.506] (-844.796) (-843.585) (-844.471) * (-848.659) (-845.143) [-841.916] (-843.776) -- 0:00:07
878500 -- [-844.363] (-843.231) (-843.827) (-846.701) * [-842.328] (-850.043) (-842.563) (-842.903) -- 0:00:07
879000 -- (-849.823) (-843.579) [-844.728] (-845.995) * (-846.528) (-844.335) (-843.990) [-845.708] -- 0:00:07
879500 -- (-845.701) (-842.785) [-845.247] (-845.404) * (-843.577) (-843.924) (-843.687) [-847.224] -- 0:00:07
880000 -- (-848.764) (-843.765) (-845.046) [-843.635] * (-843.933) [-843.987] (-843.322) (-845.190) -- 0:00:07
Average standard deviation of split frequencies: 0.007316
880500 -- (-842.662) [-844.987] (-845.314) (-842.700) * [-843.893] (-843.460) (-846.236) (-844.217) -- 0:00:07
881000 -- (-842.272) [-844.846] (-843.552) (-842.664) * (-844.740) (-842.987) (-845.781) [-845.828] -- 0:00:07
881500 -- (-843.991) (-847.892) [-843.067] (-842.185) * (-849.669) (-842.458) (-846.696) [-843.681] -- 0:00:07
882000 -- [-846.113] (-845.197) (-842.906) (-845.027) * [-845.650] (-843.334) (-842.413) (-844.935) -- 0:00:07
882500 -- (-844.265) (-843.943) (-843.244) [-844.076] * (-845.384) (-846.239) (-843.252) [-844.064] -- 0:00:07
883000 -- (-844.186) (-844.322) (-845.807) [-844.654] * (-843.714) (-843.492) (-847.667) [-844.373] -- 0:00:07
883500 -- [-845.967] (-844.340) (-844.370) (-845.811) * (-843.163) (-844.838) [-844.131] (-843.536) -- 0:00:07
884000 -- [-842.442] (-844.667) (-844.283) (-848.741) * [-847.599] (-843.186) (-843.542) (-844.308) -- 0:00:07
884500 -- (-842.076) (-842.924) [-843.544] (-844.884) * (-845.308) [-842.913] (-843.093) (-843.121) -- 0:00:07
885000 -- (-844.506) [-843.541] (-852.077) (-844.031) * [-845.576] (-842.451) (-847.797) (-842.584) -- 0:00:07
Average standard deviation of split frequencies: 0.007981
885500 -- (-846.970) (-843.142) [-843.147] (-844.816) * (-846.587) [-842.474] (-846.569) (-844.894) -- 0:00:06
886000 -- [-846.866] (-846.654) (-844.151) (-851.404) * (-844.991) (-842.039) (-845.932) [-843.205] -- 0:00:06
886500 -- (-846.941) [-843.961] (-844.417) (-848.141) * [-843.840] (-845.407) (-844.529) (-844.129) -- 0:00:06
887000 -- (-848.368) [-844.466] (-844.093) (-844.317) * (-845.681) [-843.471] (-844.240) (-843.079) -- 0:00:06
887500 -- [-843.587] (-843.633) (-846.512) (-842.034) * (-846.951) (-844.636) (-845.704) [-842.611] -- 0:00:06
888000 -- (-843.715) (-847.324) [-843.768] (-850.494) * [-844.282] (-841.828) (-846.229) (-844.846) -- 0:00:06
888500 -- [-843.391] (-842.775) (-842.774) (-843.214) * (-844.067) (-841.856) (-842.826) [-844.756] -- 0:00:06
889000 -- [-845.529] (-843.898) (-848.481) (-843.237) * (-844.675) (-843.869) [-842.907] (-843.105) -- 0:00:06
889500 -- (-843.943) (-846.411) [-842.668] (-843.686) * (-844.020) (-845.109) [-844.738] (-842.006) -- 0:00:06
890000 -- [-843.204] (-843.231) (-844.723) (-845.578) * (-844.470) [-842.327] (-845.591) (-842.820) -- 0:00:06
Average standard deviation of split frequencies: 0.007727
890500 -- (-846.799) (-844.920) (-842.146) [-846.989] * (-842.456) (-843.050) [-844.118] (-843.311) -- 0:00:06
891000 -- (-843.678) (-846.910) (-843.804) [-843.935] * [-843.390] (-842.681) (-844.341) (-846.804) -- 0:00:06
891500 -- [-843.737] (-844.413) (-847.188) (-846.372) * [-843.883] (-843.286) (-842.342) (-845.681) -- 0:00:06
892000 -- (-846.601) (-847.595) [-844.403] (-842.574) * [-843.233] (-843.374) (-845.410) (-844.616) -- 0:00:06
892500 -- [-846.620] (-843.845) (-844.451) (-852.909) * [-842.209] (-843.748) (-844.882) (-843.805) -- 0:00:06
893000 -- (-847.358) [-846.809] (-845.864) (-848.270) * (-843.074) [-845.484] (-843.462) (-845.075) -- 0:00:06
893500 -- (-843.108) [-842.780] (-844.166) (-843.569) * (-843.836) (-843.726) [-843.661] (-843.701) -- 0:00:06
894000 -- (-848.409) [-842.605] (-843.985) (-844.155) * (-843.590) [-846.535] (-842.494) (-842.983) -- 0:00:06
894500 -- (-849.724) [-843.007] (-844.435) (-844.782) * (-842.481) [-843.933] (-844.398) (-845.930) -- 0:00:06
895000 -- (-846.120) (-844.552) (-846.937) [-843.942] * [-843.145] (-845.373) (-845.218) (-843.295) -- 0:00:06
Average standard deviation of split frequencies: 0.007120
895500 -- [-842.596] (-842.157) (-850.206) (-843.253) * [-842.843] (-845.388) (-842.518) (-851.172) -- 0:00:06
896000 -- [-843.286] (-846.125) (-845.236) (-842.286) * [-844.913] (-845.665) (-842.887) (-844.438) -- 0:00:06
896500 -- (-843.770) (-841.736) [-845.854] (-844.341) * (-842.837) [-844.845] (-843.724) (-844.845) -- 0:00:06
897000 -- [-843.503] (-842.098) (-843.363) (-845.926) * (-844.429) [-842.744] (-842.706) (-844.505) -- 0:00:06
897500 -- [-843.461] (-845.457) (-843.256) (-848.420) * (-846.474) [-843.148] (-845.940) (-846.712) -- 0:00:06
898000 -- (-846.046) (-842.774) [-843.276] (-845.213) * (-845.719) [-843.777] (-845.241) (-843.145) -- 0:00:06
898500 -- (-844.083) (-844.348) [-842.671] (-845.116) * (-844.221) (-842.601) (-844.498) [-845.881] -- 0:00:06
899000 -- (-842.742) [-846.460] (-846.226) (-843.162) * (-842.090) [-845.211] (-843.718) (-846.235) -- 0:00:06
899500 -- (-843.658) (-843.948) [-842.453] (-844.032) * [-842.996] (-852.858) (-845.053) (-847.809) -- 0:00:06
900000 -- (-846.837) (-843.505) (-843.184) [-842.728] * (-843.883) [-847.754] (-845.513) (-844.421) -- 0:00:06
Average standard deviation of split frequencies: 0.006944
900500 -- [-843.595] (-846.595) (-843.509) (-847.187) * [-844.251] (-843.273) (-846.838) (-843.013) -- 0:00:06
901000 -- (-844.162) (-842.867) [-843.338] (-844.716) * [-842.360] (-843.036) (-843.693) (-847.629) -- 0:00:06
901500 -- [-843.956] (-842.710) (-844.706) (-843.426) * [-842.958] (-843.629) (-844.279) (-845.177) -- 0:00:06
902000 -- (-843.089) [-845.718] (-842.632) (-843.121) * (-845.815) (-844.045) (-846.278) [-846.557] -- 0:00:05
902500 -- (-843.276) (-847.345) [-842.855] (-842.895) * (-843.702) (-844.623) (-846.062) [-844.698] -- 0:00:05
903000 -- (-845.475) (-847.382) (-844.977) [-843.604] * (-842.595) [-844.438] (-843.913) (-843.651) -- 0:00:05
903500 -- [-844.121] (-846.713) (-844.696) (-842.937) * (-845.517) (-844.015) (-843.981) [-843.924] -- 0:00:05
904000 -- (-843.803) (-844.962) [-842.757] (-846.841) * (-847.787) (-847.907) [-846.354] (-851.127) -- 0:00:05
904500 -- (-844.447) (-846.052) [-842.392] (-842.586) * (-846.992) (-843.115) (-842.680) [-845.322] -- 0:00:05
905000 -- (-844.810) (-844.987) [-845.896] (-845.805) * (-844.763) (-842.104) [-842.466] (-845.139) -- 0:00:05
Average standard deviation of split frequencies: 0.007215
905500 -- (-842.946) (-846.807) (-844.763) [-843.236] * (-846.855) [-844.408] (-842.492) (-844.598) -- 0:00:05
906000 -- [-845.245] (-845.163) (-844.321) (-846.201) * (-843.893) [-847.629] (-845.445) (-844.050) -- 0:00:05
906500 -- (-845.163) [-842.378] (-844.905) (-842.676) * (-844.556) (-845.195) [-844.911] (-850.022) -- 0:00:05
907000 -- (-849.002) [-845.723] (-843.824) (-844.068) * (-851.311) (-846.377) (-846.905) [-845.418] -- 0:00:05
907500 -- (-850.099) [-848.379] (-843.146) (-843.235) * [-842.590] (-845.134) (-844.574) (-845.121) -- 0:00:05
