>C1
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C2
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C3
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C4
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C5
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C6
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=311
C1 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C2 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C3 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C4 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C5 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C6 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
**************************************************
C1 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C2 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C3 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C4 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C5 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C6 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
**************************************************
C1 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C2 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C3 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C4 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C5 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C6 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
**************************************************
C1 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C2 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C3 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C4 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C5 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C6 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
**************************************************
C1 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C2 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C3 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C4 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C5 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C6 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
**************************************************
C1 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C2 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C3 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C4 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C5 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C6 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
**************************************************
C1 PVDRPLPSTRD
C2 PVDRPLPSTRD
C3 PVDRPLPSTRD
C4 PVDRPLPSTRD
C5 PVDRPLPSTRD
C6 PVDRPLPSTRD
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 311 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 311 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9330]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9330]--->[9330]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.865 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C2 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C3 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C4 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C5 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
C6 VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
**************************************************
C1 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C2 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C3 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C4 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C5 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
C6 MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
**************************************************
C1 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C2 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C3 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C4 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C5 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
C6 AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
**************************************************
C1 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C2 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C3 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C4 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C5 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
C6 VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
**************************************************
C1 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C2 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C3 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C4 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C5 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
C6 YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
**************************************************
C1 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C2 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C3 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C4 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C5 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
C6 QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
**************************************************
C1 PVDRPLPSTRD
C2 PVDRPLPSTRD
C3 PVDRPLPSTRD
C4 PVDRPLPSTRD
C5 PVDRPLPSTRD
C6 PVDRPLPSTRD
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
C2 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
C3 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
C4 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
C5 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
C6 GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
**************************************************
C1 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
C2 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
C3 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
C4 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
C5 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
C6 TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
**************************************************
C1 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
C2 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
C3 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
C4 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
C5 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
C6 CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
**************************************************
C1 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
C2 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
C3 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
C4 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
C5 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
C6 ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
**************************************************
C1 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
C2 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
C3 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
C4 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
C5 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
C6 CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
**************************************************
C1 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
C2 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
C3 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
C4 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
C5 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
C6 TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
**************************************************
C1 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
C2 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
C3 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
C4 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
C5 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
C6 GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
**************************************************
C1 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
C2 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
C3 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
C4 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
C5 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
C6 CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
**************************************************
C1 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
C2 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
C3 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
C4 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
C5 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
C6 CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
**************************************************
C1 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
C2 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
C3 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
C4 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
C5 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
C6 GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
**************************************************
C1 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
C2 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
C3 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
C4 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
C5 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
C6 CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
**************************************************
C1 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
C2 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
C3 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
C4 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
C5 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
C6 CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
**************************************************
C1 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
C2 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
C3 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
C4 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
C5 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
C6 TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
**************************************************
C1 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
C2 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
C3 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
C4 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
C5 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
C6 GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
**************************************************
C1 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
C2 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
C3 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
C4 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
C5 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
C6 GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
**************************************************
C1 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
C2 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
C3 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
C4 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
C5 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
C6 CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
**************************************************
C1 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
C2 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
C3 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
C4 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
C5 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
C6 TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
**************************************************
C1 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
C2 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
C3 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
C4 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
C5 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
C6 GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
**************************************************
C1 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
C2 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
C3 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
C4 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
C5 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
C6 CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
*********************************
>C1
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C2
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C3
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C4
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C5
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C6
GTGTCGGACAGGTCAGGCAGACTAGTGATTACCGGTGCCGGTGGGCAGCT
TGGCAGCGCTCTAGCGGCGCAGGCCACCGCTGCGGGCCGGGACGTGCTAG
CGTTGACCTCGTCGCAATGGGATATTACCGATGCCGCGGTCGCCGAACGG
ATGGGGCGCAGCGCCCTCAAAAAAAATGATGTCGTGGTGAACTGTGCGGC
CTACACCAATGTAGACGGCGCCGAAAGCAACGAGTTGGCCGCGTATGCGG
TCAATGCTACCGGTCCGGAGTATATCGCGCGTGCCTGCCGGTGCGCCGGC
GCTGCCCTGATTCACGTCTCAACCGACTATGTGTTCAGTGGTGATTTCGG
CTCGGGCGCTAATAGGGTTGCTCCGCGTCCGTATGAGCCTACGGATGAAA
CTGGGCCGCTGGGGGTGTACGGACGCAGCAAACTTGCTGGTGAGCAGGCC
GTACTGGCAGCGATGCCCGAGGCCACCGTGGTCCGGACCGCCTGGGTCTA
CACCGGCGGGACCGGCAAGGATTTCGTCGCTGTCATGCGACGCTTGGCTG
CTGGGGACGGCCCGGTGTACGTGGTTGATGATCAGATCGGCTCGCCGACC
TATGTTGTCGATCTGGCTGCCGCACTGCTGCAGGTCGCCGACGGCAGTGT
GCATGGGTCCGTCCTACACGCCGCCAACGAGGGGGAGGTTTCACGATTCG
GCCAAGCCCGCGCCGTGTTCGAAGAATGCGGCGCTGACCCGCTGCAAGTG
CAACCCGTTAGCACCGCCCAAAACCCGCGTTCGGCGGCCCGGCCGGCCTA
TTCCGCGCTATCTGGTCGACAGTCCGTCGCGGCTGGCTTAACGCCGCTAA
GGCCCTGGCGCAGCGCACTTGTCGAGGCACTCGCGGTATCTCGCAGCCTC
CCGGTCGATCGACCGTTACCCTCTACGCGTGAC
>C1
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C2
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C3
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C4
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C5
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
>C6
VSDRSGRLVITGAGGQLGSALAAQATAAGRDVLALTSSQWDITDAAVAER
MGRSALKKNDVVVNCAAYTNVDGAESNELAAYAVNATGPEYIARACRCAG
AALIHVSTDYVFSGDFGSGANRVAPRPYEPTDETGPLGVYGRSKLAGEQA
VLAAMPEATVVRTAWVYTGGTGKDFVAVMRRLAAGDGPVYVVDDQIGSPT
YVVDLAAALLQVADGSVHGSVLHAANEGEVSRFGQARAVFEECGADPLQV
QPVSTAQNPRSAARPAYSALSGRQSVAAGLTPLRPWRSALVEALAVSRSL
PVDRPLPSTRD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 933 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789525
Setting output file names to "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 104649709
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0800999630
Seed = 10959021
Swapseed = 1579789525
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2088.098606 -- -24.965149
Chain 2 -- -2088.098606 -- -24.965149
Chain 3 -- -2088.098606 -- -24.965149
Chain 4 -- -2088.098606 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2088.098727 -- -24.965149
Chain 2 -- -2088.098727 -- -24.965149
Chain 3 -- -2088.098727 -- -24.965149
Chain 4 -- -2088.098727 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2088.099] (-2088.099) (-2088.099) (-2088.099) * [-2088.099] (-2088.099) (-2088.099) (-2088.099)
500 -- [-1270.457] (-1276.971) (-1288.742) (-1274.356) * (-1279.354) [-1264.139] (-1281.946) (-1302.083) -- 0:00:00
1000 -- (-1265.501) (-1271.754) (-1268.715) [-1257.696] * (-1278.843) (-1263.541) [-1266.634] (-1264.717) -- 0:00:00
1500 -- (-1267.784) [-1276.940] (-1273.301) (-1267.145) * (-1270.161) (-1260.808) (-1263.667) [-1261.493] -- 0:00:00
2000 -- (-1263.557) (-1265.202) [-1262.663] (-1264.674) * (-1265.053) (-1268.681) [-1269.062] (-1266.619) -- 0:00:00
2500 -- (-1266.778) [-1264.189] (-1260.651) (-1263.387) * (-1261.020) (-1271.486) (-1269.875) [-1261.413] -- 0:00:00
3000 -- (-1262.002) [-1267.657] (-1261.126) (-1268.080) * (-1266.723) (-1265.386) [-1263.628] (-1262.488) -- 0:00:00
3500 -- (-1266.102) (-1264.132) (-1270.843) [-1261.529] * (-1257.827) (-1284.326) (-1261.177) [-1262.245] -- 0:00:00
4000 -- [-1260.074] (-1266.069) (-1264.022) (-1261.492) * (-1262.438) (-1268.139) [-1263.720] (-1258.696) -- 0:00:00
4500 -- [-1263.545] (-1269.096) (-1272.050) (-1263.386) * [-1266.831] (-1260.616) (-1261.555) (-1258.357) -- 0:00:00
5000 -- (-1262.129) (-1263.049) [-1262.668] (-1274.055) * (-1268.243) (-1264.588) (-1264.961) [-1262.563] -- 0:00:00
Average standard deviation of split frequencies: 0.067344
5500 -- (-1264.419) [-1265.150] (-1262.617) (-1261.464) * (-1263.988) (-1264.411) (-1272.906) [-1262.627] -- 0:00:00
6000 -- (-1259.226) (-1265.907) [-1262.230] (-1273.127) * (-1266.377) (-1261.570) (-1265.210) [-1258.634] -- 0:00:00
6500 -- (-1265.742) (-1255.163) (-1263.529) [-1265.868] * (-1266.826) (-1259.394) (-1265.114) [-1259.155] -- 0:00:00
7000 -- (-1264.057) (-1254.976) (-1269.603) [-1258.078] * [-1262.976] (-1263.909) (-1264.357) (-1261.675) -- 0:00:00
7500 -- (-1268.465) [-1253.056] (-1261.276) (-1267.156) * (-1260.651) [-1260.529] (-1260.652) (-1258.169) -- 0:00:00
8000 -- (-1263.214) [-1254.231] (-1269.402) (-1264.694) * (-1262.404) (-1269.183) (-1265.781) [-1262.363] -- 0:00:00
8500 -- [-1260.219] (-1253.974) (-1262.653) (-1271.447) * [-1261.319] (-1270.123) (-1260.128) (-1261.609) -- 0:01:56
9000 -- [-1270.716] (-1253.950) (-1264.232) (-1272.440) * [-1258.318] (-1262.194) (-1263.997) (-1268.484) -- 0:01:50
9500 -- [-1272.704] (-1253.774) (-1262.046) (-1267.329) * [-1258.420] (-1279.561) (-1260.009) (-1271.005) -- 0:01:44
10000 -- (-1263.135) (-1253.407) (-1263.968) [-1265.039] * [-1256.164] (-1259.447) (-1268.391) (-1259.832) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-1265.431] (-1256.344) (-1263.697) (-1272.791) * (-1267.914) (-1258.376) (-1267.119) [-1261.364] -- 0:01:34
11000 -- (-1265.584) [-1253.929] (-1262.201) (-1263.771) * (-1266.948) (-1254.566) [-1263.426] (-1264.167) -- 0:01:29
11500 -- (-1264.749) [-1254.399] (-1261.421) (-1260.095) * (-1257.289) (-1255.362) [-1262.350] (-1263.927) -- 0:01:25
12000 -- (-1266.725) [-1254.296] (-1261.231) (-1263.179) * (-1269.308) (-1260.857) [-1262.308] (-1261.496) -- 0:01:22