908000 -- (-846.687) (-845.564) [-844.335] (-850.379) * (-842.798) (-843.557) [-843.323] (-842.382) -- 0:00:05
908500 -- (-843.248) (-846.034) (-842.818) [-844.776] * (-844.910) (-843.410) [-844.838] (-842.414) -- 0:00:05
909000 -- (-845.671) (-848.220) [-842.963] (-842.679) * (-845.876) [-842.647] (-844.533) (-845.462) -- 0:00:05
909500 -- [-843.816] (-845.357) (-844.534) (-843.564) * (-843.166) [-844.981] (-842.429) (-843.931) -- 0:00:05
910000 -- [-842.898] (-843.201) (-843.522) (-842.771) * (-842.855) [-845.686] (-844.841) (-843.671) -- 0:00:05
Average standard deviation of split frequencies: 0.007454
910500 -- (-842.905) (-843.784) [-844.117] (-843.572) * (-845.610) (-844.815) [-845.220] (-843.397) -- 0:00:05
911000 -- (-845.006) (-843.137) [-844.489] (-842.970) * (-847.358) [-843.987] (-842.763) (-846.988) -- 0:00:05
911500 -- (-846.086) [-846.280] (-843.039) (-843.758) * [-843.830] (-843.740) (-842.804) (-843.824) -- 0:00:05
912000 -- (-848.587) (-846.063) (-843.710) [-843.081] * (-845.135) (-842.841) [-843.055] (-843.503) -- 0:00:05
912500 -- (-844.244) [-843.736] (-842.746) (-843.999) * [-843.940] (-846.168) (-843.568) (-852.021) -- 0:00:05
913000 -- (-842.803) [-843.787] (-848.657) (-845.045) * [-842.157] (-844.436) (-846.154) (-846.586) -- 0:00:05
913500 -- [-843.913] (-845.384) (-848.118) (-843.457) * (-844.412) (-845.761) [-842.610] (-844.754) -- 0:00:05
914000 -- [-847.585] (-841.968) (-847.456) (-843.039) * (-847.808) (-848.479) (-844.533) [-843.613] -- 0:00:05
914500 -- (-842.877) (-845.765) [-846.151] (-842.891) * (-845.470) (-843.944) (-846.602) [-844.749] -- 0:00:05
915000 -- (-848.341) (-845.570) (-843.787) [-842.876] * (-848.854) [-844.219] (-843.251) (-842.257) -- 0:00:05
Average standard deviation of split frequencies: 0.007068
915500 -- (-847.010) (-843.915) [-843.055] (-844.620) * (-845.860) (-843.318) (-844.698) [-844.332] -- 0:00:05
916000 -- (-847.842) (-843.066) [-844.739] (-842.754) * (-843.462) (-842.706) (-843.009) [-845.231] -- 0:00:05
916500 -- (-843.054) (-844.477) (-843.525) [-842.480] * (-843.235) (-842.062) [-843.491] (-843.146) -- 0:00:05
917000 -- [-841.918] (-845.694) (-845.542) (-842.472) * (-843.677) [-841.879] (-845.303) (-843.398) -- 0:00:05
917500 -- (-842.028) [-845.788] (-843.718) (-844.574) * [-842.876] (-842.506) (-847.268) (-844.957) -- 0:00:05
918000 -- (-845.822) (-842.926) (-842.731) [-842.378] * (-843.039) (-844.039) [-842.606] (-848.511) -- 0:00:05
918500 -- (-845.501) [-842.629] (-842.663) (-843.728) * (-847.733) (-844.652) (-846.353) [-845.322] -- 0:00:04
919000 -- [-842.324] (-842.907) (-844.579) (-844.556) * (-851.004) [-844.288] (-847.794) (-844.354) -- 0:00:04
919500 -- (-843.213) (-843.631) (-843.475) [-842.179] * (-842.646) [-842.006] (-844.748) (-842.624) -- 0:00:04
920000 -- (-845.384) (-843.878) [-846.246] (-844.648) * (-844.054) [-845.828] (-846.085) (-845.152) -- 0:00:04
Average standard deviation of split frequencies: 0.006998
920500 -- (-846.593) (-846.281) (-843.046) [-842.296] * (-844.023) (-844.160) (-846.855) [-843.061] -- 0:00:04
921000 -- (-843.836) [-846.361] (-843.800) (-842.658) * [-846.766] (-843.433) (-846.544) (-844.116) -- 0:00:04
921500 -- [-842.436] (-847.800) (-843.311) (-842.664) * [-844.286] (-844.043) (-844.056) (-843.191) -- 0:00:04
922000 -- [-845.391] (-842.528) (-844.204) (-842.058) * (-849.605) (-845.210) (-844.617) [-843.255] -- 0:00:04
922500 -- (-846.384) (-844.978) (-843.770) [-842.008] * [-843.211] (-844.019) (-842.461) (-849.071) -- 0:00:04
923000 -- (-845.492) (-842.593) [-845.065] (-844.024) * (-844.875) (-843.858) [-845.547] (-844.299) -- 0:00:04
923500 -- (-845.012) (-843.116) [-843.715] (-847.318) * [-843.100] (-846.083) (-842.563) (-846.882) -- 0:00:04
924000 -- (-845.495) (-843.632) (-844.242) [-846.095] * (-844.701) (-850.522) (-842.258) [-845.314] -- 0:00:04
924500 -- (-847.442) (-842.829) [-844.872] (-846.260) * (-846.059) [-843.252] (-842.376) (-842.724) -- 0:00:04
925000 -- (-852.973) [-844.458] (-842.582) (-845.167) * (-845.928) [-843.074] (-844.092) (-845.076) -- 0:00:04
Average standard deviation of split frequencies: 0.006923
925500 -- (-845.037) (-843.220) (-843.209) [-845.389] * (-845.363) (-844.973) [-843.285] (-843.115) -- 0:00:04
926000 -- (-844.601) (-842.937) (-844.127) [-845.919] * (-843.431) (-845.782) (-846.010) [-842.989] -- 0:00:04
926500 -- (-844.196) [-846.969] (-844.435) (-844.599) * (-842.839) (-846.099) (-845.480) [-847.783] -- 0:00:04
927000 -- [-847.590] (-843.001) (-842.227) (-842.898) * (-845.149) (-845.376) (-849.807) [-845.142] -- 0:00:04
927500 -- (-845.566) [-845.550] (-842.686) (-843.001) * (-844.632) [-843.077] (-844.139) (-843.412) -- 0:00:04
928000 -- (-845.761) (-845.369) [-843.892] (-844.277) * (-843.654) [-847.411] (-845.326) (-842.616) -- 0:00:04
928500 -- (-842.822) [-847.334] (-842.926) (-847.399) * (-844.519) (-843.489) [-843.695] (-843.094) -- 0:00:04
929000 -- (-844.245) (-844.544) (-842.674) [-844.838] * (-842.659) [-844.363] (-843.267) (-842.202) -- 0:00:04
929500 -- (-843.168) (-844.397) (-843.281) [-846.383] * (-843.587) (-847.902) (-843.681) [-843.179] -- 0:00:04
930000 -- [-842.843] (-844.990) (-843.028) (-844.368) * (-846.831) [-841.888] (-846.917) (-844.752) -- 0:00:04
Average standard deviation of split frequencies: 0.007159
930500 -- [-843.841] (-845.319) (-842.369) (-847.284) * [-848.227] (-842.818) (-843.432) (-844.028) -- 0:00:04
931000 -- [-843.405] (-845.147) (-845.933) (-845.063) * [-844.114] (-842.620) (-843.798) (-846.738) -- 0:00:04
931500 -- (-844.632) [-843.180] (-845.805) (-844.867) * [-847.008] (-842.726) (-844.436) (-845.830) -- 0:00:04
932000 -- (-844.450) [-844.305] (-843.013) (-844.051) * [-843.630] (-842.384) (-846.020) (-843.646) -- 0:00:04
932500 -- (-846.531) (-842.457) (-845.744) [-845.809] * (-844.062) [-842.351] (-844.392) (-842.952) -- 0:00:04
933000 -- (-844.215) (-845.567) (-846.619) [-844.915] * (-842.573) (-845.166) [-842.594] (-843.648) -- 0:00:04
933500 -- (-846.888) (-842.818) [-845.512] (-843.400) * (-843.217) (-847.150) (-842.767) [-842.944] -- 0:00:04
934000 -- (-843.874) [-844.833] (-843.554) (-844.277) * [-843.728] (-845.108) (-844.897) (-846.705) -- 0:00:04
934500 -- [-846.568] (-844.067) (-845.924) (-845.083) * (-842.270) [-844.750] (-842.115) (-844.155) -- 0:00:03
935000 -- (-846.742) (-842.986) (-844.950) [-843.088] * (-842.190) (-842.953) [-842.314] (-842.751) -- 0:00:03
Average standard deviation of split frequencies: 0.007017
935500 -- (-846.035) (-844.301) [-846.089] (-844.527) * (-844.710) [-844.229] (-841.839) (-844.043) -- 0:00:03
936000 -- (-845.357) (-843.197) (-848.375) [-843.956] * (-846.405) [-852.692] (-845.667) (-852.770) -- 0:00:03
936500 -- [-844.979] (-843.578) (-844.074) (-844.988) * [-843.229] (-850.196) (-844.267) (-846.761) -- 0:00:03
937000 -- (-843.729) (-843.306) (-843.348) [-843.501] * (-843.912) (-845.464) (-843.121) [-844.162] -- 0:00:03
937500 -- [-843.258] (-846.941) (-842.420) (-844.504) * (-843.939) (-844.007) (-844.254) [-842.886] -- 0:00:03