12500 -- [-1268.924] (-1255.478) (-1265.410) (-1262.974) * (-1264.091) (-1255.094) [-1264.565] (-1266.315) -- 0:01:19
13000 -- (-1262.892) [-1253.058] (-1268.855) (-1261.289) * [-1262.712] (-1255.792) (-1257.914) (-1265.181) -- 0:01:15
13500 -- [-1257.673] (-1254.335) (-1272.268) (-1262.549) * (-1265.020) (-1259.310) (-1262.384) [-1269.323] -- 0:01:13
14000 -- (-1282.603) (-1253.837) (-1259.583) [-1261.229] * (-1266.608) (-1256.137) [-1264.761] (-1268.368) -- 0:01:10
14500 -- (-1268.026) (-1257.301) [-1253.977] (-1270.958) * (-1264.814) (-1256.573) [-1261.039] (-1263.359) -- 0:01:07
15000 -- (-1268.630) (-1252.787) [-1253.396] (-1263.253) * (-1261.722) [-1255.464] (-1266.460) (-1268.645) -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- (-1260.121) (-1254.876) (-1253.108) [-1259.526] * (-1265.066) [-1254.628] (-1269.045) (-1275.495) -- 0:01:03
16000 -- (-1258.816) (-1252.404) (-1253.084) [-1261.104] * (-1261.455) (-1253.948) [-1265.916] (-1259.920) -- 0:01:01
16500 -- (-1263.762) [-1253.745] (-1255.147) (-1268.695) * [-1258.339] (-1253.688) (-1265.330) (-1263.799) -- 0:00:59
17000 -- (-1261.116) (-1253.755) (-1259.047) [-1260.325] * (-1264.256) (-1256.134) (-1273.678) [-1258.755] -- 0:00:57
17500 -- (-1261.497) (-1256.166) (-1257.890) [-1258.539] * (-1261.650) (-1255.765) (-1270.318) [-1262.361] -- 0:00:56
18000 -- [-1259.443] (-1254.543) (-1254.308) (-1261.021) * (-1270.519) [-1256.044] (-1265.013) (-1262.846) -- 0:00:54
18500 -- (-1261.400) (-1252.845) (-1256.704) [-1259.319] * (-1265.130) (-1258.155) [-1261.049] (-1263.531) -- 0:00:53
19000 -- (-1259.220) [-1253.262] (-1255.540) (-1266.731) * (-1272.687) (-1256.126) [-1265.698] (-1261.040) -- 0:00:51
19500 -- [-1263.074] (-1253.643) (-1254.594) (-1258.585) * (-1266.875) (-1255.819) [-1257.218] (-1261.944) -- 0:00:50
20000 -- (-1262.607) [-1256.172] (-1254.543) (-1262.588) * (-1262.267) [-1257.324] (-1265.826) (-1259.451) -- 0:00:49
Average standard deviation of split frequencies: 0.071113
20500 -- (-1265.249) (-1258.021) [-1254.555] (-1262.190) * (-1266.598) [-1257.449] (-1261.780) (-1261.529) -- 0:00:47
21000 -- (-1266.131) (-1256.337) [-1254.545] (-1262.811) * (-1257.857) (-1256.417) [-1262.497] (-1264.903) -- 0:00:46
21500 -- (-1261.095) (-1259.739) (-1255.567) [-1263.228] * (-1263.883) (-1253.664) (-1273.843) [-1265.010] -- 0:00:45
22000 -- (-1274.578) (-1254.769) [-1254.141] (-1265.724) * (-1264.308) (-1256.558) [-1267.229] (-1267.687) -- 0:00:44
22500 -- (-1260.890) [-1256.970] (-1255.114) (-1264.615) * [-1258.672] (-1254.858) (-1275.267) (-1266.538) -- 0:00:43
23000 -- (-1257.554) (-1255.773) (-1254.003) [-1266.843] * (-1262.027) (-1255.262) [-1265.348] (-1275.410) -- 0:00:42
23500 -- (-1256.093) [-1254.570] (-1256.351) (-1265.796) * [-1267.904] (-1255.307) (-1263.515) (-1269.657) -- 0:00:41
24000 -- (-1258.733) (-1253.284) (-1254.241) [-1262.330] * [-1264.676] (-1257.819) (-1266.506) (-1275.061) -- 0:01:21
24500 -- (-1258.579) (-1252.683) (-1253.177) [-1263.773] * [-1262.435] (-1257.097) (-1262.650) (-1280.030) -- 0:01:19
25000 -- (-1256.281) (-1256.390) [-1252.807] (-1271.952) * (-1266.438) (-1258.411) [-1263.721] (-1253.534) -- 0:01:18
Average standard deviation of split frequencies: 0.055347
25500 -- (-1255.090) (-1256.047) (-1253.820) [-1259.542] * [-1260.665] (-1254.715) (-1266.478) (-1253.493) -- 0:01:16
26000 -- (-1257.177) (-1255.047) [-1253.298] (-1267.245) * (-1264.478) (-1254.943) [-1260.003] (-1254.259) -- 0:01:14
26500 -- (-1257.449) [-1254.145] (-1253.065) (-1269.322) * [-1260.996] (-1256.942) (-1269.125) (-1255.107) -- 0:01:13
27000 -- (-1253.952) (-1254.410) (-1254.519) [-1258.661] * (-1272.933) [-1254.280] (-1286.778) (-1256.136) -- 0:01:12
27500 -- (-1253.948) [-1253.076] (-1254.099) (-1259.575) * (-1260.649) (-1252.469) (-1263.060) [-1253.162] -- 0:01:10
28000 -- (-1256.191) (-1252.820) [-1257.077] (-1260.149) * (-1268.923) (-1256.193) (-1254.915) [-1253.093] -- 0:01:09
28500 -- (-1255.139) (-1255.270) (-1257.967) [-1267.114] * (-1264.930) [-1254.316] (-1255.357) (-1255.533) -- 0:01:08
29000 -- (-1254.411) (-1253.338) (-1259.798) [-1265.475] * (-1267.899) [-1253.768] (-1257.460) (-1254.315) -- 0:01:06
29500 -- [-1254.189] (-1253.338) (-1254.877) (-1261.282) * (-1262.917) [-1253.527] (-1253.529) (-1255.301) -- 0:01:05
30000 -- [-1258.214] (-1253.339) (-1255.849) (-1269.384) * (-1270.081) (-1254.764) (-1253.546) [-1254.847] -- 0:01:04
Average standard deviation of split frequencies: 0.040138
30500 -- [-1254.621] (-1253.424) (-1254.288) (-1263.740) * (-1270.620) (-1255.014) (-1252.640) [-1255.218] -- 0:01:03
31000 -- [-1254.792] (-1252.875) (-1255.117) (-1263.881) * (-1268.403) (-1255.220) [-1253.922] (-1256.501) -- 0:01:02
31500 -- [-1253.846] (-1253.678) (-1257.662) (-1266.394) * (-1262.220) (-1254.770) [-1254.449] (-1257.323) -- 0:01:01
32000 -- (-1256.642) [-1253.399] (-1257.894) (-1260.807) * (-1264.419) [-1254.336] (-1253.337) (-1260.344) -- 0:01:00
32500 -- (-1252.588) (-1253.857) (-1258.599) [-1266.457] * (-1266.779) (-1254.921) (-1253.337) [-1254.696] -- 0:00:59
33000 -- (-1253.118) (-1256.249) [-1254.410] (-1266.680) * [-1261.574] (-1256.092) (-1254.184) (-1253.193) -- 0:00:58
33500 -- (-1252.928) [-1254.287] (-1257.429) (-1270.122) * (-1266.434) [-1254.940] (-1256.612) (-1255.029) -- 0:00:57
34000 -- (-1252.795) [-1253.807] (-1254.415) (-1266.377) * (-1262.175) (-1253.175) [-1259.172] (-1254.539) -- 0:00:56
34500 -- [-1254.384] (-1253.993) (-1253.866) (-1265.857) * (-1267.286) [-1252.463] (-1254.439) (-1255.987) -- 0:00:55
35000 -- (-1255.347) [-1254.331] (-1253.977) (-1275.971) * (-1262.742) (-1252.908) (-1256.849) [-1254.503] -- 0:00:55
Average standard deviation of split frequencies: 0.033464
35500 -- (-1253.110) [-1254.331] (-1254.020) (-1270.444) * (-1266.257) (-1254.503) [-1253.165] (-1255.972) -- 0:00:54
36000 -- (-1254.136) [-1256.197] (-1256.044) (-1262.090) * (-1259.960) [-1252.859] (-1257.011) (-1256.558) -- 0:00:53
36500 -- (-1254.472) (-1255.071) [-1255.119] (-1274.266) * (-1261.539) [-1254.034] (-1252.945) (-1257.596) -- 0:00:52
37000 -- [-1256.419] (-1256.959) (-1254.144) (-1265.384) * (-1264.546) (-1252.637) (-1253.779) [-1258.367] -- 0:00:52
37500 -- (-1258.398) [-1255.043] (-1254.516) (-1271.594) * (-1271.832) (-1253.710) (-1254.693) [-1263.738] -- 0:00:51
38000 -- (-1255.931) (-1256.770) (-1255.896) [-1263.349] * (-1263.409) (-1254.314) [-1253.596] (-1259.085) -- 0:00:50
38500 -- (-1256.928) [-1253.324] (-1254.683) (-1257.269) * (-1262.824) [-1252.832] (-1254.196) (-1257.697) -- 0:00:49
39000 -- [-1254.561] (-1253.460) (-1257.224) (-1261.697) * [-1267.588] (-1254.816) (-1256.441) (-1253.912) -- 0:00:49
39500 -- [-1253.858] (-1253.615) (-1255.420) (-1265.813) * (-1274.577) (-1253.213) [-1253.201] (-1253.146) -- 0:00:48
40000 -- (-1252.962) (-1253.380) (-1257.045) [-1266.880] * (-1266.338) (-1255.744) [-1253.125] (-1253.219) -- 0:01:12
Average standard deviation of split frequencies: 0.023908
40500 -- (-1254.389) (-1254.398) [-1252.770] (-1259.882) * (-1264.744) (-1255.337) [-1254.728] (-1256.455) -- 0:01:11
41000 -- (-1254.471) (-1254.833) [-1253.532] (-1269.805) * (-1269.949) [-1257.492] (-1254.851) (-1253.339) -- 0:01:10
41500 -- (-1255.384) [-1253.384] (-1252.889) (-1263.983) * (-1269.313) (-1254.850) (-1254.972) [-1257.226] -- 0:01:09
42000 -- (-1256.312) [-1253.204] (-1253.421) (-1267.788) * [-1264.904] (-1255.273) (-1254.930) (-1254.427) -- 0:01:08
42500 -- [-1255.201] (-1252.734) (-1252.485) (-1262.883) * (-1263.897) [-1257.578] (-1253.941) (-1254.500) -- 0:01:07
43000 -- [-1256.176] (-1256.234) (-1253.506) (-1272.433) * (-1263.016) [-1255.343] (-1255.981) (-1254.747) -- 0:01:06
43500 -- (-1255.412) (-1256.112) (-1253.231) [-1262.640] * (-1269.483) (-1255.545) [-1258.159] (-1258.303) -- 0:01:05
44000 -- (-1254.032) (-1253.423) [-1253.231] (-1264.787) * (-1268.867) [-1253.228] (-1254.945) (-1255.757) -- 0:01:05
44500 -- (-1261.397) (-1255.547) [-1252.940] (-1271.252) * [-1261.704] (-1260.791) (-1254.575) (-1254.418) -- 0:01:04
45000 -- (-1258.956) (-1256.166) [-1252.806] (-1259.256) * [-1261.043] (-1257.751) (-1256.098) (-1257.299) -- 0:01:03
Average standard deviation of split frequencies: 0.021099
45500 -- (-1265.283) (-1254.733) (-1253.220) [-1260.079] * (-1265.178) (-1254.114) (-1254.553) [-1255.078] -- 0:01:02
46000 -- (-1256.897) (-1257.876) (-1255.268) [-1263.934] * (-1267.842) [-1253.727] (-1254.484) (-1254.335) -- 0:01:02
46500 -- [-1256.826] (-1257.135) (-1257.797) (-1263.590) * (-1262.270) [-1255.659] (-1254.960) (-1254.797) -- 0:01:01
47000 -- (-1256.244) (-1254.483) [-1255.139] (-1274.226) * (-1260.764) (-1256.436) [-1253.910] (-1254.601) -- 0:01:00
47500 -- (-1257.839) (-1255.521) [-1258.577] (-1262.501) * (-1263.334) (-1256.436) [-1255.723] (-1260.091) -- 0:01:00
48000 -- (-1258.456) (-1255.470) (-1254.434) [-1265.957] * (-1263.080) (-1262.239) (-1254.510) [-1255.047] -- 0:00:59
48500 -- (-1257.022) (-1261.534) (-1253.969) [-1267.257] * [-1262.926] (-1259.416) (-1253.666) (-1255.250) -- 0:00:58
49000 -- [-1254.167] (-1260.167) (-1254.361) (-1263.429) * [-1258.434] (-1259.951) (-1253.962) (-1253.781) -- 0:00:58
49500 -- [-1252.882] (-1254.786) (-1254.172) (-1265.097) * (-1265.622) (-1256.606) [-1255.131] (-1254.345) -- 0:00:57
50000 -- (-1252.864) (-1257.795) (-1254.916) [-1268.340] * (-1276.050) (-1257.140) [-1257.873] (-1254.187) -- 0:00:57
Average standard deviation of split frequencies: 0.026517
50500 -- [-1254.231] (-1254.599) (-1256.582) (-1266.606) * [-1265.277] (-1257.055) (-1256.019) (-1253.535) -- 0:00:56
51000 -- [-1252.898] (-1254.830) (-1254.471) (-1269.724) * [-1264.846] (-1253.076) (-1255.991) (-1254.026) -- 0:00:55
51500 -- (-1253.403) (-1253.584) (-1253.398) [-1261.851] * (-1268.033) [-1253.546] (-1258.148) (-1254.759) -- 0:00:55
52000 -- (-1255.535) (-1253.651) (-1256.696) [-1256.828] * (-1262.479) [-1255.555] (-1254.199) (-1255.721) -- 0:00:54
52500 -- (-1254.343) (-1256.856) (-1256.194) [-1261.037] * [-1265.481] (-1257.146) (-1256.765) (-1253.857) -- 0:00:54
53000 -- (-1253.490) [-1254.827] (-1254.042) (-1268.993) * (-1255.190) (-1254.370) (-1257.476) [-1255.363] -- 0:00:53
53500 -- (-1256.037) (-1256.064) (-1253.638) [-1265.566] * (-1258.343) [-1252.910] (-1255.043) (-1253.634) -- 0:00:53
54000 -- (-1257.022) (-1256.184) [-1253.546] (-1267.126) * (-1254.186) [-1253.402] (-1253.904) (-1255.526) -- 0:00:52
54500 -- (-1253.816) (-1254.946) (-1254.632) [-1262.276] * [-1254.143] (-1254.152) (-1253.193) (-1253.640) -- 0:00:52
55000 -- (-1253.638) (-1254.296) (-1256.565) [-1257.887] * (-1255.680) (-1257.252) (-1256.330) [-1253.760] -- 0:00:51
Average standard deviation of split frequencies: 0.020797
55500 -- [-1253.951] (-1254.356) (-1256.778) (-1262.280) * (-1254.387) (-1253.356) (-1258.439) [-1253.743] -- 0:00:51
56000 -- (-1255.521) (-1256.148) [-1252.787] (-1264.684) * (-1260.747) [-1257.706] (-1255.158) (-1253.955) -- 0:01:07
56500 -- [-1253.811] (-1255.566) (-1254.140) (-1263.740) * (-1255.136) [-1253.497] (-1252.813) (-1255.245) -- 0:01:06
57000 -- (-1256.368) (-1255.409) (-1258.737) [-1262.960] * (-1253.762) (-1253.643) [-1254.434] (-1253.115) -- 0:01:06
57500 -- [-1254.891] (-1254.561) (-1253.455) (-1264.947) * (-1252.800) (-1252.447) (-1254.701) [-1254.074] -- 0:01:05
58000 -- (-1254.629) [-1254.056] (-1253.811) (-1259.647) * (-1253.185) (-1252.409) [-1253.712] (-1253.547) -- 0:01:04
58500 -- [-1253.978] (-1254.943) (-1256.982) (-1264.517) * (-1255.704) [-1254.286] (-1257.094) (-1253.591) -- 0:01:04
59000 -- (-1254.478) [-1255.945] (-1255.431) (-1262.367) * (-1255.771) (-1256.921) [-1253.058] (-1259.151) -- 0:01:03
59500 -- [-1253.571] (-1254.746) (-1255.949) (-1261.972) * (-1254.446) (-1258.006) (-1254.435) [-1253.439] -- 0:01:03
60000 -- (-1253.946) [-1254.068] (-1255.451) (-1264.023) * [-1253.893] (-1258.917) (-1253.327) (-1255.849) -- 0:01:02
Average standard deviation of split frequencies: 0.016998
60500 -- [-1254.780] (-1255.493) (-1254.733) (-1262.074) * [-1254.493] (-1257.208) (-1257.314) (-1261.710) -- 0:01:02
61000 -- [-1253.318] (-1257.386) (-1254.290) (-1258.666) * (-1255.461) (-1259.843) (-1260.832) [-1260.055] -- 0:01:01
61500 -- (-1254.366) (-1256.390) [-1254.026] (-1260.207) * (-1255.961) (-1254.845) [-1253.780] (-1262.393) -- 0:01:01
62000 -- (-1254.694) [-1255.960] (-1254.015) (-1270.061) * (-1258.750) (-1258.311) [-1257.696] (-1260.849) -- 0:01:00
62500 -- (-1255.462) [-1254.593] (-1253.533) (-1267.311) * (-1256.761) [-1256.131] (-1256.898) (-1262.190) -- 0:01:00
63000 -- (-1255.865) [-1254.421] (-1256.783) (-1271.218) * (-1258.700) [-1253.024] (-1254.343) (-1256.607) -- 0:00:59
63500 -- (-1256.317) [-1255.704] (-1254.404) (-1266.874) * (-1254.880) [-1254.460] (-1256.201) (-1256.882) -- 0:00:58
64000 -- (-1255.591) [-1254.787] (-1259.637) (-1263.671) * (-1256.324) [-1256.284] (-1256.138) (-1255.393) -- 0:00:58
64500 -- (-1255.468) (-1254.946) [-1253.706] (-1260.470) * (-1259.204) (-1254.987) (-1257.823) [-1253.821] -- 0:00:58
65000 -- (-1257.150) (-1256.742) [-1253.816] (-1272.860) * (-1253.520) (-1258.035) (-1256.918) [-1255.277] -- 0:00:57
Average standard deviation of split frequencies: 0.017063
65500 -- [-1257.019] (-1252.921) (-1253.936) (-1262.168) * (-1253.340) (-1254.006) [-1252.637] (-1253.948) -- 0:00:57
66000 -- (-1252.736) (-1253.667) [-1253.932] (-1264.987) * (-1255.955) (-1256.871) [-1255.058] (-1252.423) -- 0:00:56
66500 -- (-1252.936) (-1255.661) [-1253.247] (-1263.112) * (-1254.805) [-1253.739] (-1254.244) (-1254.676) -- 0:00:56
67000 -- (-1253.346) [-1254.607] (-1255.163) (-1263.317) * (-1255.012) [-1254.340] (-1254.576) (-1254.999) -- 0:00:55
67500 -- (-1253.108) (-1255.869) (-1253.368) [-1260.202] * (-1254.806) (-1255.059) [-1257.721] (-1254.222) -- 0:00:55
68000 -- [-1254.008] (-1254.557) (-1255.045) (-1265.515) * (-1254.095) (-1252.940) (-1252.692) [-1256.621] -- 0:00:54
68500 -- (-1254.240) [-1255.396] (-1254.195) (-1271.462) * (-1253.845) (-1253.164) [-1253.931] (-1258.834) -- 0:00:54
69000 -- (-1257.186) (-1252.968) [-1256.225] (-1262.587) * (-1253.634) (-1254.414) [-1252.863] (-1253.935) -- 0:00:53
69500 -- (-1258.597) (-1254.114) (-1255.154) [-1265.766] * [-1253.811] (-1254.971) (-1256.047) (-1255.021) -- 0:00:53
70000 -- (-1258.442) (-1254.157) (-1255.835) [-1260.309] * (-1254.895) (-1255.229) (-1255.882) [-1255.277] -- 0:00:53
Average standard deviation of split frequencies: 0.019345
70500 -- [-1255.154] (-1253.247) (-1253.520) (-1262.844) * (-1253.806) (-1261.392) [-1255.468] (-1256.696) -- 0:00:52
71000 -- [-1256.362] (-1252.487) (-1253.650) (-1261.621) * (-1256.683) [-1257.028] (-1257.940) (-1255.156) -- 0:00:52
71500 -- (-1254.012) (-1252.491) (-1254.581) [-1262.821] * (-1253.463) (-1257.671) (-1255.661) [-1255.150] -- 0:00:51
72000 -- (-1253.201) (-1255.441) [-1253.581] (-1264.847) * (-1253.463) (-1258.675) (-1257.734) [-1253.763] -- 0:01:04
72500 -- [-1253.982] (-1256.393) (-1254.584) (-1267.085) * (-1253.933) (-1261.654) (-1258.268) [-1253.032] -- 0:01:03
73000 -- [-1253.944] (-1255.692) (-1256.745) (-1258.744) * (-1254.061) (-1256.502) (-1258.591) [-1252.913] -- 0:01:03
73500 -- [-1254.511] (-1256.834) (-1254.362) (-1263.565) * [-1256.321] (-1255.045) (-1255.604) (-1254.074) -- 0:01:03
74000 -- [-1255.854] (-1253.912) (-1253.736) (-1266.754) * (-1252.532) (-1254.317) (-1256.071) [-1253.319] -- 0:01:02
74500 -- [-1256.759] (-1253.895) (-1254.421) (-1262.295) * (-1253.260) (-1254.258) (-1256.034) [-1257.080] -- 0:01:02
75000 -- [-1254.696] (-1253.759) (-1255.949) (-1270.781) * (-1253.304) [-1252.484] (-1259.375) (-1254.036) -- 0:01:01
Average standard deviation of split frequencies: 0.019297
75500 -- (-1256.194) [-1253.525] (-1254.938) (-1259.551) * (-1253.608) [-1252.573] (-1256.903) (-1255.897) -- 0:01:01
76000 -- (-1254.665) (-1253.609) (-1253.985) [-1259.125] * [-1254.759] (-1255.733) (-1260.259) (-1256.944) -- 0:01:00
76500 -- [-1254.272] (-1254.017) (-1254.608) (-1260.236) * (-1254.366) (-1252.695) (-1253.728) [-1254.068] -- 0:01:00
77000 -- (-1254.543) (-1253.756) [-1253.820] (-1263.454) * (-1254.742) [-1253.228] (-1253.315) (-1255.774) -- 0:00:59
77500 -- (-1255.193) (-1256.805) [-1253.545] (-1266.254) * (-1255.926) (-1253.710) [-1253.328] (-1255.503) -- 0:00:59
78000 -- (-1256.653) (-1254.617) (-1256.256) [-1263.824] * (-1255.487) (-1253.935) [-1252.871] (-1253.325) -- 0:00:59
78500 -- (-1257.334) (-1255.799) [-1256.221] (-1267.821) * [-1253.592] (-1259.579) (-1254.338) (-1252.686) -- 0:00:58
79000 -- (-1256.081) (-1254.572) (-1256.081) [-1262.124] * (-1253.435) (-1261.254) [-1253.646] (-1253.414) -- 0:00:58
79500 -- (-1255.083) [-1254.961] (-1255.145) (-1264.536) * [-1253.357] (-1259.042) (-1254.321) (-1256.738) -- 0:00:57
80000 -- (-1255.085) (-1256.016) [-1258.079] (-1264.887) * (-1253.360) [-1254.955] (-1258.823) (-1253.596) -- 0:00:57
Average standard deviation of split frequencies: 0.019594
80500 -- (-1256.163) (-1255.804) [-1257.532] (-1263.817) * (-1254.411) [-1255.248] (-1256.644) (-1253.509) -- 0:00:57
81000 -- (-1257.018) (-1255.200) [-1258.978] (-1260.183) * (-1253.554) [-1253.068] (-1255.318) (-1261.464) -- 0:00:56
81500 -- (-1257.498) (-1256.880) [-1253.168] (-1263.292) * (-1252.822) [-1255.311] (-1255.885) (-1258.924) -- 0:00:56
82000 -- (-1254.492) [-1257.189] (-1254.945) (-1261.719) * [-1252.895] (-1256.268) (-1257.172) (-1256.439) -- 0:00:55
82500 -- (-1254.509) (-1255.206) (-1256.342) [-1258.664] * (-1254.357) (-1261.105) [-1255.743] (-1259.332) -- 0:00:55
83000 -- (-1255.717) (-1253.102) (-1256.193) [-1274.250] * [-1254.305] (-1256.309) (-1254.539) (-1260.155) -- 0:00:55
83500 -- (-1253.203) (-1256.531) (-1256.258) [-1261.531] * [-1253.935] (-1252.998) (-1256.338) (-1255.066) -- 0:00:54
84000 -- (-1252.752) [-1254.978] (-1255.927) (-1259.630) * (-1253.044) (-1254.176) (-1255.137) [-1253.763] -- 0:00:54
84500 -- (-1253.424) [-1253.725] (-1254.627) (-1267.511) * (-1255.611) [-1258.494] (-1255.844) (-1253.074) -- 0:00:54
85000 -- [-1253.578] (-1255.162) (-1253.857) (-1268.868) * (-1253.071) [-1257.344] (-1257.187) (-1254.534) -- 0:00:53
Average standard deviation of split frequencies: 0.022200
85500 -- (-1255.640) [-1254.379] (-1253.287) (-1270.023) * [-1253.549] (-1254.062) (-1252.995) (-1255.546) -- 0:00:53
86000 -- (-1255.235) (-1253.269) [-1253.444] (-1269.526) * (-1254.204) (-1255.770) [-1255.566] (-1259.076) -- 0:00:53
86500 -- (-1255.192) (-1252.955) (-1254.071) [-1257.489] * [-1253.081] (-1257.022) (-1254.828) (-1254.769) -- 0:00:52
87000 -- (-1253.796) [-1253.067] (-1254.889) (-1257.100) * (-1254.685) (-1255.911) (-1257.904) [-1258.001] -- 0:00:52
87500 -- (-1261.648) [-1256.964] (-1255.027) (-1257.751) * (-1253.815) (-1257.565) (-1254.793) [-1255.267] -- 0:00:52
88000 -- (-1255.343) [-1258.296] (-1253.817) (-1256.927) * (-1255.186) (-1258.699) [-1253.806] (-1254.275) -- 0:01:02
88500 -- (-1257.853) [-1253.935] (-1254.741) (-1253.694) * (-1256.208) [-1256.465] (-1254.226) (-1256.946) -- 0:01:01
89000 -- (-1254.432) [-1255.497] (-1255.002) (-1254.143) * [-1253.038] (-1255.487) (-1254.609) (-1253.874) -- 0:01:01
89500 -- [-1253.433] (-1254.223) (-1254.264) (-1257.973) * (-1255.182) [-1258.547] (-1256.090) (-1253.548) -- 0:01:01
90000 -- (-1254.277) (-1253.661) (-1256.663) [-1255.062] * [-1253.043] (-1256.670) (-1257.765) (-1253.670) -- 0:01:00
Average standard deviation of split frequencies: 0.016145
90500 -- [-1257.441] (-1252.934) (-1255.451) (-1254.747) * (-1253.350) [-1254.970] (-1254.468) (-1252.905) -- 0:01:00
91000 -- (-1255.199) [-1252.932] (-1255.031) (-1258.832) * (-1257.233) [-1254.771] (-1253.251) (-1252.870) -- 0:00:59
91500 -- [-1257.218] (-1253.373) (-1255.103) (-1255.127) * [-1254.699] (-1253.366) (-1254.668) (-1252.595) -- 0:00:59
92000 -- [-1256.280] (-1253.000) (-1254.439) (-1254.105) * (-1256.446) (-1253.098) [-1254.668] (-1255.400) -- 0:00:59
92500 -- [-1258.829] (-1253.868) (-1257.137) (-1253.801) * [-1254.499] (-1253.998) (-1255.820) (-1255.400) -- 0:00:58
93000 -- [-1256.911] (-1253.850) (-1254.425) (-1257.373) * (-1254.616) (-1255.329) (-1255.228) [-1254.723] -- 0:00:58
93500 -- (-1254.364) (-1254.399) (-1256.386) [-1254.739] * (-1254.524) (-1253.933) [-1259.968] (-1252.708) -- 0:00:58
94000 -- [-1253.591] (-1258.081) (-1254.331) (-1253.440) * (-1255.225) [-1253.215] (-1253.417) (-1252.915) -- 0:00:57
94500 -- (-1258.304) (-1261.977) [-1258.660] (-1255.224) * (-1254.709) (-1252.458) (-1253.764) [-1255.050] -- 0:00:57
95000 -- (-1256.214) [-1255.889] (-1256.734) (-1254.625) * (-1254.208) (-1252.666) [-1255.945] (-1254.484) -- 0:00:57
Average standard deviation of split frequencies: 0.017833
95500 -- (-1253.341) [-1254.202] (-1255.126) (-1256.499) * (-1252.631) [-1254.548] (-1255.309) (-1254.773) -- 0:00:56
96000 -- [-1254.635] (-1255.019) (-1254.677) (-1255.744) * [-1252.630] (-1253.163) (-1255.099) (-1255.072) -- 0:00:56
96500 -- (-1254.095) (-1253.698) [-1254.824] (-1254.405) * (-1253.272) (-1254.055) (-1254.335) [-1254.753] -- 0:00:56
97000 -- (-1254.071) [-1252.606] (-1257.057) (-1255.865) * [-1254.159] (-1253.161) (-1253.411) (-1254.153) -- 0:00:55
97500 -- (-1257.264) (-1253.178) (-1255.686) [-1254.295] * [-1255.503] (-1254.487) (-1253.996) (-1253.673) -- 0:00:55
98000 -- [-1256.829] (-1254.659) (-1254.845) (-1255.156) * (-1254.115) (-1252.643) [-1254.715] (-1254.615) -- 0:00:55
98500 -- (-1253.616) (-1253.705) [-1254.637] (-1253.783) * (-1253.320) (-1253.425) [-1254.566] (-1258.132) -- 0:00:54
99000 -- [-1254.283] (-1254.052) (-1254.652) (-1254.341) * (-1252.713) (-1254.820) [-1252.448] (-1255.252) -- 0:00:54
99500 -- (-1254.199) (-1254.554) (-1255.096) [-1254.566] * (-1256.663) [-1253.419] (-1254.145) (-1256.780) -- 0:00:54
100000 -- (-1253.585) (-1254.280) [-1254.441] (-1253.716) * (-1257.244) (-1254.080) [-1256.275] (-1254.751) -- 0:00:54
Average standard deviation of split frequencies: 0.015512
100500 -- (-1255.904) (-1253.449) [-1252.824] (-1253.590) * [-1254.532] (-1253.252) (-1258.706) (-1254.729) -- 0:00:53
101000 -- (-1257.524) (-1257.492) [-1252.655] (-1254.728) * (-1254.233) (-1253.251) (-1253.877) [-1255.184] -- 0:00:53
101500 -- (-1254.688) [-1255.641] (-1256.651) (-1254.319) * (-1256.632) (-1256.319) [-1255.763] (-1253.299) -- 0:00:53
102000 -- [-1254.232] (-1257.317) (-1253.811) (-1255.371) * (-1255.512) (-1255.250) [-1253.257] (-1253.713) -- 0:00:52
102500 -- [-1254.656] (-1254.164) (-1254.412) (-1252.893) * (-1255.273) (-1255.316) (-1253.268) [-1253.870] -- 0:00:52
103000 -- (-1257.923) (-1252.374) (-1254.720) [-1254.860] * (-1254.672) [-1260.710] (-1253.377) (-1255.269) -- 0:00:52
103500 -- (-1258.063) (-1252.684) [-1252.342] (-1255.093) * (-1254.928) (-1257.160) [-1252.980] (-1253.563) -- 0:00:51
104000 -- (-1254.860) (-1253.104) [-1254.618] (-1258.811) * (-1253.874) (-1259.257) [-1254.866] (-1262.417) -- 0:01:00
104500 -- (-1257.073) [-1253.075] (-1252.541) (-1259.376) * (-1254.774) [-1259.746] (-1257.156) (-1258.082) -- 0:00:59
105000 -- (-1254.886) [-1254.717] (-1252.781) (-1260.047) * (-1255.134) (-1257.486) [-1255.563] (-1256.668) -- 0:00:59
Average standard deviation of split frequencies: 0.018725
105500 -- [-1255.086] (-1255.920) (-1255.206) (-1254.627) * [-1253.675] (-1258.657) (-1254.786) (-1252.986) -- 0:00:59
106000 -- (-1253.822) (-1254.034) (-1255.980) [-1256.167] * [-1253.595] (-1254.433) (-1254.986) (-1252.987) -- 0:00:59
106500 -- [-1254.622] (-1252.757) (-1261.857) (-1257.965) * (-1253.062) (-1256.404) (-1254.284) [-1255.494] -- 0:00:58
107000 -- (-1255.001) (-1252.861) (-1257.886) [-1253.857] * (-1255.164) (-1257.121) [-1256.248] (-1254.784) -- 0:00:58
107500 -- (-1255.478) [-1254.556] (-1254.718) (-1254.439) * (-1258.199) (-1255.030) (-1257.145) [-1254.716] -- 0:00:58
108000 -- [-1253.266] (-1256.071) (-1255.874) (-1253.803) * (-1256.073) [-1252.603] (-1255.878) (-1257.143) -- 0:00:57
108500 -- [-1254.259] (-1257.937) (-1259.716) (-1254.072) * (-1254.558) (-1252.379) (-1255.810) [-1254.775] -- 0:00:57
109000 -- [-1254.476] (-1256.293) (-1253.325) (-1252.751) * (-1256.239) (-1254.227) (-1252.581) [-1253.908] -- 0:00:57
109500 -- (-1255.140) [-1256.937] (-1254.316) (-1254.307) * [-1259.360] (-1252.588) (-1255.343) (-1252.896) -- 0:00:56
110000 -- [-1255.307] (-1254.826) (-1252.660) (-1257.341) * [-1259.268] (-1255.549) (-1255.904) (-1253.327) -- 0:00:56
Average standard deviation of split frequencies: 0.019169
110500 -- (-1255.754) (-1255.973) [-1253.106] (-1256.303) * [-1252.908] (-1254.908) (-1253.193) (-1254.386) -- 0:00:56
111000 -- (-1259.277) [-1255.728] (-1254.402) (-1258.875) * (-1254.656) (-1253.565) [-1253.865] (-1253.763) -- 0:00:56
111500 -- (-1252.817) (-1256.541) (-1253.843) [-1256.901] * [-1254.224] (-1253.152) (-1252.671) (-1252.872) -- 0:00:55
112000 -- (-1252.501) (-1254.063) (-1257.523) [-1253.050] * (-1255.610) (-1252.887) [-1257.391] (-1254.106) -- 0:00:55
112500 -- (-1252.409) [-1252.748] (-1254.634) (-1253.088) * (-1255.904) (-1254.396) [-1255.260] (-1255.000) -- 0:00:55
113000 -- [-1255.183] (-1253.976) (-1255.559) (-1253.275) * (-1254.685) (-1254.248) (-1262.593) [-1254.321] -- 0:00:54
113500 -- (-1255.474) (-1256.220) (-1254.382) [-1254.041] * [-1254.464] (-1255.183) (-1258.350) (-1254.399) -- 0:00:54
114000 -- [-1255.137] (-1254.434) (-1254.801) (-1255.040) * (-1256.977) (-1253.905) (-1253.839) [-1257.291] -- 0:00:54
114500 -- (-1254.213) (-1255.951) [-1253.110] (-1254.395) * (-1255.440) [-1252.598] (-1253.326) (-1256.035) -- 0:00:54
115000 -- (-1254.694) (-1255.627) (-1252.993) [-1253.795] * (-1255.066) [-1254.273] (-1253.081) (-1255.926) -- 0:00:53
Average standard deviation of split frequencies: 0.017451
115500 -- (-1252.770) [-1255.164] (-1254.128) (-1255.677) * (-1255.234) [-1255.183] (-1253.173) (-1254.356) -- 0:00:53
116000 -- (-1253.974) (-1255.138) (-1252.633) [-1257.784] * (-1254.571) (-1253.684) (-1254.692) [-1254.989] -- 0:00:53
116500 -- [-1256.627] (-1257.444) (-1253.254) (-1259.219) * (-1254.744) [-1252.684] (-1255.278) (-1255.293) -- 0:00:53
117000 -- [-1256.994] (-1260.906) (-1254.486) (-1254.854) * (-1254.650) (-1259.548) [-1254.779] (-1253.678) -- 0:00:52
117500 -- [-1253.678] (-1256.346) (-1254.141) (-1254.817) * (-1259.808) (-1259.259) [-1256.645] (-1254.167) -- 0:00:52
118000 -- (-1256.847) (-1255.207) (-1254.772) [-1255.832] * (-1257.440) [-1256.245] (-1252.633) (-1254.168) -- 0:00:52
118500 -- (-1255.617) (-1254.834) (-1254.052) [-1254.917] * (-1256.148) [-1254.974] (-1254.190) (-1253.042) -- 0:00:52
119000 -- (-1258.286) (-1253.222) (-1253.974) [-1255.517] * (-1253.926) (-1255.337) [-1252.538] (-1255.595) -- 0:00:51
119500 -- [-1254.900] (-1254.853) (-1254.089) (-1253.421) * (-1254.188) (-1254.990) (-1253.727) [-1254.797] -- 0:00:58
120000 -- (-1255.633) (-1253.467) [-1253.639] (-1252.319) * (-1252.936) (-1253.385) [-1254.185] (-1255.417) -- 0:00:58
Average standard deviation of split frequencies: 0.015856
120500 -- [-1254.292] (-1255.838) (-1253.450) (-1253.732) * (-1252.936) (-1255.685) [-1252.771] (-1254.895) -- 0:00:58
121000 -- (-1253.284) (-1253.065) [-1254.987] (-1253.818) * (-1253.486) [-1256.136] (-1253.636) (-1253.734) -- 0:00:58
121500 -- (-1253.959) (-1253.121) (-1252.736) [-1257.009] * (-1253.867) (-1253.686) [-1253.326] (-1255.484) -- 0:00:57
122000 -- [-1254.720] (-1255.826) (-1255.088) (-1254.132) * [-1255.086] (-1254.044) (-1253.334) (-1255.302) -- 0:00:57
122500 -- (-1254.799) (-1255.166) (-1254.442) [-1253.550] * [-1254.053] (-1253.506) (-1252.823) (-1253.439) -- 0:00:57
123000 -- (-1255.801) (-1256.394) (-1254.987) [-1253.783] * (-1256.876) (-1255.379) (-1253.555) [-1252.969] -- 0:00:57
123500 -- [-1256.295] (-1255.659) (-1252.801) (-1253.920) * (-1255.975) (-1253.155) (-1254.515) [-1254.069] -- 0:00:56
124000 -- [-1255.190] (-1257.875) (-1254.010) (-1260.625) * [-1254.640] (-1255.566) (-1252.810) (-1257.191) -- 0:00:56
124500 -- (-1254.122) (-1253.963) (-1253.774) [-1252.933] * [-1254.225] (-1256.053) (-1254.100) (-1254.867) -- 0:00:56
125000 -- (-1252.705) (-1253.377) (-1258.029) [-1253.283] * [-1255.035] (-1256.244) (-1253.845) (-1255.062) -- 0:00:56
Average standard deviation of split frequencies: 0.016506
125500 -- [-1256.508] (-1252.729) (-1256.817) (-1252.718) * [-1252.276] (-1256.253) (-1257.198) (-1253.457) -- 0:00:55
126000 -- (-1254.097) (-1254.865) (-1256.664) [-1255.347] * [-1252.824] (-1256.888) (-1254.956) (-1256.487) -- 0:00:55
126500 -- (-1255.308) [-1252.791] (-1254.971) (-1252.723) * [-1252.874] (-1254.664) (-1254.340) (-1253.438) -- 0:00:55
127000 -- (-1253.277) (-1255.195) [-1254.121] (-1255.077) * (-1254.442) (-1257.992) [-1252.925] (-1254.858) -- 0:00:54
127500 -- (-1253.579) [-1254.260] (-1254.630) (-1257.207) * [-1257.679] (-1253.316) (-1254.530) (-1255.087) -- 0:00:54
128000 -- [-1254.398] (-1253.480) (-1256.645) (-1258.000) * (-1256.670) (-1261.001) (-1254.364) [-1254.319] -- 0:00:54
128500 -- [-1253.249] (-1255.462) (-1255.401) (-1254.701) * (-1259.241) [-1255.814] (-1254.533) (-1256.596) -- 0:00:54
129000 -- (-1253.660) (-1254.299) [-1254.926] (-1254.021) * (-1258.729) (-1255.250) (-1253.996) [-1255.247] -- 0:00:54
129500 -- (-1253.376) (-1254.894) [-1256.103] (-1253.404) * (-1257.071) [-1254.876] (-1254.712) (-1255.664) -- 0:00:53
130000 -- (-1253.798) (-1254.789) (-1256.497) [-1253.585] * (-1259.034) (-1254.950) (-1255.375) [-1253.522] -- 0:00:53
Average standard deviation of split frequencies: 0.015280
130500 -- (-1252.639) (-1254.927) [-1255.587] (-1253.530) * (-1254.331) [-1255.151] (-1253.527) (-1254.343) -- 0:00:53
131000 -- [-1252.638] (-1255.655) (-1254.765) (-1253.621) * (-1254.301) [-1254.626] (-1254.811) (-1254.645) -- 0:00:53
131500 -- (-1252.681) [-1254.059] (-1252.862) (-1253.777) * (-1255.092) (-1254.085) [-1256.115] (-1257.411) -- 0:00:52
132000 -- [-1253.980] (-1253.737) (-1253.007) (-1253.780) * (-1254.444) [-1253.310] (-1254.591) (-1256.650) -- 0:00:52
132500 -- (-1255.954) [-1254.169] (-1253.449) (-1258.141) * (-1252.797) (-1257.783) (-1255.179) [-1254.130] -- 0:00:52
133000 -- [-1255.236] (-1254.965) (-1253.226) (-1253.678) * [-1252.256] (-1253.201) (-1253.976) (-1255.036) -- 0:00:52
133500 -- (-1254.047) (-1257.003) (-1253.608) [-1254.009] * (-1252.798) (-1259.733) (-1253.985) [-1256.377] -- 0:00:51
134000 -- (-1256.130) (-1257.196) [-1259.570] (-1253.389) * (-1253.058) (-1258.801) [-1253.144] (-1253.373) -- 0:00:51
134500 -- [-1255.410] (-1255.607) (-1257.950) (-1253.374) * (-1253.205) (-1256.904) [-1253.699] (-1256.002) -- 0:00:51
135000 -- (-1255.451) (-1258.015) (-1257.692) [-1252.523] * (-1254.016) (-1254.660) (-1253.622) [-1253.916] -- 0:00:51
Average standard deviation of split frequencies: 0.015904
135500 -- (-1255.644) [-1253.583] (-1256.094) (-1256.554) * (-1255.967) (-1256.091) (-1254.412) [-1253.982] -- 0:00:57
136000 -- (-1255.393) (-1254.616) (-1257.554) [-1252.843] * (-1254.754) (-1257.067) [-1253.516] (-1254.870) -- 0:00:57
136500 -- (-1257.351) (-1253.954) (-1253.361) [-1256.924] * [-1254.316] (-1255.776) (-1253.461) (-1253.446) -- 0:00:56
137000 -- (-1261.966) (-1253.094) [-1255.615] (-1253.956) * [-1254.243] (-1255.811) (-1253.795) (-1258.713) -- 0:00:56
137500 -- [-1257.041] (-1261.165) (-1253.059) (-1254.336) * (-1252.626) (-1254.668) [-1252.556] (-1257.159) -- 0:00:56
138000 -- [-1255.393] (-1257.259) (-1254.674) (-1254.337) * (-1253.128) (-1254.653) [-1253.281] (-1254.818) -- 0:00:56
138500 -- (-1258.882) (-1258.364) [-1257.216] (-1254.416) * (-1253.458) [-1255.098] (-1252.646) (-1257.795) -- 0:00:55
139000 -- [-1257.640] (-1265.314) (-1254.794) (-1256.867) * [-1255.136] (-1254.438) (-1253.564) (-1263.095) -- 0:00:55
139500 -- (-1259.314) (-1255.487) (-1254.349) [-1255.784] * (-1252.718) (-1255.416) (-1254.050) [-1257.015] -- 0:00:55
140000 -- [-1255.106] (-1255.018) (-1256.277) (-1255.785) * (-1253.461) [-1253.531] (-1256.123) (-1254.079) -- 0:00:55
Average standard deviation of split frequencies: 0.014982
140500 -- [-1254.811] (-1255.929) (-1255.543) (-1256.101) * (-1253.493) (-1252.503) [-1255.192] (-1254.173) -- 0:00:55
141000 -- (-1253.668) (-1260.293) (-1255.782) [-1254.626] * [-1252.772] (-1253.185) (-1253.776) (-1253.643) -- 0:00:54
141500 -- [-1259.408] (-1255.185) (-1256.527) (-1254.538) * (-1254.025) [-1254.532] (-1255.459) (-1253.451) -- 0:00:54
142000 -- (-1253.033) [-1253.008] (-1252.966) (-1254.829) * (-1253.951) (-1255.056) [-1254.394] (-1255.399) -- 0:00:54
142500 -- (-1254.243) (-1253.366) [-1252.958] (-1254.656) * (-1254.238) (-1254.868) [-1252.890] (-1252.244) -- 0:00:54
143000 -- (-1254.206) (-1253.001) [-1254.234] (-1256.826) * [-1254.470] (-1254.953) (-1256.474) (-1252.567) -- 0:00:53
143500 -- [-1253.741] (-1260.775) (-1254.572) (-1256.428) * [-1253.078] (-1253.719) (-1254.928) (-1253.327) -- 0:00:53
144000 -- (-1255.053) (-1259.922) (-1253.449) [-1255.402] * (-1256.109) (-1253.745) [-1252.455] (-1253.610) -- 0:00:53
144500 -- [-1252.647] (-1253.472) (-1254.105) (-1256.528) * [-1256.838] (-1255.406) (-1252.457) (-1253.304) -- 0:00:53
145000 -- [-1253.532] (-1253.252) (-1253.115) (-1256.527) * (-1258.536) (-1255.750) (-1254.095) [-1252.767] -- 0:00:53
Average standard deviation of split frequencies: 0.015194
145500 -- (-1252.819) (-1255.890) [-1254.820] (-1258.163) * [-1252.586] (-1255.662) (-1253.507) (-1252.449) -- 0:00:52
146000 -- [-1252.670] (-1255.931) (-1252.532) (-1255.879) * (-1253.639) (-1255.504) [-1254.933] (-1255.836) -- 0:00:52
146500 -- (-1255.941) (-1256.252) (-1255.590) [-1254.087] * [-1255.396] (-1256.040) (-1252.849) (-1257.650) -- 0:00:52
147000 -- (-1256.324) (-1256.777) [-1255.565] (-1254.380) * [-1258.813] (-1256.105) (-1253.698) (-1261.767) -- 0:00:52
147500 -- (-1259.323) (-1253.011) (-1252.450) [-1254.058] * (-1253.635) (-1255.615) (-1253.910) [-1255.859] -- 0:00:52
148000 -- [-1252.909] (-1253.149) (-1252.424) (-1253.204) * (-1254.140) (-1254.730) (-1256.913) [-1254.379] -- 0:00:51
148500 -- (-1255.747) (-1253.039) (-1252.424) [-1254.420] * [-1254.242] (-1252.671) (-1258.385) (-1254.052) -- 0:00:51
149000 -- (-1253.801) [-1253.800] (-1253.068) (-1254.246) * (-1254.314) [-1252.348] (-1260.018) (-1253.277) -- 0:00:51
149500 -- (-1253.298) (-1253.602) [-1252.818] (-1252.598) * [-1255.383] (-1253.718) (-1257.079) (-1254.320) -- 0:00:51
150000 -- [-1254.174] (-1253.733) (-1253.778) (-1254.749) * [-1252.896] (-1253.480) (-1253.773) (-1253.210) -- 0:00:51
Average standard deviation of split frequencies: 0.014080
150500 -- [-1253.298] (-1256.038) (-1255.504) (-1253.262) * (-1254.331) (-1253.201) (-1255.974) [-1253.650] -- 0:00:50
151000 -- (-1255.936) [-1255.088] (-1256.767) (-1254.368) * (-1253.710) [-1255.234] (-1253.519) (-1253.679) -- 0:00:50
151500 -- [-1257.444] (-1254.326) (-1256.495) (-1254.864) * [-1254.656] (-1254.911) (-1255.517) (-1253.664) -- 0:00:56
152000 -- (-1255.209) [-1254.976] (-1256.767) (-1252.964) * [-1255.716] (-1260.411) (-1255.479) (-1253.100) -- 0:00:55
152500 -- (-1256.918) [-1254.308] (-1255.011) (-1253.737) * (-1253.638) (-1257.259) (-1253.161) [-1253.085] -- 0:00:55
153000 -- (-1256.599) (-1253.898) (-1253.847) [-1258.969] * [-1253.309] (-1262.558) (-1254.121) (-1257.023) -- 0:00:55
153500 -- (-1255.613) (-1253.970) (-1252.849) [-1255.635] * (-1253.961) (-1253.958) [-1255.410] (-1256.622) -- 0:00:55
154000 -- (-1253.681) (-1254.840) (-1253.277) [-1256.511] * (-1255.500) [-1254.468] (-1257.303) (-1254.422) -- 0:00:54
154500 -- [-1252.978] (-1256.831) (-1253.461) (-1252.908) * (-1254.903) (-1256.731) (-1256.416) [-1255.785] -- 0:00:54
155000 -- (-1253.659) (-1255.619) (-1253.893) [-1257.244] * (-1256.563) (-1258.339) [-1253.913] (-1255.642) -- 0:00:54
Average standard deviation of split frequencies: 0.012591
155500 -- (-1254.497) (-1253.004) (-1254.984) [-1254.613] * (-1258.144) (-1255.865) [-1254.922] (-1256.794) -- 0:00:54
156000 -- [-1253.268] (-1253.207) (-1254.628) (-1254.198) * (-1255.829) (-1262.874) (-1254.512) [-1255.534] -- 0:00:54
156500 -- (-1254.323) [-1252.972] (-1257.819) (-1256.288) * (-1257.613) (-1262.054) (-1257.543) [-1258.329] -- 0:00:53
157000 -- (-1253.134) (-1252.947) (-1259.318) [-1254.319] * (-1253.042) (-1260.534) (-1256.186) [-1256.038] -- 0:00:53
157500 -- (-1253.832) [-1255.165] (-1256.736) (-1255.659) * (-1255.825) (-1260.960) [-1254.758] (-1254.543) -- 0:00:53
158000 -- (-1258.237) (-1256.613) (-1253.877) [-1255.128] * [-1253.449] (-1262.472) (-1254.671) (-1253.977) -- 0:00:53
158500 -- (-1257.006) (-1254.824) (-1257.158) [-1254.552] * (-1253.819) (-1254.822) (-1253.406) [-1254.937] -- 0:00:53
159000 -- (-1254.420) (-1253.767) [-1256.090] (-1254.796) * (-1254.893) (-1253.194) (-1254.461) [-1255.851] -- 0:00:52
159500 -- (-1255.377) (-1255.078) [-1254.509] (-1257.319) * (-1252.592) (-1254.274) (-1257.862) [-1254.384] -- 0:00:52
160000 -- (-1256.496) [-1256.405] (-1255.002) (-1253.476) * (-1254.570) (-1257.123) (-1259.058) [-1254.383] -- 0:00:52
Average standard deviation of split frequencies: 0.014843
160500 -- (-1256.204) (-1254.633) (-1255.520) [-1254.268] * [-1253.085] (-1256.694) (-1255.861) (-1255.130) -- 0:00:52