938000 -- (-844.417) (-846.611) [-842.496] (-848.328) * [-848.558] (-843.704) (-851.019) (-842.694) -- 0:00:03
938500 -- (-842.092) (-847.301) [-842.858] (-852.741) * (-847.247) (-842.198) (-847.177) [-843.863] -- 0:00:03
939000 -- [-844.515] (-847.293) (-845.015) (-846.608) * (-843.485) (-848.672) (-843.384) [-845.115] -- 0:00:03
939500 -- (-847.346) (-844.955) (-845.764) [-845.228] * (-842.173) [-845.409] (-843.609) (-845.785) -- 0:00:03
940000 -- [-842.891] (-844.413) (-842.394) (-843.030) * (-842.904) (-842.924) [-843.335] (-843.503) -- 0:00:03
Average standard deviation of split frequencies: 0.007049
940500 -- (-845.650) (-845.667) (-843.709) [-843.534] * (-844.315) [-843.242] (-850.001) (-844.125) -- 0:00:03
941000 -- [-843.074] (-845.182) (-843.287) (-843.256) * (-842.966) (-844.499) (-842.961) [-844.544] -- 0:00:03
941500 -- (-844.899) (-844.324) (-842.738) [-842.339] * (-844.325) (-843.384) [-843.844] (-842.862) -- 0:00:03
942000 -- (-851.234) (-843.128) (-843.509) [-843.710] * (-842.448) [-843.485] (-843.404) (-842.382) -- 0:00:03
942500 -- (-843.783) (-843.675) (-843.503) [-844.361] * (-844.233) (-843.949) (-846.641) [-842.382] -- 0:00:03
943000 -- [-843.530] (-844.903) (-844.738) (-842.929) * (-846.368) (-843.421) [-844.439] (-842.699) -- 0:00:03
943500 -- (-848.014) (-844.957) (-846.460) [-845.087] * [-843.244] (-843.923) (-844.876) (-842.973) -- 0:00:03
944000 -- (-849.168) [-843.524] (-844.827) (-843.011) * (-842.407) (-846.503) [-842.943] (-842.801) -- 0:00:03
944500 -- (-844.353) (-843.841) [-842.452] (-845.533) * (-845.362) (-843.942) [-846.159] (-844.953) -- 0:00:03
945000 -- (-844.231) (-843.861) [-843.617] (-845.822) * (-844.011) [-845.425] (-847.209) (-845.366) -- 0:00:03
Average standard deviation of split frequencies: 0.007076
945500 -- (-845.218) (-842.902) [-845.831] (-845.640) * (-843.282) (-844.048) (-847.669) [-844.168] -- 0:00:03
946000 -- (-844.384) [-843.846] (-843.412) (-842.740) * (-843.112) (-844.438) (-854.014) [-843.672] -- 0:00:03
946500 -- [-845.971] (-844.017) (-845.922) (-846.115) * (-842.603) [-843.943] (-854.682) (-843.346) -- 0:00:03
947000 -- (-846.836) (-844.407) (-846.008) [-844.192] * (-843.503) [-842.739] (-843.235) (-844.165) -- 0:00:03
947500 -- (-845.233) (-843.524) (-848.234) [-844.761] * (-845.139) [-842.995] (-849.668) (-843.923) -- 0:00:03
948000 -- [-844.223] (-845.447) (-842.426) (-849.594) * (-843.880) (-846.753) [-843.029] (-849.520) -- 0:00:03
948500 -- (-842.902) (-843.692) [-843.230] (-848.506) * [-844.216] (-846.917) (-845.643) (-845.441) -- 0:00:03
949000 -- (-845.058) [-842.641] (-847.359) (-843.470) * [-846.004] (-850.355) (-842.884) (-848.758) -- 0:00:03
949500 -- [-846.235] (-843.179) (-847.778) (-846.692) * (-845.588) [-845.303] (-842.490) (-848.841) -- 0:00:03
950000 -- (-847.123) [-844.509] (-845.373) (-846.057) * (-845.693) (-843.581) [-842.996] (-842.784) -- 0:00:03
Average standard deviation of split frequencies: 0.007372
950500 -- (-846.292) (-842.372) (-844.777) [-843.364] * (-843.747) (-844.570) [-844.548] (-845.196) -- 0:00:03
951000 -- [-842.508] (-842.201) (-842.192) (-844.253) * (-844.375) [-843.268] (-845.251) (-842.530) -- 0:00:02
951500 -- [-841.974] (-843.189) (-842.941) (-847.549) * [-849.161] (-843.306) (-843.390) (-843.297) -- 0:00:02
952000 -- (-843.592) (-844.575) (-842.272) [-842.957] * [-845.126] (-843.089) (-847.719) (-844.957) -- 0:00:02
952500 -- (-844.157) [-842.083] (-841.988) (-843.869) * (-844.434) (-842.904) (-843.229) [-844.940] -- 0:00:02
953000 -- (-843.473) (-843.845) [-845.419] (-843.088) * (-844.355) [-845.909] (-843.747) (-843.906) -- 0:00:02
953500 -- (-842.810) [-844.797] (-843.790) (-845.938) * (-845.744) (-844.397) [-843.987] (-842.716) -- 0:00:02
954000 -- (-842.706) (-845.017) (-842.900) [-843.081] * (-850.820) (-846.213) (-845.281) [-842.683] -- 0:00:02
954500 -- (-847.854) (-844.351) (-845.003) [-844.380] * [-845.538] (-844.997) (-844.001) (-841.807) -- 0:00:02
955000 -- [-846.217] (-844.006) (-845.668) (-844.842) * (-846.415) (-844.083) (-845.646) [-842.764] -- 0:00:02
Average standard deviation of split frequencies: 0.006640
955500 -- (-846.591) (-844.403) [-846.476] (-843.710) * (-846.140) [-844.791] (-842.882) (-843.771) -- 0:00:02
956000 -- (-843.751) (-845.028) [-844.293] (-846.640) * (-844.410) (-843.016) (-845.535) [-844.469] -- 0:00:02
956500 -- [-842.523] (-842.471) (-842.318) (-842.895) * (-843.371) (-843.999) [-845.058] (-844.087) -- 0:00:02
957000 -- [-843.212] (-843.649) (-843.574) (-843.379) * (-843.704) (-843.815) [-842.195] (-842.767) -- 0:00:02
957500 -- (-846.514) (-844.596) (-845.513) [-845.487] * (-845.011) (-843.702) [-843.377] (-846.052) -- 0:00:02
958000 -- (-845.906) [-844.528] (-844.812) (-844.293) * (-845.384) [-846.235] (-841.939) (-844.396) -- 0:00:02
958500 -- (-843.499) (-844.864) [-843.676] (-846.381) * [-843.234] (-844.643) (-842.441) (-844.994) -- 0:00:02
959000 -- (-846.689) (-845.839) (-846.522) [-843.727] * (-842.165) (-844.864) [-842.530] (-845.158) -- 0:00:02
959500 -- [-844.373] (-843.408) (-847.587) (-847.356) * (-846.285) [-845.419] (-843.198) (-844.667) -- 0:00:02
960000 -- (-843.361) [-843.408] (-844.063) (-844.189) * (-845.597) (-842.327) (-845.918) [-844.566] -- 0:00:02
Average standard deviation of split frequencies: 0.006543
960500 -- [-843.840] (-844.761) (-847.025) (-844.529) * (-844.968) (-845.789) [-845.708] (-845.557) -- 0:00:02
961000 -- (-844.905) (-843.283) (-846.557) [-844.605] * (-845.433) [-845.071] (-842.594) (-850.685) -- 0:00:02
961500 -- (-843.627) (-844.830) (-844.268) [-843.358] * (-844.790) [-844.238] (-845.310) (-842.622) -- 0:00:02
962000 -- (-842.272) (-844.327) [-843.088] (-846.536) * (-846.968) [-842.572] (-844.336) (-844.255) -- 0:00:02
962500 -- (-844.988) (-847.049) [-844.986] (-845.790) * (-843.409) (-842.955) (-843.123) [-845.244] -- 0:00:02
963000 -- (-842.322) (-845.559) [-842.697] (-845.603) * (-842.838) [-844.286] (-844.800) (-844.170) -- 0:00:02
963500 -- [-843.075] (-844.937) (-844.296) (-843.726) * [-842.474] (-843.795) (-844.670) (-843.065) -- 0:00:02
964000 -- (-845.590) (-847.061) [-843.983] (-842.457) * (-843.088) (-846.078) (-847.135) [-847.230] -- 0:00:02
964500 -- (-845.178) (-844.910) [-847.698] (-841.847) * (-842.370) (-844.805) [-843.508] (-846.648) -- 0:00:02
965000 -- (-846.077) (-845.472) (-849.506) [-842.850] * [-845.572] (-844.044) (-845.638) (-849.743) -- 0:00:02
Average standard deviation of split frequencies: 0.006344
965500 -- [-843.193] (-843.202) (-842.610) (-842.521) * [-842.681] (-843.154) (-842.098) (-842.938) -- 0:00:02
966000 -- (-843.060) (-844.133) (-843.333) [-844.272] * (-842.537) (-843.544) (-842.895) [-842.551] -- 0:00:02
966500 -- [-843.075] (-844.058) (-842.563) (-844.300) * [-844.951] (-843.737) (-844.603) (-845.099) -- 0:00:02
967000 -- (-845.114) (-843.992) (-842.562) [-841.884] * (-843.577) [-843.243] (-843.469) (-843.681) -- 0:00:02
967500 -- [-846.225] (-843.981) (-843.494) (-843.234) * (-844.070) (-842.758) [-849.241] (-843.616) -- 0:00:01
968000 -- (-847.848) [-844.090] (-843.241) (-842.487) * (-843.945) (-842.204) [-845.867] (-842.968) -- 0:00:01
968500 -- [-843.899] (-843.510) (-846.416) (-844.829) * (-845.983) (-842.563) [-842.605] (-845.254) -- 0:00:01
969000 -- (-842.786) (-845.068) [-843.894] (-844.967) * (-845.000) [-842.181] (-843.352) (-846.953) -- 0:00:01
969500 -- (-843.153) [-848.819] (-845.251) (-844.580) * (-845.218) [-842.669] (-843.714) (-843.986) -- 0:00:01
970000 -- [-843.597] (-844.004) (-843.591) (-843.442) * (-845.885) (-845.228) [-843.101] (-844.675) -- 0:00:01
Average standard deviation of split frequencies: 0.006249
970500 -- (-844.629) [-845.762] (-844.655) (-845.644) * (-843.148) (-844.152) [-845.966] (-844.030) -- 0:00:01
971000 -- (-845.529) [-846.772] (-843.158) (-846.501) * (-844.614) [-844.820] (-844.742) (-844.277) -- 0:00:01
971500 -- (-844.404) (-847.671) [-844.423] (-843.199) * (-844.942) (-846.309) [-844.477] (-842.389) -- 0:00:01
972000 -- (-843.433) (-846.470) [-843.005] (-843.707) * (-844.673) [-842.496] (-843.258) (-844.432) -- 0:00:01
972500 -- (-845.674) (-843.858) (-844.070) [-843.262] * (-846.094) (-844.257) (-844.371) [-847.248] -- 0:00:01
973000 -- (-843.649) [-843.175] (-842.059) (-847.423) * (-846.296) (-842.920) (-843.880) [-843.951] -- 0:00:01
973500 -- [-843.635] (-843.793) (-844.201) (-843.160) * (-843.789) (-845.110) [-843.858] (-849.728) -- 0:00:01
974000 -- (-843.576) (-842.301) (-843.680) [-843.057] * [-844.831] (-844.898) (-844.075) (-843.201) -- 0:00:01
974500 -- (-844.447) (-843.280) (-846.814) [-843.947] * (-845.066) (-847.713) (-848.812) [-842.207] -- 0:00:01
975000 -- (-844.858) (-843.023) [-846.447] (-843.454) * [-849.078] (-845.262) (-848.058) (-843.955) -- 0:00:01
Average standard deviation of split frequencies: 0.006633
975500 -- [-844.809] (-843.867) (-843.158) (-843.838) * (-843.881) [-842.185] (-845.112) (-842.920) -- 0:00:01
976000 -- [-845.165] (-843.330) (-843.955) (-844.975) * [-844.156] (-846.629) (-845.342) (-842.721) -- 0:00:01
976500 -- (-843.123) (-842.857) [-843.338] (-843.929) * (-841.860) [-842.230] (-842.632) (-843.064) -- 0:00:01
977000 -- (-843.482) (-849.566) (-844.026) [-844.105] * (-844.950) (-843.214) [-843.985] (-842.584) -- 0:00:01
977500 -- [-844.177] (-841.998) (-845.008) (-844.648) * [-845.336] (-844.099) (-845.714) (-843.444) -- 0:00:01
978000 -- [-844.685] (-845.633) (-843.524) (-845.063) * (-844.723) (-843.893) (-842.388) [-842.247] -- 0:00:01
978500 -- (-845.295) [-844.534] (-842.224) (-847.722) * (-845.476) [-844.020] (-843.323) (-843.289) -- 0:00:01
979000 -- (-844.209) (-843.902) (-843.172) [-842.542] * (-843.899) (-843.882) [-847.266] (-844.493) -- 0:00:01
979500 -- (-846.698) [-846.446] (-844.715) (-845.686) * (-844.236) [-844.531] (-844.874) (-843.627) -- 0:00:01
980000 -- (-842.462) [-844.687] (-842.527) (-845.624) * [-842.756] (-843.737) (-844.389) (-845.202) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
980500 -- [-844.004] (-847.830) (-844.136) (-844.955) * [-847.213] (-844.578) (-843.249) (-846.913) -- 0:00:01
981000 -- (-843.587) (-847.452) [-844.412] (-844.800) * (-844.517) [-844.586] (-842.744) (-845.743) -- 0:00:01
981500 -- (-844.686) [-844.693] (-845.739) (-844.084) * (-843.088) (-851.839) (-844.354) [-845.117] -- 0:00:01
982000 -- (-842.994) [-844.903] (-843.162) (-842.272) * (-842.152) (-844.271) (-844.366) [-842.667] -- 0:00:01
982500 -- (-844.055) [-843.681] (-844.446) (-844.838) * [-845.309] (-844.408) (-846.438) (-842.848) -- 0:00:01
983000 -- (-844.536) (-843.256) [-843.040] (-845.561) * (-842.496) (-845.679) (-849.319) [-844.100] -- 0:00:01
983500 -- (-842.879) (-842.289) [-843.006] (-843.019) * (-842.242) (-849.018) (-845.909) [-851.056] -- 0:00:01
984000 -- (-843.650) [-845.918] (-843.242) (-842.821) * (-843.858) [-844.352] (-843.049) (-847.750) -- 0:00:00
984500 -- (-843.183) (-846.796) (-843.549) [-842.827] * (-842.272) (-844.599) (-842.144) [-844.008] -- 0:00:00
985000 -- (-846.233) [-842.569] (-845.776) (-843.829) * [-845.024] (-844.951) (-845.460) (-847.008) -- 0:00:00
Average standard deviation of split frequencies: 0.006757
985500 -- (-844.583) [-842.374] (-848.526) (-843.525) * (-844.792) [-843.979] (-844.771) (-845.588) -- 0:00:00
986000 -- (-847.417) (-842.818) [-844.501] (-846.820) * [-844.682] (-844.519) (-843.016) (-846.313) -- 0:00:00
986500 -- (-849.813) [-842.825] (-843.718) (-844.654) * (-844.904) (-844.188) [-841.920] (-842.609) -- 0:00:00
987000 -- (-843.228) (-843.278) (-843.447) [-847.118] * (-843.324) (-843.973) [-842.138] (-842.130) -- 0:00:00
987500 -- [-842.304] (-844.596) (-845.231) (-843.588) * (-849.569) (-844.295) [-841.901] (-843.644) -- 0:00:00
988000 -- (-842.401) [-845.672] (-844.751) (-846.442) * [-844.419] (-842.587) (-843.965) (-843.711) -- 0:00:00
988500 -- (-846.762) (-843.163) [-843.592] (-844.510) * (-845.422) [-844.466] (-843.872) (-843.684) -- 0:00:00
989000 -- (-847.486) (-843.138) [-842.969] (-842.589) * (-845.738) (-844.755) [-842.365] (-843.310) -- 0:00:00
989500 -- (-842.945) (-844.147) (-843.897) [-844.247] * (-844.054) [-844.128] (-844.502) (-843.253) -- 0:00:00
990000 -- (-842.825) (-845.742) [-843.734] (-846.086) * (-844.916) [-843.643] (-844.092) (-845.109) -- 0:00:00
Average standard deviation of split frequencies: 0.007169
990500 -- (-843.107) [-843.220] (-844.203) (-846.485) * [-847.907] (-843.711) (-843.909) (-843.366) -- 0:00:00
991000 -- [-843.045] (-842.773) (-846.081) (-845.395) * (-843.072) (-846.197) [-843.895] (-843.057) -- 0:00:00
991500 -- (-842.704) [-843.002] (-845.392) (-847.196) * (-846.985) (-847.146) [-845.220] (-847.501) -- 0:00:00
992000 -- [-844.252] (-842.718) (-844.893) (-846.137) * (-843.889) (-847.270) [-843.582] (-848.544) -- 0:00:00
992500 -- (-846.781) (-844.450) (-844.909) [-845.942] * (-844.243) [-845.705] (-842.989) (-845.074) -- 0:00:00
993000 -- (-845.440) (-849.320) [-846.762] (-846.538) * [-843.189] (-845.960) (-842.141) (-844.115) -- 0:00:00
993500 -- (-850.808) (-842.749) (-847.246) [-843.234] * (-842.421) (-845.910) (-843.203) [-846.410] -- 0:00:00
994000 -- [-846.482] (-844.455) (-846.462) (-845.330) * (-845.940) (-845.901) [-843.899] (-845.599) -- 0:00:00
994500 -- (-843.839) [-844.183] (-846.128) (-843.346) * (-844.272) (-845.516) [-842.957] (-843.879) -- 0:00:00
995000 -- (-842.657) [-845.498] (-847.888) (-842.490) * (-844.872) (-846.873) [-843.919] (-843.194) -- 0:00:00
Average standard deviation of split frequencies: 0.006973
995500 -- [-842.577] (-842.752) (-843.934) (-842.496) * (-844.760) [-847.289] (-844.234) (-844.955) -- 0:00:00
996000 -- (-847.827) (-843.359) (-845.320) [-842.072] * (-848.447) (-847.461) (-845.071) [-845.726] -- 0:00:00
996500 -- (-843.567) (-843.110) [-843.604] (-844.387) * (-845.143) (-844.797) [-842.015] (-846.932) -- 0:00:00
997000 -- [-845.451] (-844.506) (-844.687) (-842.414) * (-847.465) (-845.465) [-844.361] (-846.402) -- 0:00:00
997500 -- (-848.538) (-843.000) [-842.546] (-844.408) * (-843.714) [-842.766] (-844.360) (-843.917) -- 0:00:00
998000 -- (-845.881) (-843.802) (-845.019) [-844.535] * (-843.680) (-842.454) [-844.545] (-846.122) -- 0:00:00