161000 -- (-1253.314) [-1253.813] (-1253.946) (-1254.422) * (-1253.035) (-1255.795) [-1255.286] (-1255.963) -- 0:00:52
161500 -- (-1252.799) (-1255.570) (-1253.659) [-1254.402] * [-1253.026] (-1256.642) (-1254.894) (-1255.199) -- 0:00:51
162000 -- (-1252.981) (-1255.208) [-1255.409] (-1252.448) * [-1253.281] (-1253.170) (-1253.643) (-1255.928) -- 0:00:51
162500 -- [-1253.426] (-1254.898) (-1256.998) (-1253.312) * (-1253.541) [-1253.121] (-1254.243) (-1258.723) -- 0:00:51
163000 -- (-1255.458) (-1255.223) (-1253.937) [-1254.667] * (-1254.775) (-1253.488) (-1253.003) [-1256.080] -- 0:00:51
163500 -- (-1254.219) (-1254.312) (-1255.143) [-1255.137] * (-1254.342) [-1255.852] (-1253.919) (-1254.413) -- 0:00:51
164000 -- (-1254.163) (-1253.636) [-1256.318] (-1253.808) * (-1255.678) [-1252.994] (-1254.504) (-1256.040) -- 0:00:50
164500 -- [-1253.449] (-1257.019) (-1254.211) (-1253.853) * [-1254.025] (-1253.646) (-1254.873) (-1254.427) -- 0:00:50
165000 -- (-1254.402) [-1256.568] (-1254.847) (-1254.408) * (-1253.853) [-1255.367] (-1256.242) (-1253.727) -- 0:00:50
Average standard deviation of split frequencies: 0.015096
165500 -- [-1254.348] (-1255.820) (-1255.671) (-1253.102) * (-1256.018) (-1253.836) [-1253.294] (-1255.132) -- 0:00:50
166000 -- (-1255.511) (-1257.040) [-1256.457] (-1257.813) * (-1253.198) (-1254.743) (-1253.785) [-1255.594] -- 0:00:50
166500 -- [-1254.884] (-1259.894) (-1253.616) (-1256.269) * (-1257.724) (-1254.862) (-1253.964) [-1254.860] -- 0:00:50
167000 -- (-1256.478) (-1255.147) [-1254.171] (-1254.887) * (-1253.261) (-1255.021) [-1254.326] (-1254.622) -- 0:00:49
167500 -- (-1257.375) (-1255.315) [-1254.763] (-1253.203) * [-1254.202] (-1253.279) (-1254.363) (-1256.892) -- 0:00:54
168000 -- [-1257.577] (-1255.523) (-1253.651) (-1254.661) * (-1254.305) [-1254.599] (-1253.169) (-1254.095) -- 0:00:54
168500 -- [-1252.418] (-1252.932) (-1260.155) (-1254.676) * (-1254.225) (-1256.869) (-1252.697) [-1254.548] -- 0:00:54
169000 -- (-1254.460) (-1256.919) (-1259.543) [-1254.873] * (-1255.221) (-1253.719) [-1252.705] (-1255.876) -- 0:00:54
169500 -- (-1253.352) [-1254.928] (-1260.084) (-1255.279) * (-1254.465) (-1256.325) (-1255.002) [-1255.935] -- 0:00:53
170000 -- (-1253.607) [-1255.108] (-1257.883) (-1254.418) * (-1263.072) (-1257.293) (-1254.107) [-1255.571] -- 0:00:53
Average standard deviation of split frequencies: 0.016137
170500 -- (-1254.425) (-1257.230) (-1254.218) [-1253.750] * (-1254.646) [-1253.912] (-1254.000) (-1254.484) -- 0:00:53
171000 -- (-1257.376) [-1256.063] (-1256.369) (-1256.317) * (-1255.987) [-1254.020] (-1252.448) (-1253.712) -- 0:00:53
171500 -- (-1259.350) [-1255.884] (-1255.406) (-1253.728) * [-1255.254] (-1254.647) (-1252.698) (-1255.231) -- 0:00:53
172000 -- (-1257.697) [-1253.416] (-1254.268) (-1253.041) * (-1255.735) (-1262.789) [-1254.503] (-1259.031) -- 0:00:52
172500 -- (-1254.976) (-1253.162) (-1257.788) [-1252.533] * (-1255.829) [-1255.935] (-1255.361) (-1254.932) -- 0:00:52
173000 -- (-1257.032) (-1253.963) (-1256.685) [-1252.466] * [-1253.956] (-1257.363) (-1252.833) (-1256.304) -- 0:00:52
173500 -- (-1260.269) [-1253.181] (-1254.466) (-1252.620) * (-1253.795) (-1253.691) [-1254.402] (-1258.474) -- 0:00:52
174000 -- (-1256.884) (-1253.741) (-1254.170) [-1256.823] * (-1256.331) (-1253.020) [-1252.862] (-1256.097) -- 0:00:52
174500 -- (-1254.623) (-1256.278) [-1253.558] (-1254.631) * (-1256.225) (-1252.906) [-1253.806] (-1255.714) -- 0:00:52
175000 -- [-1254.290] (-1254.720) (-1254.406) (-1252.919) * (-1255.564) (-1254.202) [-1253.569] (-1256.707) -- 0:00:51
Average standard deviation of split frequencies: 0.017112
175500 -- [-1254.855] (-1254.862) (-1253.550) (-1253.798) * (-1255.888) (-1252.736) [-1255.366] (-1254.504) -- 0:00:51
176000 -- (-1256.785) (-1256.673) (-1253.629) [-1254.399] * (-1254.057) [-1253.980] (-1253.415) (-1255.800) -- 0:00:51
176500 -- (-1254.881) (-1256.176) [-1253.038] (-1258.719) * (-1255.630) (-1254.334) [-1253.692] (-1254.427) -- 0:00:51
177000 -- (-1258.278) (-1253.369) [-1252.482] (-1254.200) * (-1256.256) (-1253.624) (-1252.444) [-1254.251] -- 0:00:51
177500 -- (-1257.162) (-1253.523) (-1254.878) [-1253.806] * (-1256.387) (-1259.117) [-1254.022] (-1258.209) -- 0:00:50
178000 -- (-1258.107) (-1253.941) (-1255.058) [-1253.725] * [-1258.242] (-1257.657) (-1257.549) (-1258.804) -- 0:00:50
178500 -- [-1257.501] (-1254.925) (-1256.331) (-1252.505) * [-1257.152] (-1254.216) (-1253.339) (-1259.659) -- 0:00:50
179000 -- [-1252.413] (-1254.681) (-1254.055) (-1252.845) * (-1254.054) [-1254.404] (-1255.029) (-1258.403) -- 0:00:50
179500 -- (-1256.558) (-1253.935) [-1254.504] (-1252.284) * (-1256.944) (-1254.198) [-1256.247] (-1258.939) -- 0:00:50
180000 -- [-1254.519] (-1253.327) (-1253.161) (-1254.826) * [-1253.568] (-1253.061) (-1255.681) (-1255.841) -- 0:00:50
Average standard deviation of split frequencies: 0.015656
180500 -- (-1257.017) (-1253.181) [-1256.107] (-1253.866) * (-1257.453) [-1254.181] (-1257.312) (-1255.102) -- 0:00:49
181000 -- [-1255.023] (-1253.075) (-1255.331) (-1255.302) * (-1253.310) (-1254.234) (-1255.220) [-1256.175] -- 0:00:49
181500 -- (-1253.026) [-1253.394] (-1253.408) (-1256.276) * (-1255.436) [-1255.434] (-1259.127) (-1253.418) -- 0:00:49
182000 -- (-1253.229) (-1254.059) (-1254.995) [-1253.826] * (-1254.693) [-1255.243] (-1253.552) (-1254.220) -- 0:00:49
182500 -- (-1254.052) (-1253.812) [-1253.745] (-1254.569) * (-1259.648) (-1255.945) [-1259.274] (-1258.500) -- 0:00:49
183000 -- [-1254.249] (-1254.377) (-1259.000) (-1254.531) * (-1252.874) (-1258.442) (-1259.612) [-1253.769] -- 0:00:53
183500 -- (-1256.085) [-1253.366] (-1254.523) (-1254.523) * (-1253.566) [-1253.815] (-1256.308) (-1254.963) -- 0:00:53
184000 -- [-1255.707] (-1256.147) (-1252.534) (-1253.979) * (-1253.611) [-1253.910] (-1255.313) (-1253.607) -- 0:00:53
184500 -- (-1254.175) [-1253.645] (-1254.931) (-1254.640) * [-1253.163] (-1254.553) (-1253.817) (-1253.811) -- 0:00:53
185000 -- (-1253.703) (-1255.973) [-1256.624] (-1254.467) * (-1256.591) [-1255.647] (-1255.493) (-1257.266) -- 0:00:52
Average standard deviation of split frequencies: 0.015066
185500 -- (-1256.123) (-1254.072) (-1253.510) [-1254.026] * [-1255.123] (-1252.478) (-1255.014) (-1261.668) -- 0:00:52
186000 -- (-1257.353) [-1253.023] (-1252.883) (-1253.528) * (-1253.508) [-1254.982] (-1255.243) (-1256.610) -- 0:00:52
186500 -- (-1253.081) (-1257.203) [-1253.270] (-1255.242) * [-1252.550] (-1256.949) (-1254.441) (-1256.129) -- 0:00:52
187000 -- (-1252.913) (-1254.713) (-1254.241) [-1255.926] * (-1253.117) [-1260.964] (-1256.603) (-1255.135) -- 0:00:52
187500 -- [-1252.397] (-1254.555) (-1254.475) (-1257.562) * [-1257.096] (-1259.222) (-1255.156) (-1257.392) -- 0:00:52
188000 -- (-1252.410) (-1255.790) (-1253.681) [-1253.166] * [-1254.577] (-1255.185) (-1254.003) (-1256.114) -- 0:00:51
188500 -- (-1252.412) [-1253.922] (-1255.580) (-1263.135) * (-1254.472) (-1255.832) [-1256.157] (-1253.921) -- 0:00:51
189000 -- (-1252.800) (-1253.530) [-1256.931] (-1260.869) * [-1255.053] (-1257.643) (-1254.645) (-1253.203) -- 0:00:51
189500 -- (-1252.993) [-1254.454] (-1252.919) (-1255.491) * (-1255.010) (-1260.071) [-1254.406] (-1252.694) -- 0:00:51
190000 -- (-1253.013) (-1254.631) (-1253.010) [-1259.766] * (-1255.270) (-1256.580) [-1253.799] (-1254.678) -- 0:00:51
Average standard deviation of split frequencies: 0.013525
190500 -- (-1254.548) [-1257.149] (-1254.795) (-1257.602) * (-1254.257) (-1253.755) (-1255.771) [-1255.324] -- 0:00:50
191000 -- (-1255.053) (-1263.728) [-1255.645] (-1255.976) * [-1254.619] (-1253.406) (-1254.451) (-1253.436) -- 0:00:50
191500 -- (-1255.646) (-1258.142) [-1254.199] (-1254.269) * [-1253.210] (-1254.480) (-1254.155) (-1255.306) -- 0:00:50
192000 -- [-1254.865] (-1257.316) (-1254.938) (-1256.299) * (-1253.751) (-1253.517) [-1254.381] (-1253.885) -- 0:00:50
192500 -- (-1255.948) (-1254.029) [-1252.848] (-1255.838) * [-1253.202] (-1254.252) (-1255.085) (-1252.631) -- 0:00:50
193000 -- (-1254.114) (-1253.758) [-1253.085] (-1253.663) * (-1253.370) [-1253.940] (-1252.742) (-1254.156) -- 0:00:50
193500 -- (-1253.775) (-1254.980) [-1253.684] (-1253.553) * [-1255.815] (-1253.081) (-1254.302) (-1253.620) -- 0:00:50
194000 -- (-1258.908) (-1254.351) [-1253.508] (-1253.067) * (-1256.709) (-1253.233) [-1253.058] (-1256.556) -- 0:00:49
194500 -- (-1256.547) (-1254.232) [-1253.898] (-1254.349) * [-1254.194] (-1253.605) (-1252.907) (-1254.846) -- 0:00:49
195000 -- [-1253.274] (-1256.860) (-1253.436) (-1255.576) * (-1255.635) (-1254.922) [-1256.641] (-1254.071) -- 0:00:49
Average standard deviation of split frequencies: 0.011743
195500 -- (-1253.118) (-1254.242) (-1256.681) [-1253.948] * (-1255.040) (-1257.504) (-1254.951) [-1255.840] -- 0:00:49
196000 -- (-1254.583) (-1255.178) (-1253.508) [-1253.459] * (-1254.761) (-1254.553) (-1254.228) [-1257.120] -- 0:00:49
196500 -- [-1254.640] (-1253.055) (-1252.839) (-1257.671) * (-1254.194) [-1254.295] (-1254.050) (-1254.015) -- 0:00:49
197000 -- (-1253.314) [-1253.055] (-1253.246) (-1256.950) * (-1254.220) (-1255.761) (-1254.347) [-1255.692] -- 0:00:48
197500 -- (-1254.476) (-1255.343) (-1253.929) [-1256.226] * (-1252.479) (-1254.395) (-1257.309) [-1255.181] -- 0:00:48
198000 -- (-1255.367) (-1255.375) (-1257.342) [-1254.448] * (-1254.761) (-1255.307) [-1258.354] (-1258.682) -- 0:00:48
198500 -- (-1255.143) (-1253.467) (-1255.786) [-1255.490] * [-1256.487] (-1254.224) (-1255.812) (-1259.010) -- 0:00:48
199000 -- [-1253.712] (-1254.092) (-1256.954) (-1253.918) * [-1255.363] (-1253.508) (-1257.479) (-1254.151) -- 0:00:52
199500 -- (-1262.525) (-1253.554) [-1255.027] (-1253.917) * (-1255.313) (-1255.151) (-1252.385) [-1253.944] -- 0:00:52
200000 -- (-1260.534) [-1253.841] (-1256.117) (-1256.312) * (-1256.847) [-1254.500] (-1254.751) (-1257.910) -- 0:00:51
Average standard deviation of split frequencies: 0.011608
200500 -- [-1256.320] (-1255.866) (-1255.416) (-1258.192) * (-1253.087) (-1259.225) (-1254.547) [-1256.563] -- 0:00:51
201000 -- (-1255.660) [-1258.115] (-1253.364) (-1252.921) * (-1253.485) [-1255.832] (-1253.661) (-1258.826) -- 0:00:51
201500 -- (-1255.730) (-1257.355) (-1255.103) [-1255.552] * (-1254.369) (-1253.068) [-1252.606] (-1256.196) -- 0:00:51
202000 -- [-1255.747] (-1256.245) (-1254.170) (-1252.923) * [-1255.762] (-1256.470) (-1253.503) (-1254.674) -- 0:00:51
202500 -- (-1253.642) (-1257.182) (-1254.144) [-1253.564] * (-1254.306) (-1256.171) (-1252.954) [-1253.184] -- 0:00:51
203000 -- (-1253.183) (-1256.169) [-1253.220] (-1253.327) * (-1256.108) [-1254.677] (-1254.541) (-1257.247) -- 0:00:51
203500 -- (-1253.319) (-1255.119) (-1252.934) [-1252.932] * (-1253.410) [-1255.771] (-1254.755) (-1253.500) -- 0:00:50
204000 -- [-1253.751] (-1253.602) (-1254.284) (-1254.917) * (-1253.352) (-1256.499) (-1257.624) [-1253.288] -- 0:00:50
204500 -- (-1256.009) (-1253.052) [-1256.041] (-1254.862) * (-1254.890) (-1256.761) (-1258.509) [-1254.529] -- 0:00:50
205000 -- (-1259.619) (-1253.726) (-1254.840) [-1255.352] * (-1254.935) [-1255.109] (-1257.383) (-1254.497) -- 0:00:50
Average standard deviation of split frequencies: 0.011315
205500 -- (-1254.736) [-1253.729] (-1254.643) (-1254.667) * (-1257.887) (-1256.205) [-1253.448] (-1255.601) -- 0:00:50
206000 -- (-1255.807) (-1252.784) (-1253.934) [-1254.488] * [-1254.591] (-1255.397) (-1253.162) (-1260.126) -- 0:00:50
206500 -- (-1254.834) [-1256.498] (-1256.909) (-1254.046) * (-1255.387) (-1255.174) [-1253.229] (-1258.639) -- 0:00:49
207000 -- [-1256.177] (-1253.206) (-1254.593) (-1256.763) * (-1254.008) [-1253.132] (-1253.045) (-1259.312) -- 0:00:49
207500 -- (-1254.033) (-1254.457) [-1252.525] (-1254.642) * [-1254.910] (-1257.317) (-1252.813) (-1256.028) -- 0:00:49
208000 -- [-1254.167] (-1255.834) (-1253.374) (-1254.209) * (-1255.099) (-1259.603) (-1255.920) [-1258.985] -- 0:00:49
208500 -- [-1255.077] (-1253.331) (-1252.909) (-1254.407) * [-1255.076] (-1256.686) (-1255.965) (-1256.197) -- 0:00:49
209000 -- (-1254.259) [-1253.589] (-1253.021) (-1258.288) * [-1256.418] (-1259.426) (-1254.787) (-1258.325) -- 0:00:49
209500 -- [-1257.255] (-1254.180) (-1252.906) (-1257.892) * (-1253.558) (-1257.166) [-1255.641] (-1257.363) -- 0:00:49
210000 -- [-1252.902] (-1255.562) (-1253.506) (-1255.057) * (-1253.991) [-1254.441] (-1255.823) (-1258.033) -- 0:00:48
Average standard deviation of split frequencies: 0.010567
210500 -- (-1253.594) (-1255.562) (-1253.293) [-1252.945] * (-1254.478) (-1253.798) [-1254.242] (-1256.666) -- 0:00:48
211000 -- [-1252.988] (-1257.724) (-1253.715) (-1254.824) * (-1254.162) [-1254.779] (-1255.722) (-1257.772) -- 0:00:48
211500 -- (-1253.677) [-1255.671] (-1253.318) (-1253.451) * (-1252.848) [-1252.923] (-1257.804) (-1256.711) -- 0:00:48
212000 -- (-1252.924) (-1256.596) [-1252.923] (-1253.998) * (-1252.599) [-1255.299] (-1257.890) (-1256.837) -- 0:00:48
212500 -- (-1254.636) (-1255.128) [-1253.534] (-1254.044) * [-1255.727] (-1253.031) (-1257.541) (-1254.157) -- 0:00:48
213000 -- (-1256.280) (-1254.766) (-1253.342) [-1254.636] * [-1254.363] (-1253.454) (-1254.721) (-1261.437) -- 0:00:48
213500 -- [-1259.633] (-1254.089) (-1253.808) (-1252.874) * (-1253.700) [-1253.441] (-1254.329) (-1257.753) -- 0:00:47
214000 -- (-1259.301) [-1255.601] (-1256.332) (-1252.796) * (-1253.067) (-1254.948) [-1252.742] (-1253.298) -- 0:00:47
214500 -- (-1258.641) (-1254.092) (-1257.836) [-1253.231] * (-1253.820) [-1254.838] (-1254.783) (-1254.286) -- 0:00:47
215000 -- [-1254.967] (-1252.915) (-1259.166) (-1252.705) * (-1253.820) (-1257.641) [-1253.778] (-1254.060) -- 0:00:51
Average standard deviation of split frequencies: 0.010548
215500 -- (-1255.816) (-1253.326) (-1255.399) [-1254.716] * [-1253.073] (-1256.174) (-1253.441) (-1258.254) -- 0:00:50
216000 -- (-1255.269) [-1255.245] (-1254.608) (-1252.839) * (-1253.393) (-1257.968) [-1256.396] (-1254.697) -- 0:00:50
216500 -- (-1257.529) (-1257.300) [-1255.262] (-1253.251) * (-1254.046) [-1256.441] (-1258.192) (-1257.081) -- 0:00:50
217000 -- (-1258.161) (-1253.894) [-1254.649] (-1257.490) * [-1253.208] (-1257.630) (-1258.105) (-1254.881) -- 0:00:50
217500 -- (-1254.380) (-1254.008) (-1254.742) [-1255.670] * (-1253.550) (-1254.899) (-1255.401) [-1252.392] -- 0:00:50
218000 -- (-1253.707) (-1254.029) (-1255.581) [-1255.315] * [-1254.068] (-1253.241) (-1258.272) (-1252.919) -- 0:00:50
218500 -- (-1253.214) (-1254.521) (-1255.263) [-1255.355] * [-1254.475] (-1252.377) (-1252.654) (-1253.314) -- 0:00:50
219000 -- [-1253.677] (-1254.521) (-1254.773) (-1253.971) * (-1255.754) (-1256.317) [-1254.831] (-1254.000) -- 0:00:49
219500 -- (-1257.115) [-1254.204] (-1255.619) (-1254.907) * (-1257.685) (-1258.777) (-1254.560) [-1253.293] -- 0:00:49
220000 -- (-1257.199) (-1257.858) [-1255.787] (-1254.413) * (-1256.714) [-1261.227] (-1254.388) (-1253.321) -- 0:00:49
Average standard deviation of split frequencies: 0.010147
220500 -- [-1255.191] (-1255.952) (-1254.253) (-1253.508) * (-1254.027) (-1257.337) (-1254.671) [-1253.656] -- 0:00:49
221000 -- (-1252.394) (-1255.836) [-1254.857] (-1255.452) * [-1252.584] (-1259.288) (-1254.705) (-1253.811) -- 0:00:49
221500 -- [-1253.590] (-1255.442) (-1253.318) (-1257.233) * [-1253.585] (-1255.359) (-1257.069) (-1255.494) -- 0:00:49
222000 -- (-1253.496) (-1255.666) [-1254.868] (-1255.078) * (-1253.863) (-1254.680) [-1257.043] (-1256.335) -- 0:00:49
222500 -- (-1256.849) [-1254.511] (-1256.831) (-1256.750) * [-1253.870] (-1252.767) (-1257.979) (-1254.218) -- 0:00:48
223000 -- (-1253.557) [-1253.391] (-1253.883) (-1256.992) * (-1253.904) (-1252.743) [-1255.923] (-1258.802) -- 0:00:48
223500 -- [-1258.338] (-1256.227) (-1254.044) (-1253.359) * (-1253.717) (-1256.822) (-1256.369) [-1256.722] -- 0:00:48
224000 -- (-1256.074) (-1254.691) (-1253.950) [-1252.614] * (-1255.434) (-1257.838) (-1256.014) [-1254.972] -- 0:00:48
224500 -- (-1262.180) (-1255.747) [-1253.550] (-1254.844) * (-1253.856) (-1253.417) (-1255.027) [-1254.045] -- 0:00:48
225000 -- (-1262.120) [-1255.014] (-1253.854) (-1257.123) * [-1253.180] (-1254.125) (-1259.077) (-1253.621) -- 0:00:48
Average standard deviation of split frequencies: 0.010198
225500 -- (-1258.628) [-1253.750] (-1259.059) (-1258.602) * (-1254.820) [-1253.217] (-1256.140) (-1253.967) -- 0:00:48
226000 -- (-1266.174) (-1253.701) (-1253.944) [-1254.755] * (-1252.381) (-1252.629) (-1257.309) [-1253.371] -- 0:00:47
226500 -- (-1256.921) (-1255.266) [-1252.600] (-1254.874) * [-1253.349] (-1252.504) (-1256.948) (-1253.961) -- 0:00:47
227000 -- (-1253.194) (-1257.391) [-1254.555] (-1254.545) * (-1253.202) (-1252.749) [-1256.954] (-1254.172) -- 0:00:47
227500 -- [-1253.798] (-1260.074) (-1253.810) (-1254.170) * (-1253.149) [-1253.184] (-1256.249) (-1258.279) -- 0:00:47
228000 -- (-1257.776) [-1257.693] (-1254.147) (-1252.881) * (-1253.062) (-1253.761) (-1257.851) [-1252.971] -- 0:00:47
228500 -- (-1254.585) [-1257.677] (-1253.844) (-1253.931) * [-1253.038] (-1253.123) (-1256.077) (-1255.291) -- 0:00:47
229000 -- (-1254.238) (-1255.518) [-1253.774] (-1253.969) * [-1253.882] (-1254.051) (-1256.186) (-1253.253) -- 0:00:47
229500 -- (-1255.060) (-1254.779) [-1255.189] (-1253.403) * (-1255.835) (-1254.840) (-1255.002) [-1253.074] -- 0:00:47
230000 -- [-1252.856] (-1256.652) (-1255.419) (-1254.293) * (-1253.856) [-1255.852] (-1253.127) (-1254.044) -- 0:00:46
Average standard deviation of split frequencies: 0.011581
230500 -- (-1255.821) (-1253.077) (-1262.190) [-1254.040] * [-1253.527] (-1256.118) (-1254.901) (-1254.307) -- 0:00:50
231000 -- (-1255.714) (-1253.046) (-1256.614) [-1253.960] * (-1253.377) (-1255.064) (-1254.840) [-1253.967] -- 0:00:49
231500 -- [-1254.324] (-1254.468) (-1254.041) (-1253.363) * [-1254.085] (-1256.230) (-1253.548) (-1257.088) -- 0:00:49
232000 -- (-1253.363) (-1253.849) [-1252.324] (-1254.066) * (-1253.459) [-1252.915] (-1255.092) (-1255.155) -- 0:00:49
232500 -- (-1253.694) [-1253.879] (-1253.503) (-1255.600) * [-1253.455] (-1253.192) (-1253.702) (-1255.420) -- 0:00:49
233000 -- (-1252.696) (-1253.882) [-1252.898] (-1255.600) * (-1254.206) (-1255.901) [-1253.953] (-1253.363) -- 0:00:49
233500 -- (-1253.932) (-1257.170) [-1253.529] (-1259.356) * [-1253.104] (-1253.934) (-1255.604) (-1253.719) -- 0:00:49
234000 -- (-1256.470) (-1254.850) (-1254.268) [-1254.434] * [-1254.445] (-1253.286) (-1256.056) (-1257.196) -- 0:00:49
234500 -- (-1256.350) (-1253.085) [-1253.711] (-1252.557) * (-1254.489) [-1254.895] (-1256.131) (-1255.182) -- 0:00:48
235000 -- (-1253.106) (-1253.085) [-1254.470] (-1252.289) * (-1253.648) (-1257.892) (-1256.095) [-1254.380] -- 0:00:48