998500 -- (-842.877) [-843.297] (-842.195) (-843.507) * (-847.608) (-842.062) (-845.021) [-848.730] -- 0:00:00
999000 -- (-845.665) [-844.443] (-843.993) (-843.505) * (-843.625) (-842.846) (-843.404) [-845.822] -- 0:00:00
999500 -- (-846.888) (-842.824) [-843.690] (-843.926) * [-846.604] (-844.960) (-842.123) (-842.223) -- 0:00:00
1000000 -- (-843.802) (-848.175) (-845.246) [-843.852] * (-843.113) (-842.707) (-846.784) [-841.974] -- 0:00:00
Average standard deviation of split frequencies: 0.007035
Analysis completed in 1 mins 1 seconds
Analysis used 59.97 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -841.73
Likelihood of best state for "cold" chain of run 2 was -841.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.0 % ( 20 %) Dirichlet(Pi{all})
31.1 % ( 27 %) Slider(Pi{all})
78.9 % ( 57 %) Multiplier(Alpha{1,2})
77.7 % ( 47 %) Multiplier(Alpha{3})
22.5 % ( 42 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.5 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.6 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.3 % ( 27 %) Dirichlet(Pi{all})
30.6 % ( 32 %) Slider(Pi{all})
78.8 % ( 58 %) Multiplier(Alpha{1,2})
77.9 % ( 54 %) Multiplier(Alpha{3})
22.0 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166526 0.82 0.67
3 | 166296 166255 0.84
4 | 167059 166393 167471
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166367 0.82 0.67
3 | 166087 166953 0.84
4 | 166965 166343 167285
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -843.60
| 12 2 1 |
| 2 11 2 |
| 2 1 2 2 2 11 |
|2*21 21 2 * 1 111 2 1 2 1 1121 1 1|
| 2 2 21 2 22 1 |
| 1 11 2 21 * 2 1 2 2 1 2 *1 |
|1 1 12 2 2 * *1 2 1 |
| 2 21 1 1 1 ** 22 22 2 1 1 2 2 2|
| 2 2 21 1 2 2 2 2 |
| 2 2 2 1 1 2 1 |
| 1 11 |
| 1 |
| 1 |
| |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -845.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -843.53 -846.56
2 -843.46 -846.64
--------------------------------------
TOTAL -843.50 -846.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895106 0.090634 0.361872 1.478266 0.859936 1370.14 1435.57 1.000
r(A<->C){all} 0.161719 0.018745 0.000056 0.429959 0.127351 295.51 375.16 1.005
r(A<->G){all} 0.172807 0.021012 0.000061 0.473061 0.134206 278.75 306.30 1.004
r(A<->T){all} 0.169021 0.019463 0.000022 0.441047 0.134207 304.96 363.37 1.000
r(C<->G){all} 0.165434 0.018142 0.000075 0.433181 0.129955 255.44 290.75 1.001
r(C<->T){all} 0.170340 0.019978 0.000113 0.447098 0.132416 175.29 243.82 1.005
r(G<->T){all} 0.160680 0.017912 0.000088 0.433357 0.128069 206.07 249.42 1.000
pi(A){all} 0.177390 0.000232 0.146850 0.204973 0.177443 1265.14 1298.56 1.000
pi(C){all} 0.273802 0.000320 0.237322 0.307087 0.273768 1121.31 1285.43 1.000
pi(G){all} 0.339085 0.000359 0.301721 0.376194 0.338839 1227.31 1295.72 1.000
pi(T){all} 0.209724 0.000272 0.178009 0.241906 0.209136 1216.42 1225.63 1.000
alpha{1,2} 0.408667 0.215211 0.000105 1.336803 0.244070 1062.01 1176.23 1.000
alpha{3} 0.446218 0.242914 0.000248 1.441813 0.275944 1334.05 1337.71 1.000
pinvar{all} 0.997393 0.000010 0.991651 0.999998 0.998419 1196.10 1296.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .****.
9 -- ..*..*
10 -- .**...
11 -- ....**
12 -- .**.**
13 -- .*.*..
14 -- .*...*
15 -- ..****
16 -- ...**.
17 -- .*..*.
18 -- .***.*
19 -- .*.***
20 -- ..**..
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.008480 0.151233 0.163225 2
8 457 0.152232 0.001413 0.151233 0.153231 2
9 445 0.148235 0.015546 0.137242 0.159227 2
10 444 0.147901 0.008480 0.141905 0.153897 2
11 443 0.147568 0.001413 0.146569 0.148568 2
12 443 0.147568 0.005182 0.143904 0.151233 2
13 438 0.145903 0.003769 0.143238 0.148568 2
14 429 0.142905 0.002355 0.141239 0.144570 2
15 428 0.142572 0.007537 0.137242 0.147901 2
16 418 0.139241 0.002827 0.137242 0.141239 2
17 415 0.138241 0.002355 0.136576 0.139907 2
18 411 0.136909 0.010835 0.129247 0.144570 2
19 407 0.135576 0.006124 0.131246 0.139907 2
20 406 0.135243 0.008480 0.129247 0.141239 2
21 404 0.134577 0.020728 0.119920 0.149234 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097234 0.009124 0.000078 0.284834 0.068656 1.000 2
length{all}[2] 0.100798 0.010326 0.000052 0.297300 0.072156 1.000 2
length{all}[3] 0.097760 0.009391 0.000007 0.282529 0.068878 1.000 2
length{all}[4] 0.100519 0.010572 0.000089 0.310324 0.065576 1.000 2
length{all}[5] 0.100117 0.010427 0.000114 0.301999 0.068054 1.000 2
length{all}[6] 0.097528 0.009101 0.000000 0.293698 0.068296 1.000 2
length{all}[7] 0.101637 0.010632 0.000881 0.285595 0.071763 1.001 2
length{all}[8] 0.100845 0.011720 0.000051 0.317686 0.066523 0.999 2
length{all}[9] 0.096449 0.009785 0.000131 0.305490 0.059068 1.001 2
length{all}[10] 0.105614 0.009694 0.000297 0.283767 0.074411 0.999 2
length{all}[11] 0.100654 0.011621 0.000018 0.323113 0.062718 1.001 2
length{all}[12] 0.095783 0.009382 0.000030 0.296104 0.063333 0.998 2
length{all}[13] 0.104727 0.009814 0.000098 0.298376 0.074560 0.999 2
length{all}[14] 0.107969 0.011868 0.000197 0.339850 0.069878 0.998 2
length{all}[15] 0.091172 0.006938 0.000250 0.254828 0.068792 0.998 2
length{all}[16] 0.103895 0.011645 0.000162 0.306856 0.076575 0.998 2
length{all}[17] 0.097463 0.008992 0.000775 0.287326 0.069103 0.998 2
length{all}[18] 0.100842 0.010770 0.000011 0.282238 0.075866 0.999 2
length{all}[19] 0.103193 0.009528 0.000107 0.291339 0.075387 0.998 2
length{all}[20] 0.093510 0.008728 0.000378 0.276377 0.066878 1.000 2
length{all}[21] 0.099149 0.009370 0.000311 0.286920 0.067702 1.012 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007035
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 621
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 207 / 207 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 207 / 207 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101169 0.028906 0.049282 0.045521 0.036258 0.109717 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -882.859679
Iterating by ming2
Initial: fx= 882.859679
x= 0.10117 0.02891 0.04928 0.04552 0.03626 0.10972 0.30000 1.30000
1 h-m-p 0.0000 0.0001 498.0623 ++ 847.724875 m 0.0001 13 | 1/8
2 h-m-p 0.0031 0.0290 20.4026 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 456.6179 ++ 840.218385 m 0.0000 45 | 2/8
4 h-m-p 0.0009 0.1106 15.8062 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 408.3530 ++ 832.638504 m 0.0000 76 | 3/8
6 h-m-p 0.0012 0.1381 13.0895 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 353.5678 ++ 830.331493 m 0.0000 107 | 4/8
8 h-m-p 0.0005 0.1165 10.2476 -----------.. | 4/8
9 h-m-p 0.0000 0.0003 287.8426 +++ 808.917673 m 0.0003 139 | 5/8
10 h-m-p 0.0074 0.2703 7.0211 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 205.4226 ++ 807.125201 m 0.0000 172 | 6/8
12 h-m-p 0.1355 8.0000 0.0000 +++ 807.125201 m 8.0000 184 | 6/8
13 h-m-p 0.5903 8.0000 0.0000 ++ 807.125201 m 8.0000 197 | 6/8
14 h-m-p 0.0080 4.0046 0.1170 ------Y 807.125201 0 0.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -----C 807.125201 0 0.0000 234 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ----C 807.125201 0 0.0000 251
Out..