Average standard deviation of split frequencies: 0.012337
235500 -- (-1253.009) (-1253.201) [-1253.452] (-1255.655) * (-1253.667) (-1255.311) [-1258.229] (-1253.268) -- 0:00:48
236000 -- (-1252.645) (-1253.624) [-1254.167] (-1254.097) * (-1257.533) (-1252.583) [-1256.047] (-1255.570) -- 0:00:48
236500 -- (-1252.646) (-1255.506) [-1253.195] (-1255.425) * (-1255.099) (-1254.034) (-1254.665) [-1255.552] -- 0:00:48
237000 -- (-1252.809) (-1252.681) (-1253.125) [-1254.718] * (-1256.563) (-1256.914) (-1253.972) [-1254.738] -- 0:00:48
237500 -- (-1253.376) [-1252.641] (-1253.703) (-1255.844) * (-1255.489) [-1257.850] (-1258.115) (-1254.708) -- 0:00:48
238000 -- [-1252.776] (-1253.348) (-1257.122) (-1254.780) * (-1253.861) (-1254.655) (-1252.692) [-1255.898] -- 0:00:48
238500 -- (-1260.125) (-1253.150) [-1254.998] (-1252.852) * (-1253.143) [-1256.013] (-1257.429) (-1254.580) -- 0:00:47
239000 -- [-1256.514] (-1254.217) (-1252.480) (-1255.516) * (-1253.169) [-1258.720] (-1254.223) (-1253.087) -- 0:00:47
239500 -- (-1254.647) (-1254.980) [-1252.949] (-1253.438) * [-1253.120] (-1255.668) (-1254.295) (-1255.249) -- 0:00:47
240000 -- [-1253.338] (-1254.121) (-1252.958) (-1253.001) * [-1255.583] (-1255.428) (-1253.001) (-1253.538) -- 0:00:47
Average standard deviation of split frequencies: 0.011385
240500 -- (-1253.340) (-1254.031) [-1253.543] (-1255.639) * (-1259.757) (-1257.831) [-1256.412] (-1254.267) -- 0:00:47
241000 -- (-1253.188) (-1254.597) (-1255.187) [-1254.385] * (-1260.854) (-1255.950) [-1253.917] (-1254.765) -- 0:00:47
241500 -- (-1254.379) (-1253.549) [-1252.770] (-1256.695) * (-1260.514) (-1255.440) (-1254.160) [-1255.443] -- 0:00:47
242000 -- (-1252.624) [-1253.944] (-1253.274) (-1254.921) * (-1255.371) [-1253.097] (-1253.790) (-1252.994) -- 0:00:46
242500 -- [-1252.592] (-1253.112) (-1253.687) (-1255.177) * (-1254.598) (-1253.094) [-1254.039] (-1253.990) -- 0:00:46
243000 -- [-1253.178] (-1253.494) (-1253.801) (-1255.758) * (-1254.171) (-1253.325) [-1254.183] (-1254.063) -- 0:00:46
243500 -- (-1256.316) [-1254.822] (-1254.108) (-1253.383) * (-1254.236) (-1255.664) (-1254.063) [-1254.648] -- 0:00:46
244000 -- (-1255.242) (-1252.980) [-1254.022] (-1258.274) * (-1255.134) [-1257.190] (-1254.197) (-1254.303) -- 0:00:46
244500 -- [-1253.931] (-1256.561) (-1255.017) (-1253.819) * (-1254.163) (-1253.386) (-1257.838) [-1253.691] -- 0:00:46
245000 -- (-1254.268) [-1254.831] (-1256.161) (-1254.021) * (-1252.761) (-1253.466) (-1254.453) [-1256.351] -- 0:00:46
Average standard deviation of split frequencies: 0.011836
245500 -- (-1253.673) (-1259.247) (-1256.018) [-1256.225] * (-1255.475) [-1253.130] (-1253.882) (-1255.967) -- 0:00:46
246000 -- (-1254.162) [-1254.551] (-1256.592) (-1254.084) * (-1254.256) [-1260.767] (-1254.526) (-1255.454) -- 0:00:45
246500 -- (-1256.949) (-1256.323) [-1255.697] (-1253.706) * (-1257.031) [-1254.204] (-1254.554) (-1253.785) -- 0:00:48
247000 -- (-1255.197) (-1255.077) [-1253.888] (-1256.712) * [-1258.623] (-1253.334) (-1256.828) (-1256.726) -- 0:00:48
247500 -- (-1253.993) (-1259.685) [-1254.247] (-1256.125) * (-1256.110) (-1254.629) [-1258.367] (-1255.826) -- 0:00:48
248000 -- (-1253.056) [-1257.254] (-1254.360) (-1252.983) * (-1253.914) (-1255.446) [-1255.214] (-1254.411) -- 0:00:48
248500 -- (-1255.294) [-1253.189] (-1253.810) (-1252.797) * (-1254.723) (-1254.152) (-1256.205) [-1253.543] -- 0:00:48
249000 -- (-1253.810) (-1255.538) (-1252.514) [-1252.938] * (-1255.505) (-1253.931) (-1258.174) [-1253.040] -- 0:00:48
249500 -- [-1254.751] (-1255.812) (-1252.839) (-1253.159) * (-1256.776) (-1253.981) (-1260.861) [-1254.803] -- 0:00:48
250000 -- [-1252.569] (-1254.361) (-1252.849) (-1253.538) * [-1254.546] (-1258.357) (-1263.370) (-1253.156) -- 0:00:48
Average standard deviation of split frequencies: 0.012459
250500 -- (-1253.574) (-1253.399) (-1252.744) [-1252.832] * (-1253.981) (-1260.569) (-1258.419) [-1258.750] -- 0:00:47
251000 -- (-1253.022) (-1253.513) [-1255.026] (-1252.916) * (-1255.299) (-1256.283) (-1258.536) [-1256.930] -- 0:00:47
251500 -- (-1253.616) (-1253.319) (-1254.079) [-1253.547] * [-1253.004] (-1254.990) (-1255.146) (-1258.391) -- 0:00:47
252000 -- (-1253.624) [-1253.377] (-1254.011) (-1253.367) * (-1253.836) [-1254.250] (-1253.196) (-1255.923) -- 0:00:47
252500 -- (-1257.226) (-1254.857) (-1254.716) [-1256.759] * (-1253.185) [-1256.022] (-1256.827) (-1252.592) -- 0:00:47
253000 -- (-1255.187) (-1255.489) (-1258.782) [-1254.144] * (-1254.051) [-1254.592] (-1254.004) (-1253.146) -- 0:00:47
253500 -- (-1254.223) (-1258.319) [-1256.188] (-1252.639) * (-1257.221) (-1252.470) (-1253.961) [-1253.173] -- 0:00:47
254000 -- (-1256.718) (-1255.974) (-1254.542) [-1253.603] * (-1258.209) [-1253.471] (-1253.423) (-1253.865) -- 0:00:46
254500 -- (-1257.941) (-1257.479) (-1255.506) [-1256.356] * (-1253.145) (-1254.984) [-1254.959] (-1252.634) -- 0:00:46
255000 -- (-1254.404) [-1256.273] (-1255.782) (-1256.152) * (-1254.193) [-1257.523] (-1254.527) (-1252.711) -- 0:00:46
Average standard deviation of split frequencies: 0.012430
255500 -- (-1253.034) (-1259.577) (-1254.672) [-1252.763] * (-1255.974) (-1256.110) (-1255.263) [-1253.576] -- 0:00:46
256000 -- (-1255.860) (-1253.152) (-1253.561) [-1256.152] * (-1258.376) (-1254.857) (-1255.017) [-1253.961] -- 0:00:46
256500 -- (-1257.139) (-1258.998) [-1253.597] (-1257.211) * (-1256.613) (-1255.836) [-1257.467] (-1252.488) -- 0:00:46
257000 -- (-1255.133) (-1256.498) (-1255.452) [-1255.725] * [-1256.314] (-1253.375) (-1253.593) (-1252.490) -- 0:00:46
257500 -- (-1253.899) (-1256.477) [-1255.073] (-1253.391) * (-1255.274) (-1253.570) [-1253.333] (-1254.912) -- 0:00:46
258000 -- (-1253.793) [-1253.578] (-1258.314) (-1253.697) * (-1255.539) (-1253.691) [-1254.183] (-1252.972) -- 0:00:46
258500 -- [-1252.856] (-1253.293) (-1255.479) (-1256.094) * [-1255.538] (-1252.945) (-1258.184) (-1253.544) -- 0:00:45
259000 -- [-1253.390] (-1252.792) (-1253.501) (-1252.732) * (-1253.975) (-1252.840) (-1253.869) [-1252.874] -- 0:00:45
259500 -- (-1253.653) [-1253.895] (-1256.400) (-1255.555) * [-1254.604] (-1252.794) (-1256.497) (-1253.173) -- 0:00:45
260000 -- (-1252.905) (-1254.332) (-1257.037) [-1255.634] * [-1254.042] (-1252.518) (-1256.521) (-1252.853) -- 0:00:48
Average standard deviation of split frequencies: 0.012998
260500 -- [-1253.703] (-1257.485) (-1255.736) (-1255.209) * (-1259.190) (-1254.322) (-1257.668) [-1256.025] -- 0:00:48
261000 -- (-1253.564) [-1254.647] (-1255.184) (-1253.862) * (-1255.510) (-1259.302) (-1254.996) [-1257.191] -- 0:00:48
261500 -- (-1253.965) [-1256.763] (-1254.201) (-1253.970) * [-1253.542] (-1256.970) (-1254.783) (-1254.071) -- 0:00:48
262000 -- (-1254.356) [-1253.938] (-1257.086) (-1253.573) * [-1253.468] (-1253.261) (-1254.448) (-1254.560) -- 0:00:47
262500 -- (-1254.299) (-1257.766) (-1257.086) [-1253.757] * (-1255.044) [-1253.833] (-1255.405) (-1255.345) -- 0:00:47
263000 -- (-1254.467) [-1252.733] (-1253.733) (-1253.386) * [-1255.139] (-1254.820) (-1255.425) (-1255.716) -- 0:00:47
263500 -- [-1254.187] (-1253.569) (-1253.780) (-1253.864) * (-1253.929) (-1255.380) [-1256.618] (-1256.309) -- 0:00:47
264000 -- (-1253.605) [-1255.750] (-1255.167) (-1254.146) * (-1256.450) (-1254.963) (-1254.189) [-1254.729] -- 0:00:47
264500 -- (-1253.836) (-1253.340) (-1253.739) [-1256.583] * (-1257.163) (-1255.959) [-1253.104] (-1256.598) -- 0:00:47
265000 -- [-1253.946] (-1255.954) (-1253.820) (-1259.737) * [-1257.376] (-1254.401) (-1253.102) (-1254.281) -- 0:00:47
Average standard deviation of split frequencies: 0.014178
265500 -- [-1256.749] (-1254.932) (-1257.832) (-1253.566) * [-1256.822] (-1254.409) (-1255.349) (-1255.321) -- 0:00:47
266000 -- (-1254.762) [-1254.217] (-1257.731) (-1254.688) * (-1253.959) (-1261.398) [-1255.892] (-1256.578) -- 0:00:46
266500 -- (-1254.489) (-1256.665) (-1255.866) [-1253.314] * (-1254.217) (-1258.035) (-1254.983) [-1259.269] -- 0:00:46
267000 -- (-1253.361) (-1254.898) (-1255.832) [-1258.064] * (-1256.463) (-1261.644) (-1254.169) [-1253.152] -- 0:00:46
267500 -- (-1256.801) (-1255.589) [-1255.235] (-1254.435) * (-1253.543) (-1254.646) [-1255.129] (-1253.987) -- 0:00:46
268000 -- (-1258.947) (-1255.532) (-1254.885) [-1253.705] * [-1254.521] (-1254.343) (-1261.026) (-1254.354) -- 0:00:46
268500 -- (-1256.167) [-1252.996] (-1255.566) (-1255.293) * [-1254.225] (-1252.899) (-1254.106) (-1255.579) -- 0:00:46
269000 -- [-1254.343] (-1254.196) (-1257.082) (-1254.200) * (-1252.790) [-1253.831] (-1252.710) (-1255.229) -- 0:00:46
269500 -- (-1254.701) (-1257.651) [-1253.748] (-1254.288) * (-1252.543) (-1255.415) [-1253.764] (-1254.029) -- 0:00:46
270000 -- [-1255.103] (-1257.556) (-1254.448) (-1254.176) * [-1253.277] (-1253.215) (-1259.303) (-1255.794) -- 0:00:45
Average standard deviation of split frequencies: 0.014260
270500 -- (-1254.935) (-1260.938) [-1255.448] (-1257.733) * (-1263.940) (-1255.683) (-1254.212) [-1255.627] -- 0:00:45
271000 -- [-1254.131] (-1254.803) (-1254.057) (-1253.733) * [-1258.426] (-1256.138) (-1254.963) (-1255.556) -- 0:00:45
271500 -- (-1254.369) [-1255.161] (-1254.165) (-1252.580) * [-1253.148] (-1253.257) (-1254.677) (-1254.103) -- 0:00:45
272000 -- [-1253.676] (-1254.321) (-1254.847) (-1256.723) * (-1253.278) [-1252.652] (-1255.052) (-1254.286) -- 0:00:45
272500 -- (-1253.101) (-1253.819) [-1255.713] (-1255.203) * [-1253.869] (-1253.137) (-1255.640) (-1255.965) -- 0:00:45
273000 -- [-1261.654] (-1252.904) (-1252.833) (-1254.859) * (-1253.625) (-1252.724) [-1253.106] (-1253.597) -- 0:00:45
273500 -- (-1252.890) [-1254.374] (-1252.503) (-1253.172) * (-1254.635) (-1254.088) (-1252.218) [-1254.663] -- 0:00:45
274000 -- (-1252.948) [-1254.382] (-1254.527) (-1255.384) * (-1255.279) (-1255.128) (-1256.355) [-1254.069] -- 0:00:45
274500 -- (-1253.722) (-1258.526) (-1254.909) [-1256.320] * (-1253.943) (-1253.627) (-1255.387) [-1252.532] -- 0:00:44
275000 -- (-1253.445) (-1252.588) (-1254.100) [-1253.464] * (-1258.680) (-1254.034) (-1255.786) [-1253.011] -- 0:00:44
Average standard deviation of split frequencies: 0.013450
275500 -- (-1258.837) (-1255.041) [-1253.875] (-1257.301) * [-1255.988] (-1255.802) (-1258.389) (-1252.787) -- 0:00:47
276000 -- [-1254.717] (-1257.555) (-1253.757) (-1252.983) * (-1253.342) (-1252.531) (-1255.245) [-1255.198] -- 0:00:47
276500 -- (-1253.340) (-1260.040) [-1253.422] (-1254.085) * (-1255.617) [-1253.547] (-1255.218) (-1256.447) -- 0:00:47
277000 -- (-1254.649) [-1257.960] (-1252.907) (-1253.796) * (-1254.888) [-1256.328] (-1257.123) (-1252.791) -- 0:00:46
277500 -- (-1253.471) (-1257.374) (-1259.560) [-1253.920] * (-1256.849) [-1253.929] (-1255.393) (-1253.945) -- 0:00:46
278000 -- [-1252.883] (-1260.086) (-1256.646) (-1255.777) * [-1252.805] (-1255.409) (-1255.680) (-1257.701) -- 0:00:46
278500 -- [-1258.734] (-1256.205) (-1255.903) (-1254.077) * (-1255.634) (-1252.440) [-1252.771] (-1256.572) -- 0:00:46
279000 -- (-1258.733) (-1257.144) [-1254.875] (-1254.154) * (-1254.265) (-1252.819) (-1252.780) [-1255.373] -- 0:00:46
279500 -- (-1257.269) (-1255.580) (-1255.871) [-1254.445] * (-1256.013) (-1257.333) (-1254.607) [-1256.005] -- 0:00:46
280000 -- (-1254.732) [-1254.625] (-1254.866) (-1256.213) * (-1253.415) (-1258.774) (-1252.963) [-1253.348] -- 0:00:46
Average standard deviation of split frequencies: 0.013857
280500 -- [-1255.041] (-1256.602) (-1258.083) (-1253.957) * [-1253.167] (-1256.380) (-1253.315) (-1253.163) -- 0:00:46
281000 -- (-1254.336) (-1258.396) (-1253.289) [-1253.688] * (-1252.672) (-1254.602) [-1254.421] (-1258.207) -- 0:00:46
281500 -- (-1252.779) [-1252.968] (-1253.701) (-1256.095) * (-1254.845) [-1254.939] (-1253.650) (-1263.149) -- 0:00:45
282000 -- (-1256.456) [-1253.548] (-1254.441) (-1256.099) * (-1259.776) [-1253.956] (-1254.692) (-1256.529) -- 0:00:45
282500 -- [-1259.711] (-1255.444) (-1257.111) (-1257.225) * (-1256.117) (-1253.258) [-1253.299] (-1256.120) -- 0:00:45
283000 -- (-1255.450) (-1253.783) [-1254.936] (-1253.418) * (-1253.234) (-1254.596) [-1254.359] (-1256.347) -- 0:00:45
283500 -- (-1258.769) (-1252.637) (-1256.172) [-1253.038] * (-1254.326) [-1253.816] (-1258.029) (-1256.468) -- 0:00:45
284000 -- (-1255.472) (-1252.992) (-1256.816) [-1252.966] * (-1254.324) [-1254.371] (-1256.098) (-1257.544) -- 0:00:45
284500 -- (-1254.192) [-1254.456] (-1257.267) (-1253.410) * (-1255.452) [-1256.605] (-1255.115) (-1255.759) -- 0:00:45
285000 -- [-1257.579] (-1254.992) (-1256.838) (-1253.513) * (-1255.770) [-1256.040] (-1255.027) (-1254.507) -- 0:00:45
Average standard deviation of split frequencies: 0.014319
285500 -- (-1255.169) (-1253.402) [-1253.845] (-1254.189) * [-1256.824] (-1254.850) (-1256.616) (-1253.564) -- 0:00:45
286000 -- (-1255.406) [-1252.614] (-1253.090) (-1254.537) * (-1255.089) (-1254.300) [-1256.200] (-1254.300) -- 0:00:44
286500 -- (-1253.949) (-1255.469) (-1254.433) [-1255.484] * (-1254.927) (-1255.040) [-1261.052] (-1255.402) -- 0:00:44
287000 -- [-1255.577] (-1255.784) (-1254.573) (-1254.107) * [-1254.222] (-1257.824) (-1255.144) (-1254.886) -- 0:00:44
287500 -- (-1252.505) (-1255.354) (-1255.856) [-1255.861] * (-1255.781) (-1262.641) [-1255.129] (-1256.451) -- 0:00:44
288000 -- [-1252.958] (-1255.862) (-1252.689) (-1254.924) * (-1253.271) (-1263.216) (-1255.902) [-1256.561] -- 0:00:44
288500 -- [-1252.578] (-1254.073) (-1252.731) (-1253.405) * (-1253.192) (-1261.853) [-1253.273] (-1254.907) -- 0:00:44
289000 -- (-1252.656) (-1253.282) [-1255.504] (-1253.914) * [-1253.126] (-1256.049) (-1253.502) (-1253.979) -- 0:00:44
289500 -- [-1253.871] (-1253.299) (-1256.398) (-1257.689) * (-1252.848) (-1254.302) (-1254.323) [-1253.816] -- 0:00:44
290000 -- (-1255.799) [-1253.309] (-1257.219) (-1256.085) * [-1253.327] (-1254.749) (-1254.130) (-1255.815) -- 0:00:44
Average standard deviation of split frequencies: 0.014698
290500 -- (-1252.881) (-1254.064) [-1254.628] (-1256.082) * (-1253.735) (-1254.687) (-1255.037) [-1254.321] -- 0:00:46
291000 -- (-1255.038) (-1255.411) [-1257.663] (-1257.227) * (-1253.558) [-1252.967] (-1254.749) (-1254.501) -- 0:00:46
291500 -- (-1252.654) (-1255.149) [-1255.102] (-1257.223) * (-1255.594) (-1252.892) (-1252.923) [-1254.664] -- 0:00:46
292000 -- (-1252.677) [-1253.608] (-1254.706) (-1253.437) * (-1253.273) (-1254.651) [-1253.167] (-1255.353) -- 0:00:46
292500 -- (-1254.960) (-1256.619) [-1257.472] (-1254.336) * (-1253.225) (-1253.562) [-1254.121] (-1253.317) -- 0:00:45
293000 -- (-1258.114) (-1252.413) (-1254.125) [-1254.252] * (-1256.483) (-1252.666) [-1256.254] (-1253.483) -- 0:00:45
293500 -- (-1257.383) (-1252.421) [-1255.409] (-1254.972) * (-1254.964) (-1252.760) (-1253.224) [-1253.475] -- 0:00:45
294000 -- (-1255.564) (-1253.008) [-1254.130] (-1254.576) * (-1253.396) [-1252.438] (-1255.128) (-1254.284) -- 0:00:45
294500 -- [-1254.512] (-1253.287) (-1253.149) (-1256.154) * (-1253.748) [-1252.470] (-1255.660) (-1254.858) -- 0:00:45
295000 -- [-1255.233] (-1252.944) (-1256.404) (-1259.012) * (-1255.329) [-1255.105] (-1260.240) (-1253.653) -- 0:00:45
Average standard deviation of split frequencies: 0.015627
295500 -- (-1253.958) [-1252.885] (-1257.283) (-1254.284) * (-1255.754) [-1254.875] (-1263.439) (-1254.278) -- 0:00:45
296000 -- (-1253.253) (-1254.044) (-1254.249) [-1255.087] * [-1253.235] (-1253.058) (-1257.731) (-1256.511) -- 0:00:45
296500 -- (-1255.319) [-1253.952] (-1257.028) (-1255.571) * (-1253.162) [-1253.774] (-1253.572) (-1256.471) -- 0:00:45
297000 -- (-1257.145) [-1254.779] (-1255.838) (-1255.172) * (-1259.215) [-1252.642] (-1257.241) (-1254.020) -- 0:00:44
297500 -- [-1254.949] (-1255.608) (-1255.658) (-1256.859) * (-1257.911) [-1252.872] (-1253.928) (-1257.510) -- 0:00:44
298000 -- (-1254.453) (-1257.946) [-1259.660] (-1256.643) * (-1255.839) [-1252.408] (-1253.410) (-1255.224) -- 0:00:44
298500 -- (-1255.114) (-1254.351) [-1253.299] (-1257.127) * (-1259.201) [-1252.369] (-1254.625) (-1258.208) -- 0:00:44
299000 -- (-1255.852) (-1253.885) (-1255.155) [-1252.920] * (-1253.471) (-1253.663) [-1257.661] (-1257.581) -- 0:00:44
299500 -- (-1258.901) (-1254.412) (-1254.374) [-1253.463] * (-1253.429) [-1256.306] (-1257.920) (-1256.011) -- 0:00:44
300000 -- (-1257.123) (-1255.535) [-1254.113] (-1254.613) * (-1252.419) (-1254.251) [-1254.503] (-1261.992) -- 0:00:44
Average standard deviation of split frequencies: 0.016071
300500 -- [-1252.573] (-1253.586) (-1255.637) (-1253.673) * (-1253.203) [-1254.084] (-1253.970) (-1255.574) -- 0:00:44
301000 -- (-1253.506) (-1253.803) [-1252.627] (-1254.641) * (-1254.441) (-1252.759) (-1254.164) [-1253.349] -- 0:00:44
301500 -- (-1253.561) (-1254.556) [-1252.585] (-1253.879) * [-1255.307] (-1253.962) (-1254.275) (-1256.870) -- 0:00:44
302000 -- (-1254.271) (-1252.731) (-1257.082) [-1254.076] * (-1257.074) (-1254.629) [-1256.482] (-1254.463) -- 0:00:43
302500 -- (-1253.452) (-1253.313) [-1255.734] (-1253.333) * [-1253.874] (-1254.348) (-1253.967) (-1254.084) -- 0:00:43
303000 -- (-1257.809) [-1253.085] (-1257.139) (-1253.388) * (-1253.062) (-1258.347) (-1253.604) [-1253.618] -- 0:00:43
303500 -- (-1257.765) [-1254.309] (-1254.475) (-1253.389) * (-1254.842) [-1254.123] (-1256.949) (-1257.003) -- 0:00:43
304000 -- (-1253.140) (-1254.594) (-1256.022) [-1252.944] * (-1253.736) [-1254.819] (-1253.857) (-1256.385) -- 0:00:43
304500 -- (-1254.155) [-1254.804] (-1254.618) (-1254.572) * (-1255.291) (-1254.212) [-1258.860] (-1256.222) -- 0:00:43
305000 -- (-1253.591) (-1254.265) [-1254.808] (-1255.211) * (-1255.926) [-1255.071] (-1256.556) (-1254.284) -- 0:00:43
Average standard deviation of split frequencies: 0.014731
305500 -- (-1256.285) [-1253.712] (-1254.745) (-1260.120) * [-1254.712] (-1255.457) (-1255.081) (-1255.030) -- 0:00:43
306000 -- (-1255.936) (-1258.030) [-1254.666] (-1256.596) * (-1255.993) (-1255.288) (-1254.001) [-1253.050] -- 0:00:43
306500 -- (-1256.762) (-1254.432) [-1253.208] (-1254.189) * (-1254.225) (-1254.817) (-1254.985) [-1252.935] -- 0:00:45
307000 -- (-1253.593) (-1254.572) (-1253.183) [-1254.500] * (-1253.419) [-1253.321] (-1257.155) (-1252.931) -- 0:00:45
307500 -- [-1253.389] (-1253.931) (-1260.251) (-1253.063) * (-1254.543) (-1253.130) [-1255.570] (-1254.488) -- 0:00:45
308000 -- (-1253.141) (-1253.793) [-1256.727] (-1253.393) * (-1254.084) (-1253.205) (-1253.677) [-1252.915] -- 0:00:44
308500 -- (-1257.354) [-1254.109] (-1255.797) (-1252.929) * (-1253.953) [-1254.140] (-1258.591) (-1259.612) -- 0:00:44
309000 -- (-1253.632) (-1254.702) (-1257.471) [-1253.604] * (-1254.700) (-1256.092) (-1254.442) [-1256.861] -- 0:00:44
309500 -- (-1253.646) (-1254.220) [-1254.825] (-1254.228) * [-1253.031] (-1254.024) (-1253.043) (-1257.038) -- 0:00:44
310000 -- (-1254.233) (-1255.804) [-1254.234] (-1255.360) * [-1254.466] (-1253.342) (-1257.270) (-1258.575) -- 0:00:44
Average standard deviation of split frequencies: 0.014795
310500 -- (-1253.690) (-1258.725) (-1259.151) [-1257.592] * (-1255.512) [-1253.820] (-1254.035) (-1253.533) -- 0:00:44
311000 -- (-1252.474) (-1253.553) [-1253.868] (-1259.616) * (-1253.857) [-1253.968] (-1255.386) (-1253.372) -- 0:00:44
311500 -- (-1253.500) (-1255.335) [-1254.294] (-1258.045) * (-1254.140) (-1253.052) [-1253.164] (-1255.087) -- 0:00:44
312000 -- (-1253.494) [-1253.328] (-1254.639) (-1257.096) * (-1254.140) [-1255.390] (-1253.046) (-1254.281) -- 0:00:44
312500 -- (-1259.872) (-1258.907) (-1256.086) [-1257.218] * [-1254.406] (-1253.673) (-1253.839) (-1255.085) -- 0:00:44
313000 -- [-1255.494] (-1255.100) (-1255.806) (-1256.707) * [-1254.445] (-1254.858) (-1252.688) (-1253.638) -- 0:00:43
313500 -- (-1256.659) (-1254.873) [-1255.295] (-1259.099) * (-1252.600) (-1255.241) (-1255.050) [-1255.396] -- 0:00:43
314000 -- (-1253.022) (-1254.740) [-1255.618] (-1254.579) * (-1254.843) [-1255.490] (-1254.635) (-1254.306) -- 0:00:43
314500 -- (-1253.015) (-1253.366) [-1255.845] (-1254.963) * [-1253.384] (-1255.567) (-1255.916) (-1252.771) -- 0:00:43
315000 -- (-1254.645) [-1253.306] (-1255.194) (-1256.442) * (-1256.129) (-1255.162) (-1254.685) [-1255.355] -- 0:00:43
Average standard deviation of split frequencies: 0.014391
315500 -- [-1253.527] (-1253.719) (-1258.541) (-1256.591) * (-1253.196) (-1254.209) [-1254.864] (-1257.449) -- 0:00:43
316000 -- (-1257.880) (-1253.497) [-1253.686] (-1254.473) * (-1256.819) (-1254.722) [-1255.248] (-1258.807) -- 0:00:43
316500 -- [-1255.332] (-1252.277) (-1253.253) (-1256.195) * [-1257.925] (-1255.699) (-1255.319) (-1255.300) -- 0:00:43
317000 -- [-1256.358] (-1253.528) (-1254.736) (-1257.809) * (-1257.275) (-1253.474) [-1255.602] (-1255.965) -- 0:00:43
317500 -- (-1253.302) [-1253.152] (-1253.471) (-1254.645) * (-1255.141) [-1255.301] (-1255.198) (-1253.046) -- 0:00:42
318000 -- (-1254.124) (-1253.865) [-1252.446] (-1257.222) * [-1253.061] (-1253.936) (-1254.056) (-1255.619) -- 0:00:42
318500 -- (-1258.038) [-1254.880] (-1252.983) (-1256.220) * (-1254.042) [-1254.218] (-1252.625) (-1255.646) -- 0:00:42
319000 -- (-1258.701) (-1254.778) [-1253.127] (-1254.622) * (-1255.598) [-1254.075] (-1256.559) (-1253.772) -- 0:00:42
319500 -- (-1256.276) (-1255.606) (-1254.055) [-1255.699] * (-1254.447) [-1256.685] (-1256.804) (-1252.469) -- 0:00:42
320000 -- (-1254.894) (-1255.652) (-1253.108) [-1253.136] * (-1254.060) [-1255.127] (-1253.587) (-1252.496) -- 0:00:42
Average standard deviation of split frequencies: 0.014149
320500 -- (-1255.243) (-1252.983) [-1253.128] (-1253.615) * (-1254.031) (-1255.590) [-1253.402] (-1254.766) -- 0:00:42
321000 -- (-1255.212) (-1253.202) [-1254.303] (-1254.739) * [-1255.213] (-1254.059) (-1257.569) (-1255.454) -- 0:00:42
321500 -- (-1256.126) (-1255.040) [-1254.106] (-1255.871) * (-1254.065) [-1258.975] (-1256.653) (-1254.313) -- 0:00:42
322000 -- (-1259.367) [-1255.850] (-1254.602) (-1258.307) * (-1253.132) (-1258.798) [-1254.768] (-1254.875) -- 0:00:42
322500 -- (-1255.985) [-1254.245] (-1254.266) (-1261.620) * (-1256.621) (-1256.721) (-1253.722) [-1253.775] -- 0:00:44
323000 -- [-1253.411] (-1256.622) (-1255.280) (-1255.995) * [-1252.754] (-1255.678) (-1256.347) (-1255.082) -- 0:00:44
323500 -- (-1256.151) (-1255.387) [-1254.148] (-1256.295) * [-1252.778] (-1256.832) (-1254.628) (-1257.195) -- 0:00:43
324000 -- (-1258.648) (-1255.456) (-1255.801) [-1254.621] * (-1252.801) (-1253.238) (-1253.641) [-1256.182] -- 0:00:43
324500 -- (-1257.130) (-1256.151) (-1256.489) [-1253.970] * (-1253.851) (-1252.503) (-1253.872) [-1253.898] -- 0:00:43
325000 -- (-1253.379) (-1254.893) [-1259.449] (-1256.176) * [-1253.577] (-1254.018) (-1252.893) (-1254.453) -- 0:00:43
Average standard deviation of split frequencies: 0.014370
325500 -- [-1253.827] (-1253.408) (-1261.280) (-1253.647) * (-1253.631) [-1254.521] (-1254.079) (-1254.809) -- 0:00:43
326000 -- (-1256.633) (-1253.854) (-1256.154) [-1254.210] * (-1253.790) (-1255.333) (-1253.331) [-1254.761] -- 0:00:43
326500 -- [-1259.918] (-1256.888) (-1255.204) (-1256.418) * (-1256.949) (-1256.984) (-1253.556) [-1253.544] -- 0:00:43
327000 -- (-1256.988) (-1256.523) (-1255.388) [-1253.757] * [-1252.572] (-1255.064) (-1253.108) (-1257.231) -- 0:00:43
327500 -- (-1254.760) [-1257.651] (-1256.662) (-1253.835) * (-1255.448) [-1259.772] (-1253.236) (-1254.979) -- 0:00:43
328000 -- (-1257.697) [-1255.109] (-1254.116) (-1254.177) * (-1253.424) (-1256.379) [-1253.239] (-1254.186) -- 0:00:43
328500 -- (-1255.609) (-1254.697) (-1256.906) [-1254.420] * (-1256.782) (-1256.299) [-1252.461] (-1253.366) -- 0:00:42
329000 -- (-1256.779) [-1253.988] (-1256.958) (-1256.168) * (-1253.076) [-1257.569] (-1253.366) (-1254.763) -- 0:00:42
329500 -- (-1257.614) [-1256.446] (-1255.986) (-1255.997) * (-1253.484) (-1254.351) (-1254.317) [-1255.002] -- 0:00:42
330000 -- (-1253.108) (-1256.442) [-1254.790] (-1255.314) * [-1252.949] (-1253.287) (-1257.079) (-1255.741) -- 0:00:42
Average standard deviation of split frequencies: 0.014791
330500 -- [-1252.398] (-1256.376) (-1254.554) (-1256.409) * (-1253.624) (-1253.595) [-1252.812] (-1254.314) -- 0:00:42
331000 -- (-1255.330) [-1255.087] (-1256.469) (-1253.658) * (-1257.793) (-1253.660) [-1254.998] (-1253.117) -- 0:00:42
331500 -- (-1253.547) [-1253.494] (-1253.712) (-1253.658) * (-1256.497) [-1256.861] (-1255.329) (-1255.021) -- 0:00:42
332000 -- [-1253.442] (-1253.116) (-1253.423) (-1253.695) * (-1257.637) (-1255.628) [-1253.971] (-1254.366) -- 0:00:42
332500 -- (-1253.511) [-1252.515] (-1253.414) (-1253.876) * [-1254.821] (-1254.554) (-1254.884) (-1255.014) -- 0:00:42
333000 -- (-1253.894) [-1252.554] (-1253.203) (-1257.290) * [-1254.945] (-1253.563) (-1257.181) (-1252.897) -- 0:00:42
333500 -- [-1253.896] (-1257.448) (-1254.587) (-1253.999) * (-1255.000) (-1253.563) (-1254.506) [-1252.847] -- 0:00:41
334000 -- (-1257.101) [-1255.071] (-1254.992) (-1254.067) * [-1255.343] (-1253.709) (-1256.890) (-1257.021) -- 0:00:41
334500 -- (-1254.045) (-1253.351) [-1254.918] (-1254.145) * [-1255.766] (-1257.499) (-1255.979) (-1254.334) -- 0:00:41
335000 -- (-1252.924) (-1253.243) [-1254.125] (-1254.325) * (-1255.329) (-1256.735) (-1256.996) [-1255.131] -- 0:00:41
Average standard deviation of split frequencies: 0.015170
335500 -- [-1252.925] (-1254.574) (-1257.569) (-1253.021) * (-1255.676) (-1256.170) (-1253.162) [-1254.463] -- 0:00:41
336000 -- (-1255.437) [-1254.272] (-1258.657) (-1253.002) * (-1255.950) (-1254.674) (-1254.884) [-1252.738] -- 0:00:41
336500 -- (-1258.772) [-1253.624] (-1256.436) (-1253.842) * (-1254.605) [-1256.929] (-1253.910) (-1253.223) -- 0:00:41
337000 -- [-1258.698] (-1254.505) (-1259.283) (-1253.322) * (-1255.521) (-1254.774) [-1253.778] (-1255.813) -- 0:00:41
337500 -- (-1265.328) [-1257.496] (-1256.281) (-1253.193) * (-1254.260) (-1255.995) [-1255.293] (-1257.544) -- 0:00:41
338000 -- (-1261.130) (-1255.323) (-1253.920) [-1253.674] * (-1256.819) (-1258.482) [-1256.348] (-1262.757) -- 0:00:43
338500 -- (-1253.878) [-1254.453] (-1257.216) (-1257.170) * (-1254.152) [-1255.238] (-1252.966) (-1261.744) -- 0:00:42
339000 -- [-1255.458] (-1259.936) (-1255.017) (-1255.746) * [-1253.869] (-1253.886) (-1252.486) (-1254.335) -- 0:00:42
339500 -- (-1254.101) [-1260.824] (-1254.394) (-1255.780) * (-1253.747) (-1254.320) (-1255.403) [-1252.566] -- 0:00:42
340000 -- [-1254.783] (-1255.580) (-1254.743) (-1253.407) * (-1254.221) [-1255.155] (-1255.310) (-1254.880) -- 0:00:42
Average standard deviation of split frequencies: 0.016173
340500 -- [-1253.026] (-1255.862) (-1253.679) (-1254.163) * (-1255.639) (-1253.028) (-1258.117) [-1254.149] -- 0:00:42
341000 -- (-1252.988) [-1252.642] (-1256.416) (-1257.144) * (-1255.339) [-1254.789] (-1255.672) (-1254.627) -- 0:00:42
341500 -- [-1253.144] (-1253.146) (-1257.342) (-1256.845) * [-1252.782] (-1256.210) (-1256.560) (-1254.076) -- 0:00:42
342000 -- [-1253.338] (-1254.279) (-1255.988) (-1259.034) * (-1256.191) [-1255.700] (-1256.334) (-1258.858) -- 0:00:42
342500 -- [-1253.366] (-1255.907) (-1257.198) (-1264.769) * (-1257.022) [-1254.364] (-1258.416) (-1254.603) -- 0:00:42
343000 -- (-1253.932) (-1255.071) [-1253.891] (-1256.670) * [-1253.776] (-1255.420) (-1256.228) (-1253.845) -- 0:00:42
343500 -- (-1253.404) (-1252.796) (-1253.366) [-1252.831] * (-1253.214) (-1253.189) (-1254.050) [-1254.273] -- 0:00:42
344000 -- (-1253.390) [-1254.098] (-1253.464) (-1254.291) * (-1255.713) (-1261.093) (-1253.027) [-1253.977] -- 0:00:41
344500 -- [-1253.770] (-1255.534) (-1254.170) (-1257.195) * (-1258.007) [-1253.781] (-1254.781) (-1252.771) -- 0:00:41
345000 -- (-1253.814) (-1257.104) (-1252.939) [-1254.688] * (-1253.834) [-1258.249] (-1253.196) (-1254.503) -- 0:00:41
Average standard deviation of split frequencies: 0.015668
345500 -- (-1253.007) (-1255.052) (-1252.598) [-1255.395] * [-1253.593] (-1261.836) (-1254.460) (-1252.587) -- 0:00:41
346000 -- (-1254.580) [-1256.268] (-1258.645) (-1256.524) * (-1258.821) [-1255.549] (-1256.293) (-1252.587) -- 0:00:41
346500 -- [-1252.923] (-1254.149) (-1258.202) (-1259.454) * (-1253.978) [-1256.274] (-1254.935) (-1252.751) -- 0:00:41
347000 -- [-1253.590] (-1253.555) (-1258.767) (-1255.547) * [-1253.090] (-1256.564) (-1254.989) (-1254.929) -- 0:00:41
347500 -- [-1252.743] (-1252.931) (-1253.664) (-1255.430) * (-1254.597) [-1253.751] (-1255.470) (-1255.846) -- 0:00:41
348000 -- (-1253.196) (-1255.860) [-1253.317] (-1253.824) * (-1253.671) (-1256.703) (-1254.321) [-1252.752] -- 0:00:41
348500 -- (-1253.006) (-1252.819) (-1255.348) [-1252.303] * [-1254.139] (-1253.471) (-1254.919) (-1252.669) -- 0:00:41
349000 -- (-1253.072) (-1254.609) [-1260.441] (-1252.996) * [-1252.450] (-1253.095) (-1254.749) (-1253.427) -- 0:00:41
349500 -- [-1253.104] (-1254.473) (-1254.670) (-1253.700) * (-1254.567) [-1255.569] (-1254.801) (-1254.060) -- 0:00:40
350000 -- (-1253.838) (-1254.887) [-1256.506] (-1258.207) * [-1254.256] (-1254.236) (-1255.531) (-1257.217) -- 0:00:40
Average standard deviation of split frequencies: 0.014703
350500 -- (-1253.527) [-1253.739] (-1256.767) (-1258.485) * (-1254.182) (-1252.850) (-1259.445) [-1256.900] -- 0:00:40
351000 -- (-1252.712) [-1254.917] (-1257.757) (-1260.192) * [-1253.750] (-1252.415) (-1256.183) (-1252.767) -- 0:00:40
351500 -- [-1254.480] (-1254.372) (-1258.128) (-1253.969) * (-1253.681) (-1252.660) [-1255.691] (-1253.962) -- 0:00:40
352000 -- (-1254.470) (-1256.000) [-1254.761] (-1254.891) * (-1255.969) (-1253.321) (-1254.612) [-1255.346] -- 0:00:40
352500 -- (-1254.114) (-1257.043) [-1252.731] (-1256.140) * (-1255.243) (-1253.279) [-1254.254] (-1254.870) -- 0:00:40
353000 -- (-1253.857) (-1254.866) (-1252.307) [-1256.664] * (-1254.400) [-1252.380] (-1256.966) (-1258.425) -- 0:00:40
353500 -- (-1253.917) [-1255.621] (-1252.302) (-1254.599) * (-1252.686) (-1252.760) (-1252.820) [-1255.589] -- 0:00:42
354000 -- [-1254.834] (-1252.623) (-1252.378) (-1254.575) * (-1253.991) (-1257.539) (-1253.575) [-1253.851] -- 0:00:41
354500 -- [-1254.572] (-1254.296) (-1252.601) (-1253.462) * [-1254.691] (-1257.020) (-1255.000) (-1254.874) -- 0:00:41
355000 -- (-1253.032) (-1255.685) [-1252.563] (-1253.709) * (-1252.434) (-1255.216) (-1257.938) [-1253.351] -- 0:00:41
Average standard deviation of split frequencies: 0.013904
355500 -- [-1253.618] (-1258.246) (-1253.851) (-1256.290) * (-1252.572) (-1256.649) (-1253.781) [-1253.761] -- 0:00:41
356000 -- (-1255.671) (-1256.436) [-1254.805] (-1253.740) * (-1252.901) (-1252.545) [-1253.859] (-1255.992) -- 0:00:41
356500 -- (-1259.562) [-1254.224] (-1255.863) (-1255.118) * (-1257.921) [-1255.256] (-1253.127) (-1252.483) -- 0:00:41
357000 -- [-1256.256] (-1253.982) (-1253.776) (-1258.298) * (-1253.228) [-1256.016] (-1253.344) (-1253.379) -- 0:00:41
357500 -- (-1255.680) (-1252.423) (-1253.454) [-1256.367] * (-1253.207) (-1253.600) [-1254.545] (-1252.709) -- 0:00:41
358000 -- (-1255.746) [-1252.407] (-1254.528) (-1259.355) * (-1253.388) [-1256.803] (-1254.353) (-1255.208) -- 0:00:41
358500 -- (-1253.387) (-1252.585) (-1255.423) [-1256.142] * (-1252.698) (-1254.344) [-1252.650] (-1257.790) -- 0:00:41
359000 -- (-1254.194) [-1254.183] (-1255.194) (-1255.124) * (-1253.364) (-1253.483) [-1252.501] (-1255.979) -- 0:00:41
359500 -- [-1255.207] (-1255.279) (-1254.507) (-1255.011) * [-1253.278] (-1253.537) (-1256.160) (-1254.031) -- 0:00:40
360000 -- (-1255.137) (-1256.726) [-1253.427] (-1257.837) * (-1252.786) [-1252.918] (-1253.966) (-1253.323) -- 0:00:40
Average standard deviation of split frequencies: 0.014459
360500 -- (-1257.952) (-1253.995) (-1255.086) [-1254.755] * (-1259.472) (-1252.934) [-1254.606] (-1255.977) -- 0:00:40
361000 -- (-1254.108) (-1252.921) [-1254.131] (-1255.736) * (-1253.190) (-1253.950) (-1253.239) [-1254.177] -- 0:00:40
361500 -- (-1253.260) [-1255.864] (-1254.388) (-1253.658) * [-1253.271] (-1254.514) (-1253.991) (-1254.177) -- 0:00:40
362000 -- (-1253.457) (-1252.717) (-1253.491) [-1253.404] * (-1252.950) (-1254.872) (-1253.879) [-1254.327] -- 0:00:40
362500 -- (-1255.341) (-1257.690) [-1253.838] (-1254.139) * (-1258.996) (-1254.866) [-1252.670] (-1255.025) -- 0:00:40
363000 -- (-1256.510) (-1259.634) [-1254.080] (-1253.688) * [-1253.206] (-1255.463) (-1252.669) (-1254.874) -- 0:00:40
363500 -- [-1254.767] (-1257.264) (-1256.280) (-1254.027) * (-1253.326) (-1253.674) (-1253.493) [-1253.706] -- 0:00:40
364000 -- [-1253.153] (-1255.529) (-1253.440) (-1253.974) * [-1253.899] (-1256.836) (-1254.851) (-1257.410) -- 0:00:40
364500 -- [-1252.720] (-1256.518) (-1253.786) (-1252.484) * (-1254.788) [-1253.655] (-1252.852) (-1254.242) -- 0:00:40
365000 -- [-1254.482] (-1254.803) (-1255.653) (-1252.802) * (-1255.693) (-1255.657) (-1252.312) [-1254.993] -- 0:00:40
Average standard deviation of split frequencies: 0.015134
365500 -- (-1255.181) (-1256.615) (-1255.156) [-1254.801] * (-1253.834) [-1254.254] (-1255.650) (-1253.712) -- 0:00:39
366000 -- (-1254.606) (-1258.034) (-1254.136) [-1254.090] * (-1253.170) (-1253.377) [-1254.167] (-1254.043) -- 0:00:39
366500 -- (-1256.093) (-1257.062) [-1252.458] (-1256.277) * (-1254.070) (-1253.096) (-1252.750) [-1254.090] -- 0:00:39
367000 -- [-1252.941] (-1257.041) (-1252.703) (-1254.628) * (-1253.662) (-1254.700) (-1252.775) [-1253.434] -- 0:00:39
367500 -- [-1255.712] (-1259.911) (-1253.521) (-1257.597) * (-1256.087) [-1254.360] (-1252.520) (-1255.101) -- 0:00:39
368000 -- [-1254.182] (-1260.373) (-1254.322) (-1257.747) * [-1253.395] (-1253.155) (-1253.437) (-1255.352) -- 0:00:39
368500 -- (-1253.430) (-1253.060) [-1253.873] (-1254.971) * (-1253.985) [-1253.455] (-1254.916) (-1255.286) -- 0:00:41
369000 -- [-1256.370] (-1258.651) (-1254.116) (-1255.972) * (-1254.616) [-1253.939] (-1254.418) (-1257.155) -- 0:00:41
369500 -- [-1255.236] (-1254.985) (-1257.002) (-1254.283) * (-1253.663) [-1254.363] (-1254.410) (-1253.319) -- 0:00:40
370000 -- (-1256.704) (-1260.454) (-1254.575) [-1256.188] * (-1252.548) [-1256.092] (-1255.479) (-1253.645) -- 0:00:40
Average standard deviation of split frequencies: 0.013831
370500 -- (-1254.276) (-1254.075) (-1254.915) [-1254.367] * (-1257.434) (-1253.509) [-1254.278] (-1252.773) -- 0:00:40
371000 -- (-1253.710) [-1253.174] (-1259.014) (-1253.453) * (-1258.158) (-1256.852) [-1253.803] (-1254.028) -- 0:00:40
371500 -- (-1254.490) [-1254.034] (-1256.595) (-1253.780) * (-1254.501) [-1257.510] (-1255.703) (-1255.271) -- 0:00:40
372000 -- (-1253.127) [-1255.744] (-1255.604) (-1254.778) * [-1253.700] (-1253.708) (-1253.427) (-1255.841) -- 0:00:40
372500 -- [-1253.794] (-1253.549) (-1254.638) (-1256.852) * (-1254.124) [-1254.548] (-1253.095) (-1260.154) -- 0:00:40
373000 -- (-1254.079) (-1254.937) [-1256.410] (-1256.995) * (-1255.300) [-1254.719] (-1255.347) (-1255.011) -- 0:00:40
373500 -- (-1254.027) (-1252.757) [-1254.711] (-1256.854) * [-1255.457] (-1254.969) (-1252.794) (-1253.927) -- 0:00:40
374000 -- (-1253.379) (-1252.797) [-1253.268] (-1257.842) * (-1253.230) (-1254.463) (-1254.021) [-1253.178] -- 0:00:40
374500 -- [-1254.348] (-1255.650) (-1253.299) (-1254.881) * (-1255.757) (-1257.183) (-1253.698) [-1254.237] -- 0:00:40
375000 -- (-1256.790) (-1254.596) [-1255.018] (-1256.319) * (-1253.324) [-1252.680] (-1253.641) (-1254.966) -- 0:00:40
Average standard deviation of split frequencies: 0.015192
375500 -- (-1254.744) (-1259.167) (-1253.864) [-1253.312] * (-1252.716) (-1253.376) (-1255.335) [-1253.749] -- 0:00:39
376000 -- (-1254.211) (-1255.565) (-1255.522) [-1255.246] * (-1257.261) [-1254.176] (-1254.684) (-1253.511) -- 0:00:39
376500 -- (-1253.989) (-1253.561) (-1256.107) [-1253.011] * [-1254.059] (-1254.614) (-1252.867) (-1253.011) -- 0:00:39
377000 -- (-1254.589) (-1257.005) (-1256.950) [-1253.982] * [-1254.229] (-1254.091) (-1253.629) (-1252.262) -- 0:00:39
377500 -- (-1257.613) (-1253.671) (-1258.462) [-1253.824] * (-1253.342) (-1254.855) (-1254.601) [-1253.841] -- 0:00:39
378000 -- [-1256.036] (-1253.635) (-1254.295) (-1255.094) * [-1254.205] (-1254.597) (-1256.065) (-1254.535) -- 0:00:39
378500 -- [-1254.679] (-1254.535) (-1254.269) (-1253.183) * (-1254.791) [-1253.359] (-1257.310) (-1253.190) -- 0:00:39
379000 -- [-1254.312] (-1255.425) (-1255.661) (-1254.296) * (-1252.970) [-1252.972] (-1256.699) (-1254.755) -- 0:00:39
379500 -- [-1253.711] (-1252.560) (-1252.345) (-1254.313) * (-1252.972) (-1252.588) (-1258.090) [-1254.588] -- 0:00:39
380000 -- (-1254.100) (-1257.546) [-1252.467] (-1255.203) * (-1252.603) (-1252.559) [-1256.367] (-1256.009) -- 0:00:39
Average standard deviation of split frequencies: 0.015712
380500 -- (-1256.047) (-1256.816) (-1252.887) [-1253.385] * (-1253.657) [-1252.939] (-1253.288) (-1256.733) -- 0:00:39
381000 -- [-1253.720] (-1255.917) (-1253.904) (-1257.432) * (-1255.080) [-1255.917] (-1253.547) (-1253.363) -- 0:00:38
381500 -- [-1254.998] (-1252.620) (-1254.076) (-1253.928) * [-1253.493] (-1255.712) (-1254.806) (-1253.361) -- 0:00:38
382000 -- (-1256.383) (-1256.574) [-1253.184] (-1252.985) * (-1258.478) (-1255.147) [-1255.022] (-1255.010) -- 0:00:38
382500 -- [-1253.737] (-1258.143) (-1255.897) (-1256.674) * (-1257.648) (-1253.900) [-1253.185] (-1257.016) -- 0:00:38