lnL = -807.125201
252 lfun, 252 eigenQcodon, 1512 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.062715 0.060152 0.072708 0.109427 0.102821 0.057130 0.300156 0.559669 0.229615
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.495375
np = 9
lnL0 = -897.296803
Iterating by ming2
Initial: fx= 897.296803
x= 0.06271 0.06015 0.07271 0.10943 0.10282 0.05713 0.30016 0.55967 0.22962
1 h-m-p 0.0000 0.0003 450.2302 +++ 832.086876 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0001 243.8137 ++ 829.012426 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 1229.3358 ++ 826.522519 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 2045.3383 ++ 819.848030 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 4052.7612 ++ 809.054623 m 0.0000 63 | 5/9
6 h-m-p 0.0047 0.0326 11.7994 ------------.. | 5/9
7 h-m-p 0.0000 0.0000 287.5527 ++ 808.186714 m 0.0000 97 | 6/9
8 h-m-p 0.0003 0.0594 6.3801 ----------.. | 6/9
9 h-m-p 0.0000 0.0000 203.7438 ++ 807.125175 m 0.0000 129 | 7/9
10 h-m-p 0.1373 8.0000 0.0000 +++ 807.125175 m 8.0000 142 | 7/9
11 h-m-p 0.3426 8.0000 0.0001 +++ 807.125175 m 8.0000 157 | 7/9
12 h-m-p 0.0022 1.0214 0.2830 ---------Y 807.125175 0 0.0000 180 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 --Y 807.125175 0 0.0003 196 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 Y 807.125175 0 0.0160 210
Out..
lnL = -807.125175
211 lfun, 633 eigenQcodon, 2532 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086367 0.103283 0.084633 0.053170 0.020456 0.098332 0.288011 0.941474 0.345164 0.306120 1.355734
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.104732
np = 11
lnL0 = -894.042930
Iterating by ming2
Initial: fx= 894.042930
x= 0.08637 0.10328 0.08463 0.05317 0.02046 0.09833 0.28801 0.94147 0.34516 0.30612 1.35573
1 h-m-p 0.0000 0.0001 454.1895 ++ 871.265257 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0006 272.1092 ++ 838.978013 m 0.0006 30 | 2/11
3 h-m-p 0.0000 0.0000 2771.7098 ++ 814.310852 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0002 123.6750 ++ 813.060503 m 0.0002 58 | 4/11
5 h-m-p 0.0000 0.0000 2216.0810 ++ 811.867522 m 0.0000 72 | 5/11
6 h-m-p 0.0033 0.1864 4.2166 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 285.4475 ++ 808.093616 m 0.0000 110 | 6/11
8 h-m-p 0.0034 0.5497 2.7699 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 204.2563 ++ 807.125185 m 0.0000 148 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 807.125185 m 8.0000 165 | 7/11
11 h-m-p 0.0977 8.0000 0.0005 ++++ 807.125185 m 8.0000 185 | 7/11
12 h-m-p 0.0038 0.5475 1.1186 ++++ 807.125182 m 0.5475 205 | 8/11
13 h-m-p 0.3899 1.9496 0.3773 ++ 807.125179 m 1.9496 219 | 8/11
14 h-m-p 0.8066 8.0000 0.9119 -----------Y 807.125179 0 0.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 -----Y 807.125179 0 0.0000 269 | 8/11
16 h-m-p 0.0001 0.0466 0.0000 ---------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 807.125179 m 8.0000 313 | 8/11
18 h-m-p 0.0000 0.0002 0.8253 -----Y 807.125179 0 0.0000 335 | 8/11
19 h-m-p 0.0160 8.0000 0.2293 +++++ 807.125138 m 8.0000 355 | 8/11
20 h-m-p 0.0036 0.2170 508.3038 Y 807.125116 0 0.0090 372 | 8/11
21 h-m-p 1.6000 8.0000 0.1591 +C 807.125116 0 6.5711 387 | 8/11
22 h-m-p 1.6000 8.0000 0.0347 Y 807.125116 0 0.7437 404 | 8/11
23 h-m-p 1.6000 8.0000 0.0017 ++ 807.125116 m 8.0000 421 | 8/11
24 h-m-p 0.2993 8.0000 0.0462 ++Y 807.125116 0 3.7675 440 | 8/11
25 h-m-p 1.6000 8.0000 0.0023 ++ 807.125116 m 8.0000 457 | 8/11
26 h-m-p 0.0001 0.0056 128.8026 +++ 807.125111 m 0.0056 475 | 9/11
27 h-m-p 0.5620 8.0000 1.2799 ++ 807.125108 m 8.0000 489 | 9/11
28 h-m-p 1.6000 8.0000 0.0000 N 807.125108 0 1.6000 503
Out..
lnL = -807.125108
504 lfun, 2016 eigenQcodon, 9072 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -807.162356 S = -807.125860 -0.014054
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:03
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068530 0.091913 0.055134 0.068536 0.029093 0.064628 0.000100 0.461304 1.976799
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.033908
np = 9
lnL0 = -880.374748
Iterating by ming2
Initial: fx= 880.374748
x= 0.06853 0.09191 0.05513 0.06854 0.02909 0.06463 0.00011 0.46130 1.97680
1 h-m-p 0.0000 0.0000 453.6158 ++ 879.949105 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0160 30.8051 +++++ 878.069866 m 0.0160 29 | 2/9
3 h-m-p 0.0000 0.0001 6286.0111 ++ 872.810831 m 0.0001 41 | 3/9
4 h-m-p 0.0001 0.0003 4143.6399 ++ 868.484667 m 0.0003 53 | 3/9
5 h-m-p 0.0047 0.0233 29.3860 YYYYYY 866.799494 5 0.0012 70 | 3/9
6 h-m-p 0.0060 0.0299 1.1651 YCCCC 866.797038 4 0.0020 89 | 3/9
7 h-m-p 0.0039 0.2467 0.6117 ------------.. | 3/9
8 h-m-p 0.0000 0.0003 376.5721 +++ 828.189591 m 0.0003 130 | 4/9
9 h-m-p 0.0049 0.3026 17.5360 YYYC 828.184786 3 0.0012 145 | 4/9
10 h-m-p 0.7086 8.0000 0.0305 ----------------.. | 3/9
11 h-m-p 0.0000 0.0001 376.1871 ++ 817.396795 m 0.0001 188 | 4/9
12 h-m-p 0.0009 0.0059 27.7616 ++ 814.385206 m 0.0059 200 | 5/9
13 h-m-p 0.0000 0.0000 24499.7458 ++ 814.381804 m 0.0000 212 | 6/9
14 h-m-p 0.0000 0.0000 34434.2793 ++ 813.754089 m 0.0000 224 | 6/9
15 h-m-p -0.0000 -0.0000 220.2384
h-m-p: -2.27502649e-20 -1.13751324e-19 2.20238421e+02 813.754089
.. | 6/9
16 h-m-p 0.0000 0.0002 204.1829 ++ 807.125201 m 0.0002 245 | 7/9
17 h-m-p 0.6305 8.0000 0.0000 +N 807.125201 0 2.5221 258
QuantileBeta(0.85, 0.42076, 0.00494) = 1.000000e+00 2000 rounds
| 6/9
18 h-m-p 0.0445 4.6338 0.0000 ++++ 807.125201 m 4.6338 274
QuantileBeta(0.85, 0.42070, 0.00494) = 1.000000e+00 2000 rounds
| 6/9
19 h-m-p 0.0092 0.0459 0.0021 ---------C 807.125201 0 0.0000 298
QuantileBeta(0.85, 0.42070, 0.00494) = 1.000000e+00 2000 rounds
| 6/9
20 h-m-p 0.0160 8.0000 0.0000 +++++ 807.125201 m 8.0000 316
QuantileBeta(0.85, 0.42082, 0.00494) = 1.000000e+00 2000 rounds
| 6/9
21 h-m-p 0.0160 8.0000 0.5095 +++++ 807.125181 m 8.0000 334 | 6/9
22 h-m-p 1.6000 8.0000 1.0221 ++ 807.125172 m 8.0000 349 | 6/9
23 h-m-p 1.6000 8.0000 3.2835 ++ 807.125168 m 8.0000 361 | 6/9
24 h-m-p 1.6000 8.0000 1.8957 ++ 807.125167 m 8.0000 373 | 6/9
25 h-m-p 0.2814 1.4069 38.1583 ----------C 807.125167 0 0.0000 395 | 6/9
26 h-m-p 0.5117 8.0000 0.0000 --C 807.125167 0 0.0080 409 | 6/9
27 h-m-p 0.3496 8.0000 0.0000 Y 807.125167 0 0.3496 424
Out..
lnL = -807.125167
425 lfun, 4675 eigenQcodon, 25500 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065279 0.098978 0.044049 0.011186 0.017145 0.109428 33.476756 0.900000 0.932600 1.926612 1.300148
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.789700
np = 11
lnL0 = -874.097299
Iterating by ming2
Initial: fx= 874.097299
x= 0.06528 0.09898 0.04405 0.01119 0.01715 0.10943 33.47676 0.90000 0.93260 1.92661 1.30015
1 h-m-p 0.0000 0.0001 455.2695 ++ 861.847422 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0003 156.3423 ++ 855.444747 m 0.0003 30 | 2/11
3 h-m-p 0.0001 0.0005 170.8645 ++ 832.344201 m 0.0005 44 | 3/11
4 h-m-p 0.0004 0.0022 58.8735 ++ 827.537936 m 0.0022 58 | 4/11
5 h-m-p 0.0001 0.0005 213.6009 ++ 813.407089 m 0.0005 72 | 5/11
6 h-m-p 0.0002 0.0008 573.3226 ++ 807.125171 m 0.0008 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 807.125171 m 8.0000 100 | 6/11
8 h-m-p 0.0318 8.0000 0.0164 --------C 807.125171 0 0.0000 127 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 807.125171 m 8.0000 149 | 6/11
10 h-m-p 0.0043 2.1284 0.6568 +++++ 807.125155 m 2.1284 171 | 7/11
11 h-m-p 1.5911 8.0000 0.7713 ++ 807.125150 m 8.0000 190 | 7/11
12 h-m-p 1.6000 8.0000 1.0593 ++ 807.125149 m 8.0000 208 | 7/11
13 h-m-p 1.6000 8.0000 4.2793 ++ 807.125148 m 8.0000 222 | 7/11
14 h-m-p 1.6000 8.0000 3.9490 ---------C 807.125148 0 0.0000 245 | 7/11
15 h-m-p 0.2662 8.0000 0.0000 ---------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 --Y 807.125148 0 0.0003 292
Out..
lnL = -807.125148
293 lfun, 3516 eigenQcodon, 19338 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -807.120642 S = -807.120314 -0.000143
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:17
did 20 / 54 patterns 0:17
did 30 / 54 patterns 0:17
did 40 / 54 patterns 0:17
did 50 / 54 patterns 0:17
did 54 / 54 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=207
NC_011896_1_WP_010907796_1_578_MLBR_RS02730 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
NC_002677_1_NP_301472_1_344_ribC MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV
**************************************************
NC_011896_1_WP_010907796_1_578_MLBR_RS02730 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
NC_002677_1_NP_301472_1_344_ribC VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ
**************************************************
NC_011896_1_WP_010907796_1_578_MLBR_RS02730 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
NC_002677_1_NP_301472_1_344_ribC GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG
**************************************************
NC_011896_1_WP_010907796_1_578_MLBR_RS02730 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
NC_002677_1_NP_301472_1_344_ribC LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV
**************************************************
NC_011896_1_WP_010907796_1_578_MLBR_RS02730 PTGDLTR
NC_002677_1_NP_301472_1_344_ribC PTGDLTR
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 PTGDLTR
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 PTGDLTR
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 PTGDLTR
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 PTGDLTR
*******
>NC_011896_1_WP_010907796_1_578_MLBR_RS02730 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA >NC_002677_1_NP_301472_1_344_ribC ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA >NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA >NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA >NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA >NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 ATGTTCACCGGAATTGTTGAGGAACTCGGAGAGGTGGTCGGTCGGGACGC CCATGCCGATGCGGCGCGCCTAATCATTCGCGGTCGCACGGTCACCGCCG ACGCTGGCCATGGCGATTCGATCGCGGTTAACGGCGTGTGCCTTACAGTG GTGGAGGTGCTGCCCGACGGCCAATTCAGTGCTGATGTGATGGCAGAAAC GCTCCATCGCTCCAACTTGGGTGAGCTACGAGTCGGCAATCGGGTCAACC TGGAGCGCGCTGTGGCTATTAACAGCCGGCTCGGCGGGCATATCGTGCAG GGGCATGTGGACGGCACCGGCGAGGTGGTGGCTCGCACCCTCTCAGACCA CTGGGAGGTGGTGCGGATAGAGGTGCCCCCGGCGGTGGCTCGCTATTTCG TTGAAAAGGGCTCGATCACCGTCGACGGGATTTCGCTGACGGTCTCCGGG CTCGGTGCTGAACCTCGGGACTGGTTGGAGGTTTCTTTGATCCCAACGAC CCGAGAGCTGACCACCCTTGGCCGTACTCCGTTGGGAACGCAGGTGAACC TTGAAGTGGACGTCATCGCCAAATATGTTGAGCGGCTACTCCAGAGCGTT CCTACCGGGGATTTGACTCGA
>NC_011896_1_WP_010907796_1_578_MLBR_RS02730 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR >NC_002677_1_NP_301472_1_344_ribC MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR >NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR >NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR >NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR >NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110 MFTGIVEELGEVVGRDAHADAARLIIRGRTVTADAGHGDSIAVNGVCLTV VEVLPDGQFSADVMAETLHRSNLGELRVGNRVNLERAVAINSRLGGHIVQ GHVDGTGEVVARTLSDHWEVVRIEVPPAVARYFVEKGSITVDGISLTVSG LGAEPRDWLEVSLIPTTRELTTLGRTPLGTQVNLEVDVIAKYVERLLQSV PTGDLTR
#NEXUS
[ID: 0046767513]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907796_1_578_MLBR_RS02730
NC_002677_1_NP_301472_1_344_ribC
NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325
NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735
NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020
NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907796_1_578_MLBR_RS02730,
2 NC_002677_1_NP_301472_1_344_ribC,
3 NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325,
4 NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735,
5 NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020,
6 NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06865572,2:0.07215608,3:0.06887766,4:0.0655759,5:0.06805372,6:0.06829557);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06865572,2:0.07215608,3:0.06887766,4:0.0655759,5:0.06805372,6:0.06829557);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -843.53 -846.56
2 -843.46 -846.64
--------------------------------------
TOTAL -843.50 -846.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/ribC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895106 0.090634 0.361872 1.478266 0.859936 1370.14 1435.57 1.000
r(A<->C){all} 0.161719 0.018745 0.000056 0.429959 0.127351 295.51 375.16 1.005
r(A<->G){all} 0.172807 0.021012 0.000061 0.473061 0.134206 278.75 306.30 1.004
r(A<->T){all} 0.169021 0.019463 0.000022 0.441047 0.134207 304.96 363.37 1.000
r(C<->G){all} 0.165434 0.018142 0.000075 0.433181 0.129955 255.44 290.75 1.001
r(C<->T){all} 0.170340 0.019978 0.000113 0.447098 0.132416 175.29 243.82 1.005
r(G<->T){all} 0.160680 0.017912 0.000088 0.433357 0.128069 206.07 249.42 1.000
pi(A){all} 0.177390 0.000232 0.146850 0.204973 0.177443 1265.14 1298.56 1.000
pi(C){all} 0.273802 0.000320 0.237322 0.307087 0.273768 1121.31 1285.43 1.000
pi(G){all} 0.339085 0.000359 0.301721 0.376194 0.338839 1227.31 1295.72 1.000
pi(T){all} 0.209724 0.000272 0.178009 0.241906 0.209136 1216.42 1225.63 1.000
alpha{1,2} 0.408667 0.215211 0.000105 1.336803 0.244070 1062.01 1176.23 1.000
alpha{3} 0.446218 0.242914 0.000248 1.441813 0.275944 1334.05 1337.71 1.000
pinvar{all} 0.997393 0.000010 0.991651 0.999998 0.998419 1196.10 1296.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/ribC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 207
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 2 2 2 2 2 2 | His CAT 5 5 5 5 5 5 | Arg CGT 1 1 1 1 1 1
CTC 6 6 6 6 6 6 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 9 9 9 9 9 9 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 7 7 7 7 7 7 | Asp GAT 4 4 4 4 4 4 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 7 7 7 | GCC 4 4 4 4 4 4 | GAC 8 8 8 8 8 8 | GGC 10 10 10 10 10 10
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 17 17 17 17 17 17 | GCG 4 4 4 4 4 4 | GAG 11 11 11 11 11 11 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907796_1_578_MLBR_RS02730
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
#2: NC_002677_1_NP_301472_1_344_ribC
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
#3: NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
#4: NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
#5: NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
#6: NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 12 | His H CAT 30 | Arg R CGT 6
CTC 36 | CCC 12 | CAC 6 | CGC 42
CTA 18 | CCA 6 | Gln Q CAA 6 | CGA 18
CTG 24 | CCG 12 | CAG 18 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 36 | ACC 54 | AAC 30 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 30 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 42 | Asp D GAT 24 | Gly G GGT 24
GTC 42 | GCC 24 | GAC 48 | GGC 60
GTA 0 | GCA 6 | Glu E GAA 30 | GGA 18
GTG 102 | GCG 24 | GAG 66 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09662 C:0.24155 A:0.19807 G:0.46377
position 2: T:0.32367 C:0.22705 A:0.23188 G:0.21739
position 3: T:0.20773 C:0.35266 A:0.10145 G:0.33816
Average T:0.20934 C:0.27375 A:0.17713 G:0.33977
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -807.125201 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300156 1.300148