383000 -- (-1252.689) [-1253.745] (-1253.355) (-1252.835) * [-1253.658] (-1254.138) (-1253.603) (-1253.363) -- 0:00:38
383500 -- (-1254.602) [-1255.396] (-1254.087) (-1254.936) * (-1253.128) (-1253.813) (-1254.253) [-1253.360] -- 0:00:38
384000 -- (-1256.244) (-1254.507) (-1253.717) [-1253.728] * (-1253.950) (-1253.739) [-1253.989] (-1255.468) -- 0:00:40
384500 -- (-1253.429) (-1259.032) (-1255.844) [-1252.954] * (-1255.721) [-1253.721] (-1257.614) (-1254.484) -- 0:00:40
385000 -- (-1255.760) [-1254.183] (-1252.559) (-1254.567) * (-1252.893) (-1260.481) [-1260.894] (-1255.853) -- 0:00:39
Average standard deviation of split frequencies: 0.014727
385500 -- [-1254.382] (-1257.465) (-1252.770) (-1254.410) * (-1253.765) [-1253.869] (-1257.368) (-1257.732) -- 0:00:39
386000 -- [-1253.359] (-1260.485) (-1255.662) (-1253.174) * (-1255.283) [-1253.344] (-1255.395) (-1255.074) -- 0:00:39
386500 -- (-1253.870) (-1252.847) [-1255.602] (-1254.984) * (-1255.089) (-1254.004) (-1254.889) [-1255.658] -- 0:00:39
387000 -- (-1257.558) (-1252.322) (-1255.749) [-1252.830] * (-1255.493) (-1253.151) [-1254.623] (-1255.346) -- 0:00:39
387500 -- (-1254.991) (-1258.035) [-1252.944] (-1252.404) * (-1254.054) (-1255.589) (-1255.156) [-1253.940] -- 0:00:39
388000 -- (-1254.085) (-1255.366) (-1254.016) [-1253.563] * (-1255.395) [-1253.143] (-1255.155) (-1255.247) -- 0:00:39
388500 -- (-1255.834) (-1253.852) [-1254.056] (-1253.880) * [-1255.796] (-1254.529) (-1253.821) (-1257.357) -- 0:00:39
389000 -- [-1253.551] (-1253.541) (-1253.728) (-1252.694) * (-1254.726) [-1253.335] (-1256.847) (-1256.817) -- 0:00:39
389500 -- (-1252.899) (-1253.358) (-1255.656) [-1254.619] * (-1254.347) (-1254.264) (-1254.815) [-1252.965] -- 0:00:39
390000 -- [-1255.908] (-1253.188) (-1255.999) (-1253.517) * (-1254.345) (-1254.578) [-1256.087] (-1257.549) -- 0:00:39
Average standard deviation of split frequencies: 0.015048
390500 -- (-1261.582) (-1253.176) [-1253.494] (-1254.424) * (-1255.419) (-1255.136) [-1255.105] (-1255.674) -- 0:00:39
391000 -- (-1254.690) (-1254.682) [-1253.550] (-1254.509) * [-1256.672] (-1253.228) (-1259.021) (-1256.505) -- 0:00:38
391500 -- (-1255.249) (-1253.792) [-1252.872] (-1256.776) * (-1255.320) (-1254.235) [-1255.789] (-1254.889) -- 0:00:38
392000 -- (-1256.764) [-1253.695] (-1253.721) (-1253.705) * (-1256.240) [-1253.621] (-1253.649) (-1255.118) -- 0:00:38
392500 -- (-1254.593) (-1254.312) [-1252.787] (-1253.851) * (-1254.615) [-1254.034] (-1252.390) (-1255.035) -- 0:00:38
393000 -- (-1254.426) (-1255.936) [-1252.696] (-1253.548) * (-1254.921) [-1256.350] (-1253.235) (-1256.349) -- 0:00:38
393500 -- (-1256.580) (-1255.200) [-1253.514] (-1254.170) * (-1255.199) (-1256.382) [-1253.135] (-1254.703) -- 0:00:38
394000 -- (-1256.525) [-1252.823] (-1253.559) (-1254.595) * [-1257.947] (-1256.963) (-1253.743) (-1254.389) -- 0:00:38
394500 -- (-1254.370) (-1254.052) [-1253.873] (-1255.225) * (-1254.061) [-1257.333] (-1255.041) (-1255.307) -- 0:00:38
395000 -- (-1253.538) (-1253.990) (-1254.888) [-1253.293] * (-1254.210) [-1254.047] (-1254.953) (-1254.307) -- 0:00:38
Average standard deviation of split frequencies: 0.015699
395500 -- (-1255.657) (-1261.648) [-1255.419] (-1252.686) * [-1253.678] (-1254.051) (-1256.203) (-1254.299) -- 0:00:38
396000 -- (-1255.892) (-1256.724) [-1257.318] (-1252.683) * [-1255.924] (-1253.097) (-1254.998) (-1255.639) -- 0:00:38
396500 -- (-1256.097) [-1255.773] (-1257.358) (-1253.537) * (-1253.649) (-1254.683) (-1253.549) [-1254.821] -- 0:00:38
397000 -- (-1255.165) (-1252.832) [-1253.172] (-1254.191) * (-1253.987) (-1253.557) (-1255.206) [-1261.417] -- 0:00:37
397500 -- [-1253.359] (-1253.343) (-1253.012) (-1252.876) * (-1253.619) (-1253.446) (-1253.550) [-1261.296] -- 0:00:37
398000 -- (-1253.334) [-1253.298] (-1254.660) (-1253.788) * (-1253.187) [-1253.691] (-1255.067) (-1253.338) -- 0:00:39
398500 -- (-1254.110) (-1254.737) (-1253.449) [-1253.765] * [-1253.514] (-1254.370) (-1253.748) (-1256.078) -- 0:00:39
399000 -- (-1255.291) [-1254.475] (-1255.833) (-1255.538) * (-1257.174) (-1257.151) (-1255.846) [-1256.312] -- 0:00:39
399500 -- [-1254.481] (-1254.497) (-1253.730) (-1256.557) * (-1256.731) (-1257.530) [-1254.172] (-1255.491) -- 0:00:39
400000 -- (-1254.579) (-1254.080) [-1259.219] (-1253.456) * [-1257.390] (-1252.841) (-1259.127) (-1259.018) -- 0:00:39
Average standard deviation of split frequencies: 0.014633
400500 -- (-1254.848) (-1254.205) [-1253.646] (-1253.297) * (-1255.637) (-1255.852) (-1256.151) [-1252.958] -- 0:00:38
401000 -- [-1252.452] (-1256.771) (-1253.857) (-1253.795) * (-1255.549) (-1253.434) [-1254.352] (-1253.081) -- 0:00:38
401500 -- (-1254.478) (-1254.961) (-1256.763) [-1259.959] * (-1259.598) (-1253.479) (-1261.481) [-1252.411] -- 0:00:38
402000 -- [-1254.268] (-1253.115) (-1257.482) (-1256.436) * (-1255.601) [-1253.196] (-1254.636) (-1254.258) -- 0:00:38
402500 -- (-1254.385) (-1253.323) [-1256.038] (-1257.582) * [-1252.329] (-1256.148) (-1253.065) (-1256.664) -- 0:00:38
403000 -- [-1257.703] (-1256.615) (-1255.015) (-1255.518) * (-1252.476) (-1254.866) (-1252.856) [-1257.115] -- 0:00:38
403500 -- (-1253.439) [-1255.668] (-1253.156) (-1255.555) * (-1252.774) (-1253.651) [-1256.803] (-1257.110) -- 0:00:38
404000 -- [-1253.639] (-1258.960) (-1254.935) (-1254.536) * (-1254.334) [-1253.032] (-1255.649) (-1255.613) -- 0:00:38
404500 -- (-1254.901) [-1256.946] (-1253.593) (-1252.376) * (-1257.099) [-1252.656] (-1253.048) (-1256.524) -- 0:00:38
405000 -- (-1255.545) [-1257.022] (-1253.306) (-1253.239) * (-1255.576) [-1253.412] (-1254.968) (-1254.638) -- 0:00:38
Average standard deviation of split frequencies: 0.015602
405500 -- (-1255.517) (-1254.932) (-1258.550) [-1253.150] * (-1256.679) (-1257.566) [-1252.799] (-1256.002) -- 0:00:38
406000 -- [-1256.015] (-1257.088) (-1257.044) (-1255.460) * (-1253.917) (-1262.148) [-1252.677] (-1253.415) -- 0:00:38
406500 -- (-1257.082) [-1253.078] (-1254.871) (-1258.020) * [-1254.246] (-1255.896) (-1252.419) (-1254.514) -- 0:00:37
407000 -- (-1264.355) [-1256.604] (-1254.871) (-1255.996) * (-1254.690) (-1253.697) [-1252.866] (-1257.860) -- 0:00:37
407500 -- (-1259.920) (-1257.033) [-1253.875] (-1254.687) * (-1256.154) [-1253.932] (-1254.269) (-1254.406) -- 0:00:37
408000 -- (-1254.746) (-1255.770) (-1254.409) [-1254.472] * (-1253.752) [-1255.823] (-1253.200) (-1254.205) -- 0:00:37
408500 -- (-1253.376) [-1253.710] (-1256.137) (-1255.415) * [-1256.547] (-1254.878) (-1253.733) (-1255.173) -- 0:00:37
409000 -- (-1253.232) (-1254.075) (-1254.863) [-1257.591] * [-1253.504] (-1255.420) (-1253.539) (-1255.598) -- 0:00:37
409500 -- [-1253.655] (-1253.256) (-1254.301) (-1254.423) * (-1254.451) (-1257.718) [-1252.780] (-1255.356) -- 0:00:37
410000 -- [-1254.780] (-1254.656) (-1254.424) (-1253.648) * (-1254.923) [-1255.827] (-1252.828) (-1257.849) -- 0:00:37
Average standard deviation of split frequencies: 0.015497
410500 -- (-1255.280) [-1255.039] (-1254.930) (-1255.263) * [-1256.511] (-1256.080) (-1253.660) (-1256.410) -- 0:00:37
411000 -- (-1253.831) (-1260.082) (-1257.451) [-1254.142] * [-1256.665] (-1254.794) (-1254.518) (-1255.209) -- 0:00:37
411500 -- (-1255.122) (-1259.705) (-1256.707) [-1257.032] * (-1255.781) (-1255.976) [-1254.214] (-1261.921) -- 0:00:37
412000 -- (-1254.293) (-1256.070) (-1254.721) [-1255.168] * (-1258.345) [-1252.592] (-1253.832) (-1257.267) -- 0:00:37
412500 -- (-1256.638) [-1255.490] (-1253.599) (-1255.537) * (-1254.850) [-1257.917] (-1255.697) (-1253.508) -- 0:00:37
413000 -- (-1259.209) (-1256.258) (-1253.927) [-1254.154] * (-1253.805) (-1254.231) (-1257.609) [-1253.213] -- 0:00:38
413500 -- (-1255.453) (-1255.463) (-1258.127) [-1253.652] * (-1258.199) [-1254.855] (-1260.665) (-1253.245) -- 0:00:38
414000 -- (-1254.056) (-1261.239) (-1254.582) [-1257.076] * (-1257.959) [-1259.688] (-1260.607) (-1253.154) -- 0:00:38
414500 -- (-1257.754) [-1253.787] (-1257.916) (-1254.442) * (-1255.019) [-1252.643] (-1255.787) (-1254.303) -- 0:00:38
415000 -- [-1254.831] (-1254.105) (-1254.062) (-1252.504) * (-1257.371) (-1254.456) [-1253.753] (-1254.402) -- 0:00:38
Average standard deviation of split frequencies: 0.014236
415500 -- [-1255.641] (-1255.429) (-1253.375) (-1252.493) * (-1254.213) [-1252.580] (-1252.642) (-1253.996) -- 0:00:37
416000 -- (-1256.191) [-1255.478] (-1254.516) (-1253.311) * [-1254.218] (-1253.122) (-1253.514) (-1253.063) -- 0:00:37
416500 -- [-1256.640] (-1254.971) (-1255.134) (-1254.012) * (-1254.152) [-1253.964] (-1254.548) (-1253.080) -- 0:00:37
417000 -- [-1257.375] (-1255.029) (-1257.416) (-1255.550) * (-1253.739) [-1254.736] (-1255.289) (-1253.649) -- 0:00:37
417500 -- (-1257.638) (-1255.168) (-1254.220) [-1254.728] * [-1254.664] (-1256.510) (-1254.147) (-1257.974) -- 0:00:37
418000 -- (-1255.853) (-1256.774) (-1254.326) [-1253.231] * [-1252.327] (-1254.840) (-1253.426) (-1257.464) -- 0:00:37
418500 -- [-1253.910] (-1256.622) (-1253.441) (-1254.133) * [-1256.353] (-1253.020) (-1254.847) (-1256.390) -- 0:00:37
419000 -- (-1258.391) (-1257.454) (-1256.969) [-1253.274] * [-1254.283] (-1254.144) (-1253.812) (-1254.938) -- 0:00:37
419500 -- (-1253.497) [-1255.309] (-1253.756) (-1254.318) * (-1253.654) [-1254.832] (-1255.959) (-1254.369) -- 0:00:37
420000 -- (-1253.463) (-1255.836) (-1253.985) [-1254.074] * (-1254.868) [-1255.489] (-1254.521) (-1257.416) -- 0:00:37
Average standard deviation of split frequencies: 0.012817
420500 -- (-1252.574) (-1253.566) (-1253.797) [-1253.529] * (-1254.548) [-1254.308] (-1252.904) (-1254.566) -- 0:00:37
421000 -- [-1252.566] (-1253.797) (-1254.738) (-1252.949) * (-1259.055) (-1254.207) (-1252.905) [-1253.767] -- 0:00:37
421500 -- (-1254.655) (-1254.671) (-1255.240) [-1254.493] * (-1253.403) (-1258.214) (-1262.698) [-1256.596] -- 0:00:37
422000 -- (-1253.658) [-1254.402] (-1253.291) (-1255.371) * (-1254.530) (-1258.180) (-1255.736) [-1253.660] -- 0:00:36
422500 -- (-1255.567) (-1256.039) (-1256.694) [-1254.263] * (-1257.111) [-1257.315] (-1255.954) (-1258.841) -- 0:00:36
423000 -- (-1258.031) [-1253.168] (-1254.041) (-1255.080) * (-1254.122) (-1253.912) (-1256.277) [-1257.198] -- 0:00:36
423500 -- (-1252.689) (-1254.773) [-1255.140] (-1254.298) * (-1252.593) [-1254.991] (-1253.952) (-1253.444) -- 0:00:36
424000 -- (-1254.049) [-1253.468] (-1254.046) (-1256.605) * (-1253.473) (-1253.819) (-1255.274) [-1252.884] -- 0:00:36
424500 -- [-1252.644] (-1254.727) (-1254.114) (-1257.570) * [-1253.111] (-1254.017) (-1254.574) (-1254.865) -- 0:00:36
425000 -- [-1252.695] (-1253.112) (-1255.047) (-1253.827) * (-1254.169) [-1252.557] (-1255.630) (-1254.478) -- 0:00:36
Average standard deviation of split frequencies: 0.013930
425500 -- [-1253.683] (-1252.854) (-1258.586) (-1253.661) * (-1256.089) (-1253.339) [-1255.783] (-1257.139) -- 0:00:36
426000 -- [-1253.257] (-1255.816) (-1254.757) (-1253.877) * [-1254.306] (-1255.541) (-1254.578) (-1255.871) -- 0:00:36
426500 -- [-1253.337] (-1256.015) (-1253.331) (-1253.338) * [-1254.090] (-1253.963) (-1256.689) (-1254.064) -- 0:00:36
427000 -- (-1256.241) (-1254.893) [-1254.811] (-1255.406) * (-1256.063) (-1252.481) (-1256.576) [-1256.018] -- 0:00:36
427500 -- (-1257.715) [-1254.167] (-1255.939) (-1255.958) * (-1258.947) (-1256.041) [-1253.683] (-1255.786) -- 0:00:36
428000 -- (-1254.208) [-1256.819] (-1257.248) (-1253.583) * (-1259.378) [-1254.846] (-1259.717) (-1252.785) -- 0:00:37
428500 -- (-1254.282) [-1254.375] (-1258.378) (-1254.179) * (-1254.255) (-1254.137) (-1257.380) [-1254.735] -- 0:00:37
429000 -- [-1253.480] (-1254.960) (-1257.866) (-1254.824) * (-1254.983) [-1254.131] (-1254.532) (-1252.847) -- 0:00:37
429500 -- (-1257.985) (-1256.650) [-1256.447] (-1255.123) * (-1253.983) (-1256.723) [-1254.105] (-1254.601) -- 0:00:37
430000 -- (-1254.435) (-1256.865) (-1254.173) [-1255.688] * (-1255.568) (-1255.664) (-1253.318) [-1253.309] -- 0:00:37
Average standard deviation of split frequencies: 0.013328
430500 -- (-1254.703) (-1259.107) (-1258.762) [-1260.648] * (-1253.200) [-1254.002] (-1252.968) (-1253.114) -- 0:00:37
431000 -- (-1257.206) [-1254.564] (-1255.110) (-1257.529) * (-1254.015) (-1256.049) [-1256.484] (-1253.603) -- 0:00:36
431500 -- (-1255.964) [-1255.220] (-1255.711) (-1256.474) * (-1257.288) [-1257.805] (-1253.428) (-1253.769) -- 0:00:36
432000 -- [-1254.029] (-1253.242) (-1260.866) (-1255.392) * (-1253.671) [-1255.040] (-1254.071) (-1252.848) -- 0:00:36
432500 -- (-1254.926) (-1256.865) [-1254.345] (-1255.587) * (-1253.890) (-1254.870) [-1254.881] (-1252.692) -- 0:00:36
433000 -- (-1255.498) [-1257.550] (-1252.893) (-1254.577) * (-1252.690) (-1254.680) (-1253.912) [-1252.736] -- 0:00:36
433500 -- (-1255.735) [-1256.385] (-1252.788) (-1256.311) * [-1253.549] (-1255.244) (-1253.969) (-1252.448) -- 0:00:36
434000 -- (-1255.231) (-1255.190) (-1253.308) [-1254.048] * (-1257.255) [-1253.617] (-1255.135) (-1253.046) -- 0:00:36
434500 -- (-1253.897) (-1253.455) (-1252.623) [-1252.506] * [-1253.362] (-1255.161) (-1255.131) (-1253.358) -- 0:00:36
435000 -- [-1255.781] (-1253.789) (-1252.599) (-1252.914) * [-1253.087] (-1252.560) (-1256.365) (-1255.011) -- 0:00:36
Average standard deviation of split frequencies: 0.011691
435500 -- [-1259.787] (-1254.095) (-1252.829) (-1255.204) * [-1252.540] (-1253.247) (-1253.856) (-1256.145) -- 0:00:36
436000 -- [-1257.150] (-1255.904) (-1252.422) (-1252.362) * (-1256.794) [-1253.616] (-1254.556) (-1256.893) -- 0:00:36
436500 -- (-1256.758) (-1256.339) (-1254.183) [-1256.338] * (-1253.921) [-1258.901] (-1253.197) (-1255.192) -- 0:00:36
437000 -- (-1255.710) (-1254.854) [-1253.135] (-1257.225) * (-1253.117) [-1256.438] (-1253.320) (-1254.228) -- 0:00:36
437500 -- [-1253.571] (-1255.926) (-1252.413) (-1258.817) * (-1255.399) [-1255.627] (-1253.096) (-1255.166) -- 0:00:36
438000 -- (-1255.751) [-1253.377] (-1255.819) (-1257.387) * (-1257.279) (-1256.185) [-1256.200] (-1255.642) -- 0:00:35
438500 -- (-1253.932) (-1253.561) (-1253.638) [-1257.647] * (-1256.467) (-1254.371) (-1260.358) [-1252.694] -- 0:00:35
439000 -- (-1255.020) [-1253.116] (-1253.682) (-1260.207) * (-1257.924) [-1254.256] (-1257.864) (-1253.861) -- 0:00:35
439500 -- [-1253.971] (-1254.377) (-1253.395) (-1256.098) * (-1254.810) (-1254.901) (-1258.071) [-1253.829] -- 0:00:35
440000 -- (-1255.603) (-1253.339) (-1253.678) [-1254.806] * [-1253.313] (-1256.049) (-1254.087) (-1254.142) -- 0:00:35
Average standard deviation of split frequencies: 0.011567
440500 -- [-1254.148] (-1254.693) (-1257.000) (-1256.223) * (-1253.239) (-1254.668) (-1254.210) [-1254.608] -- 0:00:35
441000 -- (-1254.657) (-1255.976) [-1252.684] (-1254.236) * (-1255.544) [-1257.079] (-1252.882) (-1253.916) -- 0:00:35
441500 -- (-1254.098) [-1252.950] (-1252.926) (-1256.081) * (-1257.579) (-1257.028) (-1252.265) [-1256.276] -- 0:00:35
442000 -- (-1253.672) [-1255.787] (-1256.048) (-1256.125) * [-1256.801] (-1254.788) (-1252.678) (-1255.380) -- 0:00:35
442500 -- (-1254.450) [-1255.513] (-1252.736) (-1255.214) * (-1254.119) (-1255.536) [-1253.027] (-1257.196) -- 0:00:35
443000 -- (-1255.758) [-1252.945] (-1253.053) (-1254.865) * (-1255.228) [-1252.764] (-1254.599) (-1255.392) -- 0:00:35
443500 -- (-1255.454) (-1253.560) (-1253.464) [-1253.259] * (-1254.330) (-1260.537) (-1256.597) [-1255.066] -- 0:00:36
444000 -- (-1254.719) (-1253.378) [-1255.044] (-1252.393) * [-1255.661] (-1263.589) (-1256.875) (-1254.419) -- 0:00:36
444500 -- (-1253.784) (-1256.475) [-1255.207] (-1254.252) * (-1253.459) (-1253.890) [-1254.792] (-1255.195) -- 0:00:36
445000 -- (-1253.482) [-1253.680] (-1253.178) (-1253.231) * (-1256.715) (-1255.013) (-1256.145) [-1254.993] -- 0:00:36
Average standard deviation of split frequencies: 0.011744
445500 -- (-1252.956) (-1253.805) [-1252.801] (-1253.620) * (-1253.941) (-1255.265) [-1254.540] (-1253.988) -- 0:00:36
446000 -- (-1255.344) (-1253.631) [-1253.823] (-1253.056) * (-1254.898) (-1253.374) (-1254.242) [-1253.585] -- 0:00:36
446500 -- (-1255.964) (-1255.186) [-1258.056] (-1255.750) * (-1254.640) (-1255.307) (-1261.797) [-1253.669] -- 0:00:35
447000 -- (-1256.436) (-1254.411) (-1253.272) [-1254.944] * (-1257.015) (-1257.668) (-1260.500) [-1255.542] -- 0:00:35
447500 -- (-1254.766) [-1254.754] (-1253.792) (-1252.953) * (-1256.564) (-1254.485) [-1255.480] (-1254.322) -- 0:00:35
448000 -- (-1258.735) (-1254.779) [-1257.806] (-1255.502) * (-1253.954) (-1254.068) (-1257.955) [-1255.056] -- 0:00:35
448500 -- (-1254.176) [-1255.564] (-1254.735) (-1253.460) * [-1252.881] (-1253.767) (-1257.429) (-1254.792) -- 0:00:35
449000 -- (-1255.723) (-1256.476) (-1257.445) [-1255.050] * [-1254.556] (-1252.651) (-1252.691) (-1254.283) -- 0:00:35
449500 -- (-1256.770) [-1254.272] (-1255.085) (-1253.478) * [-1255.417] (-1255.817) (-1253.119) (-1254.787) -- 0:00:35
450000 -- (-1254.343) [-1255.264] (-1252.777) (-1254.176) * (-1255.261) [-1255.816] (-1253.014) (-1254.034) -- 0:00:35
Average standard deviation of split frequencies: 0.011390
450500 -- (-1253.644) [-1253.897] (-1253.694) (-1253.103) * (-1256.938) (-1253.189) [-1254.159] (-1254.628) -- 0:00:35
451000 -- (-1254.485) (-1254.631) [-1253.241] (-1252.775) * (-1259.758) (-1253.005) [-1255.293] (-1254.097) -- 0:00:35
451500 -- (-1253.540) [-1254.607] (-1254.754) (-1253.270) * (-1256.741) (-1254.050) [-1253.200] (-1253.365) -- 0:00:35
452000 -- (-1253.107) [-1254.448] (-1256.253) (-1254.790) * (-1255.622) (-1253.568) [-1254.260] (-1253.957) -- 0:00:35
452500 -- (-1254.701) [-1253.835] (-1257.958) (-1254.251) * [-1254.814] (-1257.425) (-1254.407) (-1256.071) -- 0:00:35
453000 -- [-1252.884] (-1253.518) (-1255.940) (-1254.886) * (-1255.211) (-1254.865) (-1254.685) [-1254.031] -- 0:00:35
453500 -- (-1253.835) (-1252.630) [-1253.982] (-1253.235) * (-1254.238) (-1255.821) [-1258.560] (-1257.196) -- 0:00:34
454000 -- [-1252.832] (-1253.199) (-1254.212) (-1253.761) * (-1256.604) [-1254.404] (-1258.151) (-1254.348) -- 0:00:34
454500 -- (-1254.326) [-1254.377] (-1254.601) (-1253.030) * [-1254.976] (-1255.722) (-1253.953) (-1256.507) -- 0:00:34
455000 -- (-1254.561) (-1254.034) [-1253.987] (-1253.797) * (-1255.396) [-1254.245] (-1258.147) (-1254.436) -- 0:00:34
Average standard deviation of split frequencies: 0.011372
455500 -- (-1255.983) (-1253.777) [-1255.110] (-1253.814) * (-1254.866) (-1255.466) [-1253.264] (-1254.619) -- 0:00:34
456000 -- (-1253.594) (-1255.149) (-1257.492) [-1252.834] * [-1256.750] (-1256.559) (-1252.562) (-1256.386) -- 0:00:34
456500 -- (-1254.156) (-1256.781) (-1254.276) [-1255.542] * (-1259.930) (-1255.045) (-1253.236) [-1254.203] -- 0:00:34