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907796_1_578_MLBR_RS02730: 0.000004, NC_002677_1_NP_301472_1_344_ribC: 0.000004, NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325: 0.000004, NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735: 0.000004, NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020: 0.000004, NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30016
omega (dN/dS) = 1.30015
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 461.7 159.3 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -807.125175 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.288011 0.624226 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907796_1_578_MLBR_RS02730: 0.000004, NC_002677_1_NP_301472_1_344_ribC: 0.000004, NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325: 0.000004, NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735: 0.000004, NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020: 0.000004, NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28801
MLEs of dN/dS (w) for site classes (K=2)
p: 0.62423 0.37577
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
7..2 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
7..3 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
7..4 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
7..5 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
7..6 0.000 461.9 159.1 0.3758 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -807.125108 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907796_1_578_MLBR_RS02730: 0.000004, NC_002677_1_NP_301472_1_344_ribC: 0.000004, NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325: 0.000004, NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735: 0.000004, NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020: 0.000004, NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 466.7 154.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907796_1_578_MLBR_RS02730)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -807.125167 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 33.476756 42.391373 0.156958
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907796_1_578_MLBR_RS02730: 0.000004, NC_002677_1_NP_301472_1_344_ribC: 0.000004, NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325: 0.000004, NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735: 0.000004, NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020: 0.000004, NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 33.47676
Parameters in M7 (beta):
p = 42.39137 q = 0.15696
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.97981 0.99327 0.99735 0.99900 0.99966 0.99991 0.99998 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
7..2 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
7..3 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
7..4 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
7..5 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
7..6 0.000 429.4 191.6 0.9969 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -807.125148 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 33.606272 0.000010 2.790697 23.191943 47.266938
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907796_1_578_MLBR_RS02730: 0.000004, NC_002677_1_NP_301472_1_344_ribC: 0.000004, NZ_LVXE01000008_1_WP_010907796_1_2704_A3216_RS04325: 0.000004, NZ_LYPH01000055_1_WP_010907796_1_2031_A8144_RS09735: 0.000004, NZ_CP029543_1_WP_010907796_1_592_DIJ64_RS03020: 0.000004, NZ_AP014567_1_WP_010907796_1_610_JK2ML_RS03110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 33.60627
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.79070 q = 23.19194
(p1 = 0.99999) w = 47.26694
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.02915 0.04819 0.06286 0.07649 0.09021 0.10484 0.12135 0.14135 0.16873 0.22011 47.26694
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
7..2 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
7..3 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
7..4 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
7..5 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
7..6 0.000 429.4 191.6 47.2665 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907796_1_578_MLBR_RS02730)
Pr(w>1) post mean +- SE for w
1 M 1.000** 47.266
2 F 1.000** 47.266
3 T 1.000** 47.266
4 G 1.000** 47.266
5 I 1.000** 47.266
6 V 1.000** 47.266
7 E 1.000** 47.266
8 E 1.000** 47.266
9 L 1.000** 47.266
10 G 1.000** 47.266
11 E 1.000** 47.266
12 V 1.000** 47.266
13 V 1.000** 47.266
14 G 1.000** 47.266
15 R 1.000** 47.266
16 D 1.000** 47.266
17 A 1.000** 47.266
18 H 1.000** 47.266
19 A 1.000** 47.266
20 D 1.000** 47.266
21 A 1.000** 47.266
22 A 1.000** 47.266
23 R 1.000** 47.266
24 L 1.000** 47.266
25 I 1.000** 47.266
26 I 1.000** 47.266
27 R 1.000** 47.266
28 G 1.000** 47.266
29 R 1.000** 47.266
30 T 1.000** 47.266
31 V 1.000** 47.266
32 T 1.000** 47.266
33 A 1.000** 47.266
34 D 1.000** 47.266
35 A 1.000** 47.266
36 G 1.000** 47.266
37 H 1.000** 47.266
38 G 1.000** 47.266
39 D 1.000** 47.266
40 S 1.000** 47.266
41 I 1.000** 47.266
42 A 1.000** 47.266
43 V 1.000** 47.266
44 N 1.000** 47.266
45 G 1.000** 47.266
46 V 1.000** 47.266
47 C 1.000** 47.266
48 L 1.000** 47.266
49 T 1.000** 47.266
50 V 1.000** 47.266
51 V 1.000** 47.266
52 E 1.000** 47.266
53 V 1.000** 47.266
54 L 1.000** 47.266
55 P 1.000** 47.266
56 D 1.000** 47.266
57 G 1.000** 47.266
58 Q 1.000** 47.266
59 F 1.000** 47.266
60 S 1.000** 47.266
61 A 1.000** 47.266
62 D 1.000** 47.266
63 V 1.000** 47.266
64 M 1.000** 47.266
65 A 1.000** 47.266
66 E 1.000** 47.266
67 T 1.000** 47.266
68 L 1.000** 47.266
69 H 1.000** 47.266
70 R 1.000** 47.266
71 S 1.000** 47.266
72 N 1.000** 47.266
73 L 1.000** 47.266
74 G 1.000** 47.266
75 E 1.000** 47.266
76 L 1.000** 47.266
77 R 1.000** 47.266
78 V 1.000** 47.266
79 G 1.000** 47.266
80 N 1.000** 47.266
81 R 1.000** 47.266
82 V 1.000** 47.266
83 N 1.000** 47.266
84 L 1.000** 47.266
85 E 1.000** 47.266
86 R 1.000** 47.266
87 A 1.000** 47.266
88 V 1.000** 47.266
89 A 1.000** 47.266
90 I 1.000** 47.266
91 N 1.000** 47.266
92 S 1.000** 47.266
93 R 1.000** 47.266
94 L 1.000** 47.266
95 G 1.000** 47.266
96 G 1.000** 47.266
97 H 1.000** 47.266
98 I 1.000** 47.266
99 V 1.000** 47.266
100 Q 1.000** 47.266
101 G 1.000** 47.266
102 H 1.000** 47.266
103 V 1.000** 47.266
104 D 1.000** 47.266
105 G 1.000** 47.266
106 T 1.000** 47.266
107 G 1.000** 47.266
108 E 1.000** 47.266
109 V 1.000** 47.266
110 V 1.000** 47.266
111 A 1.000** 47.266
112 R 1.000** 47.266
113 T 1.000** 47.266
114 L 1.000** 47.266
115 S 1.000** 47.266
116 D 1.000** 47.266
117 H 1.000** 47.266
118 W 1.000** 47.266
119 E 1.000** 47.266
120 V 1.000** 47.266
121 V 1.000** 47.266
122 R 1.000** 47.266
123 I 1.000** 47.266
124 E 1.000** 47.266
125 V 1.000** 47.266
126 P 1.000** 47.266
127 P 1.000** 47.266
128 A 1.000** 47.266
129 V 1.000** 47.266
130 A 1.000** 47.266
131 R 1.000** 47.266
132 Y 1.000** 47.266
133 F 1.000** 47.266
134 V 1.000** 47.266
135 E 1.000** 47.266
136 K 1.000** 47.266
137 G 1.000** 47.266
138 S 1.000** 47.266
139 I 1.000** 47.266
140 T 1.000** 47.266
141 V 1.000** 47.266
142 D 1.000** 47.266
143 G 1.000** 47.266
144 I 1.000** 47.266
145 S 1.000** 47.266
146 L 1.000** 47.266
147 T 1.000** 47.266
148 V 1.000** 47.266
149 S 1.000** 47.266
150 G 1.000** 47.266
151 L 1.000** 47.266
152 G 1.000** 47.266
153 A 1.000** 47.266
154 E 1.000** 47.266
155 P 1.000** 47.266
156 R 1.000** 47.266
157 D 1.000** 47.266
158 W 1.000** 47.266
159 L 1.000** 47.266
160 E 1.000** 47.266
161 V 1.000** 47.266
162 S 1.000** 47.266
163 L 1.000** 47.266
164 I 1.000** 47.266
165 P 1.000** 47.266
166 T 1.000** 47.266
167 T 1.000** 47.266
168 R 1.000** 47.266
169 E 1.000** 47.266
170 L 1.000** 47.266
171 T 1.000** 47.266
172 T 1.000** 47.266
173 L 1.000** 47.266
174 G 1.000** 47.266
175 R 1.000** 47.266
176 T 1.000** 47.266
177 P 1.000** 47.266
178 L 1.000** 47.266
179 G 1.000** 47.266
180 T 1.000** 47.266
181 Q 1.000** 47.266
182 V 1.000** 47.266
183 N 1.000** 47.266
184 L 1.000** 47.266
185 E 1.000** 47.266
186 V 1.000** 47.266
187 D 1.000** 47.266
188 V 1.000** 47.266
189 I 1.000** 47.266
190 A 1.000** 47.266
191 K 1.000** 47.266
192 Y 1.000** 47.266
193 V 1.000** 47.266
194 E 1.000** 47.266
195 R 1.000** 47.266
196 L 1.000** 47.266
197 L 1.000** 47.266
198 Q 1.000** 47.266
199 S 1.000** 47.266
200 V 1.000** 47.266
201 P 1.000** 47.266
202 T 1.000** 47.266
203 G 1.000** 47.266
204 D 1.000** 47.266
205 L 1.000** 47.266
206 T 1.000** 47.266
207 R 1.000** 47.266
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907796_1_578_MLBR_RS02730)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -807.125175 Model 2: PositiveSelection -807.125108 Model 0: one-ratio -807.125201 Model 7: beta -807.125167 Model 8: beta&w>1 -807.125148 Model 0 vs 1 5.199999986871262E-5 Model 2 vs 1 1.3400000011642987E-4 Model 8 vs 7 3.80000001314329E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