457000 -- (-1257.640) (-1258.540) (-1254.075) [-1254.970] * (-1255.292) (-1255.701) [-1254.474] (-1254.537) -- 0:00:34
457500 -- (-1256.572) (-1254.015) [-1256.913] (-1254.937) * (-1254.588) (-1254.828) (-1254.388) [-1255.820] -- 0:00:34
458000 -- [-1254.740] (-1259.292) (-1255.554) (-1256.613) * [-1254.130] (-1256.080) (-1253.239) (-1256.689) -- 0:00:34
458500 -- [-1255.015] (-1254.780) (-1255.212) (-1254.143) * (-1255.722) [-1255.031] (-1253.515) (-1253.800) -- 0:00:34
459000 -- (-1254.964) (-1256.340) (-1253.383) [-1258.094] * (-1255.956) (-1256.059) [-1255.349] (-1254.030) -- 0:00:34
459500 -- (-1254.369) (-1254.374) (-1256.511) [-1255.447] * (-1256.551) (-1255.826) (-1253.339) [-1255.845] -- 0:00:35
460000 -- [-1252.507] (-1254.055) (-1254.798) (-1253.701) * [-1254.671] (-1255.887) (-1257.102) (-1256.401) -- 0:00:35
Average standard deviation of split frequencies: 0.011711
460500 -- (-1255.173) [-1253.704] (-1253.128) (-1252.571) * (-1254.563) (-1254.900) (-1253.204) [-1254.245] -- 0:00:35
461000 -- (-1253.273) [-1254.831] (-1255.600) (-1252.571) * (-1255.177) [-1256.641] (-1255.400) (-1253.771) -- 0:00:35
461500 -- (-1254.833) (-1254.523) (-1256.897) [-1252.595] * (-1255.218) (-1256.164) (-1254.653) [-1255.468] -- 0:00:35
462000 -- (-1252.842) (-1255.473) (-1255.191) [-1252.813] * (-1255.097) [-1254.818] (-1253.664) (-1254.258) -- 0:00:34
462500 -- [-1253.446] (-1256.009) (-1254.870) (-1254.346) * (-1252.816) (-1253.947) (-1254.226) [-1256.028] -- 0:00:34
463000 -- [-1253.014] (-1255.737) (-1255.212) (-1255.247) * (-1254.222) [-1253.268] (-1257.557) (-1252.580) -- 0:00:34
463500 -- (-1253.003) [-1254.504] (-1254.020) (-1255.492) * (-1253.159) [-1255.087] (-1255.774) (-1254.350) -- 0:00:34
464000 -- (-1254.011) (-1255.796) [-1253.515] (-1254.070) * (-1254.711) (-1256.962) [-1258.191] (-1256.283) -- 0:00:34
464500 -- (-1257.487) (-1255.334) [-1255.840] (-1253.847) * (-1255.066) (-1253.559) (-1258.555) [-1258.114] -- 0:00:34
465000 -- (-1253.512) (-1256.004) [-1254.664] (-1253.351) * (-1255.541) (-1254.440) (-1255.864) [-1254.990] -- 0:00:34
Average standard deviation of split frequencies: 0.011858
465500 -- (-1255.111) (-1255.625) [-1254.709] (-1253.442) * [-1255.163] (-1253.479) (-1252.998) (-1255.190) -- 0:00:34
466000 -- (-1254.496) (-1259.930) [-1254.018] (-1252.608) * (-1255.119) [-1257.394] (-1253.971) (-1255.158) -- 0:00:34
466500 -- (-1256.739) (-1253.973) [-1257.015] (-1252.950) * (-1253.292) (-1253.585) (-1256.282) [-1255.389] -- 0:00:34
467000 -- (-1255.025) (-1253.287) (-1254.565) [-1252.541] * (-1254.679) (-1254.362) (-1256.488) [-1256.023] -- 0:00:34
467500 -- (-1256.431) (-1253.719) [-1254.087] (-1252.851) * (-1252.825) (-1256.943) (-1254.431) [-1255.166] -- 0:00:34
468000 -- [-1256.647] (-1254.751) (-1254.039) (-1253.462) * (-1253.552) (-1254.132) [-1253.033] (-1254.136) -- 0:00:34
468500 -- (-1258.245) (-1256.317) (-1253.723) [-1254.482] * (-1255.960) [-1254.387] (-1255.215) (-1261.646) -- 0:00:34
469000 -- (-1257.450) (-1256.383) [-1254.878] (-1254.739) * (-1254.535) (-1254.756) [-1256.618] (-1255.564) -- 0:00:33
469500 -- (-1257.672) (-1255.398) [-1254.417] (-1255.939) * [-1254.970] (-1253.033) (-1253.241) (-1255.202) -- 0:00:33
470000 -- (-1254.883) (-1257.284) [-1256.469] (-1253.711) * [-1255.036] (-1254.351) (-1254.729) (-1255.007) -- 0:00:33
Average standard deviation of split frequencies: 0.012186
470500 -- (-1254.134) [-1253.615] (-1255.558) (-1255.819) * (-1255.766) (-1255.684) [-1253.046] (-1256.808) -- 0:00:33
471000 -- (-1258.346) [-1253.306] (-1255.557) (-1253.635) * (-1253.424) (-1255.219) (-1257.387) [-1255.027] -- 0:00:33
471500 -- (-1252.706) [-1255.184] (-1253.565) (-1256.504) * [-1253.107] (-1252.419) (-1253.308) (-1253.980) -- 0:00:33
472000 -- (-1255.130) (-1254.714) [-1252.529] (-1253.560) * (-1252.981) [-1254.059] (-1253.161) (-1257.138) -- 0:00:33
472500 -- (-1256.370) (-1252.911) [-1252.494] (-1253.280) * (-1252.620) (-1253.805) (-1256.741) [-1256.505] -- 0:00:33
473000 -- [-1255.362] (-1252.999) (-1252.317) (-1256.589) * [-1254.014] (-1254.597) (-1254.130) (-1254.945) -- 0:00:33
473500 -- [-1257.422] (-1258.130) (-1253.301) (-1254.970) * (-1253.333) (-1257.008) (-1253.125) [-1253.427] -- 0:00:33
474000 -- [-1256.463] (-1253.892) (-1254.835) (-1252.830) * (-1255.543) (-1255.591) [-1254.410] (-1256.432) -- 0:00:33
474500 -- (-1255.421) (-1254.060) (-1254.801) [-1252.841] * (-1255.222) (-1254.096) [-1253.208] (-1256.432) -- 0:00:33
475000 -- (-1255.722) (-1254.520) [-1255.374] (-1253.330) * (-1253.576) (-1254.028) [-1253.714] (-1253.410) -- 0:00:34
Average standard deviation of split frequencies: 0.012159
475500 -- (-1254.264) (-1258.770) (-1252.812) [-1255.537] * (-1252.503) (-1255.503) (-1253.646) [-1260.598] -- 0:00:34
476000 -- (-1253.321) (-1256.451) (-1252.918) [-1254.836] * [-1252.840] (-1255.242) (-1254.974) (-1254.118) -- 0:00:34
476500 -- (-1254.419) (-1254.536) (-1253.837) [-1254.245] * (-1252.280) (-1257.346) (-1253.768) [-1253.731] -- 0:00:34
477000 -- (-1254.292) (-1254.413) (-1255.165) [-1255.327] * (-1252.750) (-1253.603) [-1253.834] (-1252.541) -- 0:00:33
477500 -- [-1254.124] (-1254.262) (-1254.425) (-1252.956) * [-1252.720] (-1253.867) (-1252.242) (-1252.598) -- 0:00:33
478000 -- (-1253.402) [-1254.345] (-1256.075) (-1254.385) * (-1253.053) (-1256.863) (-1253.334) [-1255.808] -- 0:00:33
478500 -- (-1253.399) [-1253.921] (-1253.981) (-1254.701) * (-1252.824) (-1255.721) [-1253.531] (-1256.834) -- 0:00:33
479000 -- (-1253.774) [-1255.028] (-1252.911) (-1254.158) * (-1255.083) (-1252.754) [-1257.422] (-1255.567) -- 0:00:33
479500 -- [-1256.909] (-1258.999) (-1254.878) (-1253.796) * (-1252.976) (-1252.534) [-1253.120] (-1253.586) -- 0:00:33
480000 -- (-1254.346) (-1254.960) (-1256.391) [-1253.365] * (-1257.469) [-1254.207] (-1259.595) (-1255.648) -- 0:00:33
Average standard deviation of split frequencies: 0.012057
480500 -- (-1256.517) (-1252.998) (-1255.021) [-1254.571] * [-1256.441] (-1256.240) (-1254.253) (-1253.172) -- 0:00:33
481000 -- (-1256.859) (-1252.988) [-1253.244] (-1254.608) * [-1252.852] (-1260.958) (-1255.722) (-1252.991) -- 0:00:33
481500 -- (-1253.386) (-1254.922) (-1256.884) [-1253.324] * [-1253.016] (-1253.125) (-1256.869) (-1256.618) -- 0:00:33
482000 -- (-1255.534) (-1256.204) (-1257.361) [-1253.305] * (-1253.014) [-1254.249] (-1256.749) (-1253.143) -- 0:00:33
482500 -- (-1254.506) [-1256.649] (-1256.953) (-1254.222) * (-1253.797) (-1255.105) (-1254.390) [-1256.573] -- 0:00:33
483000 -- (-1256.422) [-1253.913] (-1253.065) (-1253.535) * (-1260.471) [-1255.444] (-1256.423) (-1257.021) -- 0:00:33
483500 -- (-1257.509) (-1255.537) (-1254.653) [-1253.112] * (-1254.985) (-1254.562) (-1254.345) [-1252.941] -- 0:00:33
484000 -- (-1254.044) (-1255.090) (-1258.126) [-1252.951] * [-1254.676] (-1254.194) (-1254.965) (-1254.369) -- 0:00:33
484500 -- (-1254.632) (-1257.892) (-1255.304) [-1253.642] * [-1254.672] (-1254.255) (-1258.733) (-1259.577) -- 0:00:32
485000 -- (-1254.456) (-1253.138) (-1253.076) [-1254.168] * (-1255.041) (-1257.414) [-1255.912] (-1252.883) -- 0:00:32
Average standard deviation of split frequencies: 0.011640
485500 -- (-1259.238) (-1253.196) [-1253.718] (-1257.087) * (-1257.919) (-1255.815) (-1259.100) [-1253.519] -- 0:00:32
486000 -- (-1254.875) (-1255.857) [-1254.602] (-1254.975) * (-1255.711) (-1256.916) (-1253.956) [-1254.717] -- 0:00:32
486500 -- (-1254.312) (-1255.021) (-1255.373) [-1258.041] * [-1257.530] (-1253.173) (-1256.961) (-1254.555) -- 0:00:32
487000 -- (-1254.971) (-1253.530) [-1254.666] (-1256.468) * (-1257.423) (-1255.526) [-1254.477] (-1255.453) -- 0:00:32
487500 -- [-1253.777] (-1252.682) (-1253.703) (-1254.307) * (-1254.679) [-1254.956] (-1255.647) (-1253.991) -- 0:00:32
488000 -- [-1254.447] (-1256.272) (-1255.003) (-1254.235) * (-1254.940) (-1256.455) [-1257.600] (-1254.008) -- 0:00:32
488500 -- (-1254.088) [-1256.646] (-1255.300) (-1254.417) * (-1255.844) (-1255.031) (-1255.397) [-1254.564] -- 0:00:32
489000 -- [-1254.182] (-1254.131) (-1254.109) (-1253.292) * (-1259.495) [-1256.502] (-1253.198) (-1255.755) -- 0:00:32
489500 -- (-1258.590) (-1254.876) (-1254.288) [-1256.347] * (-1255.715) (-1254.140) [-1255.190] (-1255.511) -- 0:00:32
490000 -- [-1253.308] (-1258.829) (-1253.254) (-1254.887) * (-1254.890) (-1254.502) (-1253.466) [-1254.644] -- 0:00:32
Average standard deviation of split frequencies: 0.011020
490500 -- (-1252.455) [-1255.502] (-1256.497) (-1253.142) * (-1254.518) [-1253.689] (-1256.003) (-1254.482) -- 0:00:32
491000 -- (-1252.915) [-1255.730] (-1256.536) (-1253.186) * (-1252.991) [-1253.376] (-1256.679) (-1254.234) -- 0:00:33
491500 -- (-1253.390) (-1254.789) (-1254.137) [-1253.987] * (-1254.839) (-1253.207) [-1255.476] (-1258.966) -- 0:00:33
492000 -- [-1256.017] (-1255.312) (-1254.481) (-1260.530) * [-1253.449] (-1253.010) (-1253.224) (-1260.988) -- 0:00:33
492500 -- [-1255.170] (-1254.789) (-1253.174) (-1254.451) * (-1254.281) (-1253.817) (-1253.890) [-1258.753] -- 0:00:32
493000 -- (-1253.048) [-1252.785] (-1253.060) (-1256.480) * [-1255.046] (-1253.646) (-1252.639) (-1255.880) -- 0:00:32
493500 -- (-1252.960) [-1253.175] (-1258.357) (-1258.101) * (-1254.145) [-1254.463] (-1256.723) (-1257.791) -- 0:00:32
494000 -- [-1252.944] (-1253.269) (-1255.018) (-1254.623) * [-1252.742] (-1255.926) (-1258.252) (-1258.357) -- 0:00:32
494500 -- [-1252.859] (-1255.525) (-1252.923) (-1254.318) * [-1253.569] (-1254.415) (-1254.549) (-1253.719) -- 0:00:32
495000 -- (-1252.869) (-1260.505) [-1254.038] (-1252.904) * (-1253.181) [-1254.075] (-1253.812) (-1255.650) -- 0:00:32
Average standard deviation of split frequencies: 0.011070
495500 -- (-1253.212) [-1256.935] (-1252.925) (-1253.593) * (-1253.079) (-1260.359) (-1257.492) [-1254.321] -- 0:00:32
496000 -- (-1253.076) (-1255.897) [-1255.041] (-1254.327) * (-1253.192) [-1253.140] (-1256.773) (-1253.635) -- 0:00:32
496500 -- [-1252.785] (-1253.584) (-1253.248) (-1259.464) * (-1253.343) [-1253.089] (-1255.718) (-1252.696) -- 0:00:32
497000 -- (-1253.849) [-1252.952] (-1253.392) (-1257.914) * (-1252.816) (-1253.772) [-1256.175] (-1255.775) -- 0:00:32
497500 -- [-1252.526] (-1254.644) (-1253.903) (-1254.049) * (-1253.674) [-1256.144] (-1253.472) (-1258.501) -- 0:00:32
498000 -- (-1254.783) (-1253.096) [-1256.450] (-1254.461) * (-1254.569) (-1254.288) [-1252.696] (-1258.767) -- 0:00:32
498500 -- (-1253.204) (-1257.224) (-1253.950) [-1252.794] * (-1253.937) (-1253.828) [-1253.474] (-1257.657) -- 0:00:32
499000 -- (-1255.723) (-1255.839) (-1253.674) [-1252.722] * (-1254.685) (-1253.067) [-1252.310] (-1255.355) -- 0:00:32
499500 -- [-1252.969] (-1256.139) (-1252.982) (-1253.259) * (-1256.866) (-1252.720) [-1252.351] (-1253.516) -- 0:00:32
500000 -- (-1256.623) (-1261.692) (-1256.240) [-1254.754] * (-1255.563) [-1253.356] (-1253.216) (-1253.008) -- 0:00:32
Average standard deviation of split frequencies: 0.011576
500500 -- (-1255.565) (-1261.421) [-1257.396] (-1260.148) * (-1257.179) (-1254.846) (-1253.573) [-1256.275] -- 0:00:31
501000 -- [-1253.601] (-1256.629) (-1258.146) (-1256.708) * (-1255.018) [-1255.006] (-1253.398) (-1253.317) -- 0:00:31
501500 -- [-1255.309] (-1256.410) (-1258.522) (-1257.587) * (-1252.961) [-1253.776] (-1252.846) (-1258.064) -- 0:00:31
502000 -- (-1259.561) [-1254.952] (-1254.143) (-1260.328) * [-1254.481] (-1256.488) (-1252.600) (-1255.362) -- 0:00:31
502500 -- [-1259.035] (-1252.798) (-1254.166) (-1256.884) * (-1254.376) (-1261.155) (-1252.851) [-1255.836] -- 0:00:31
503000 -- (-1257.272) [-1252.965] (-1253.277) (-1255.506) * (-1253.515) (-1256.753) (-1253.829) [-1256.185] -- 0:00:31
503500 -- (-1253.402) (-1254.432) [-1253.089] (-1254.392) * (-1255.713) (-1256.445) [-1253.525] (-1253.085) -- 0:00:31
504000 -- (-1253.650) [-1253.943] (-1253.866) (-1254.388) * (-1255.480) (-1254.305) (-1256.630) [-1256.093] -- 0:00:31
504500 -- (-1260.103) (-1254.395) [-1252.790] (-1253.977) * (-1256.383) (-1254.828) [-1253.457] (-1255.052) -- 0:00:31
505000 -- [-1253.343] (-1255.207) (-1255.162) (-1256.985) * (-1255.972) (-1254.846) [-1253.496] (-1254.405) -- 0:00:31
Average standard deviation of split frequencies: 0.010796
505500 -- [-1253.507] (-1255.817) (-1252.791) (-1257.363) * (-1254.978) [-1253.906] (-1253.536) (-1253.798) -- 0:00:31
506000 -- (-1254.662) (-1257.984) (-1253.755) [-1257.396] * (-1254.221) (-1257.152) (-1254.895) [-1254.441] -- 0:00:31
506500 -- (-1253.727) [-1255.743] (-1254.244) (-1253.766) * (-1253.350) [-1256.293] (-1253.313) (-1252.550) -- 0:00:32
507000 -- (-1253.994) (-1254.593) [-1252.920] (-1253.881) * (-1253.639) (-1255.751) [-1253.470] (-1258.714) -- 0:00:32
507500 -- (-1256.199) (-1252.965) [-1253.428] (-1252.943) * (-1253.119) (-1254.843) (-1253.886) [-1260.561] -- 0:00:32
508000 -- [-1255.919] (-1252.697) (-1252.540) (-1255.742) * (-1253.331) (-1254.730) (-1258.210) [-1255.506] -- 0:00:31
508500 -- (-1253.115) (-1253.216) [-1253.331] (-1256.906) * (-1252.836) (-1258.225) [-1253.638] (-1259.903) -- 0:00:31
509000 -- (-1252.200) (-1253.571) [-1253.394] (-1257.557) * (-1253.453) [-1253.834] (-1253.479) (-1255.829) -- 0:00:31
509500 -- [-1253.430] (-1252.937) (-1253.568) (-1255.570) * [-1254.247] (-1253.744) (-1253.365) (-1252.736) -- 0:00:31
510000 -- [-1255.109] (-1253.642) (-1253.395) (-1254.701) * (-1254.128) (-1264.956) (-1252.892) [-1255.885] -- 0:00:31
Average standard deviation of split frequencies: 0.011175
510500 -- (-1253.806) (-1256.593) [-1256.265] (-1254.554) * (-1254.017) (-1256.456) [-1253.860] (-1254.149) -- 0:00:31
511000 -- (-1255.907) (-1254.876) [-1253.778] (-1255.364) * (-1252.996) [-1259.381] (-1253.855) (-1253.744) -- 0:00:31
511500 -- (-1256.079) (-1254.953) (-1254.645) [-1257.507] * (-1253.880) [-1254.997] (-1254.658) (-1255.137) -- 0:00:31
512000 -- [-1257.027] (-1255.465) (-1254.507) (-1256.619) * [-1253.771] (-1255.027) (-1253.765) (-1255.744) -- 0:00:31
512500 -- (-1254.310) [-1253.517] (-1253.516) (-1258.084) * (-1260.279) (-1254.629) [-1254.830] (-1255.448) -- 0:00:31
513000 -- (-1255.193) [-1254.852] (-1253.419) (-1263.440) * (-1258.531) (-1254.588) [-1253.253] (-1257.930) -- 0:00:31
513500 -- [-1255.175] (-1255.897) (-1254.267) (-1253.329) * (-1254.024) [-1253.764] (-1253.320) (-1255.356) -- 0:00:31
514000 -- (-1256.498) (-1255.286) (-1253.623) [-1254.132] * [-1254.106] (-1253.465) (-1256.198) (-1257.685) -- 0:00:31
514500 -- (-1253.303) [-1253.672] (-1253.110) (-1253.841) * [-1253.591] (-1254.425) (-1254.071) (-1259.002) -- 0:00:31
515000 -- [-1253.257] (-1254.190) (-1253.972) (-1258.467) * (-1252.857) (-1254.058) [-1255.988] (-1253.153) -- 0:00:31
Average standard deviation of split frequencies: 0.010748
515500 -- (-1255.789) [-1253.475] (-1252.969) (-1255.913) * (-1254.168) [-1255.070] (-1253.244) (-1255.456) -- 0:00:31
516000 -- (-1254.513) (-1257.927) (-1255.332) [-1255.495] * (-1255.616) [-1256.780] (-1258.226) (-1253.514) -- 0:00:30
516500 -- [-1254.204] (-1254.811) (-1255.020) (-1255.671) * (-1260.131) [-1255.829] (-1254.685) (-1253.913) -- 0:00:30
517000 -- [-1257.860] (-1252.923) (-1254.192) (-1255.829) * (-1255.937) [-1256.243] (-1257.282) (-1259.055) -- 0:00:30
517500 -- [-1253.964] (-1253.402) (-1254.258) (-1253.632) * (-1259.507) (-1253.289) [-1256.400] (-1259.750) -- 0:00:30
518000 -- [-1254.777] (-1254.818) (-1255.338) (-1253.413) * [-1254.935] (-1253.344) (-1258.643) (-1260.932) -- 0:00:30
518500 -- (-1254.297) (-1254.075) [-1254.299] (-1257.647) * (-1252.769) (-1257.437) (-1255.294) [-1256.477] -- 0:00:30
519000 -- (-1253.301) [-1255.785] (-1254.553) (-1254.971) * [-1252.745] (-1257.323) (-1258.251) (-1258.371) -- 0:00:30
519500 -- (-1254.982) (-1256.574) (-1254.450) [-1255.152] * [-1256.622] (-1257.810) (-1254.409) (-1257.564) -- 0:00:30
520000 -- (-1256.245) (-1253.477) (-1254.597) [-1254.262] * (-1256.301) (-1256.602) [-1253.268] (-1254.492) -- 0:00:30
Average standard deviation of split frequencies: 0.011078
520500 -- (-1255.438) (-1254.118) (-1254.759) [-1255.280] * (-1252.981) [-1254.335] (-1255.111) (-1255.751) -- 0:00:30
521000 -- (-1254.848) (-1254.650) (-1254.068) [-1255.428] * (-1253.958) (-1255.861) (-1253.668) [-1255.529] -- 0:00:30
521500 -- [-1254.764] (-1257.785) (-1253.771) (-1253.398) * (-1256.267) (-1253.670) (-1257.758) [-1254.614] -- 0:00:30
522000 -- [-1254.822] (-1257.399) (-1255.279) (-1254.605) * (-1257.695) (-1253.953) [-1253.780] (-1252.795) -- 0:00:30
522500 -- [-1253.558] (-1257.820) (-1253.248) (-1253.530) * (-1254.593) (-1252.636) [-1260.413] (-1253.343) -- 0:00:31
523000 -- [-1254.132] (-1257.933) (-1262.922) (-1254.866) * (-1255.918) (-1253.916) (-1254.534) [-1253.503] -- 0:00:31
523500 -- [-1255.129] (-1260.979) (-1259.212) (-1254.485) * (-1256.649) [-1255.137] (-1262.155) (-1253.453) -- 0:00:30
524000 -- (-1254.656) (-1255.868) (-1258.104) [-1255.087] * (-1255.386) (-1254.953) [-1255.471] (-1255.289) -- 0:00:30
524500 -- (-1255.623) (-1253.753) [-1254.719] (-1253.636) * (-1254.227) (-1253.916) [-1256.968] (-1255.830) -- 0:00:30
525000 -- (-1254.876) (-1254.822) [-1258.490] (-1253.402) * (-1252.858) (-1256.771) [-1253.441] (-1255.702) -- 0:00:30
Average standard deviation of split frequencies: 0.010605
525500 -- [-1255.556] (-1258.305) (-1255.036) (-1254.412) * (-1255.604) (-1256.697) [-1252.866] (-1254.915) -- 0:00:30
526000 -- (-1254.705) (-1252.709) [-1255.173] (-1254.364) * [-1254.913] (-1255.195) (-1252.963) (-1255.085) -- 0:00:30
526500 -- (-1254.444) [-1252.877] (-1256.008) (-1252.267) * [-1254.399] (-1253.150) (-1253.873) (-1253.499) -- 0:00:30
527000 -- [-1254.286] (-1253.401) (-1254.779) (-1252.943) * (-1253.279) [-1253.584] (-1252.886) (-1252.419) -- 0:00:30
527500 -- (-1253.917) (-1254.977) [-1256.288] (-1255.146) * (-1253.058) (-1257.722) (-1253.211) [-1252.419] -- 0:00:30
528000 -- [-1255.800] (-1253.594) (-1254.347) (-1254.435) * (-1256.739) (-1256.793) (-1259.159) [-1253.085] -- 0:00:30
528500 -- (-1253.886) (-1256.653) [-1254.582] (-1253.988) * (-1253.522) [-1256.554] (-1253.748) (-1255.531) -- 0:00:30
529000 -- [-1254.914] (-1253.684) (-1253.257) (-1253.089) * (-1252.590) [-1253.784] (-1253.173) (-1254.916) -- 0:00:30
529500 -- (-1252.909) [-1252.947] (-1257.175) (-1255.906) * (-1252.591) [-1252.786] (-1259.508) (-1257.973) -- 0:00:30
530000 -- (-1258.143) (-1253.029) [-1255.040] (-1254.653) * (-1254.057) (-1256.255) (-1260.861) [-1254.527] -- 0:00:30
Average standard deviation of split frequencies: 0.010503
530500 -- (-1256.432) (-1256.474) (-1255.008) [-1253.640] * (-1256.934) (-1254.654) [-1254.996] (-1256.677) -- 0:00:30
531000 -- [-1253.743] (-1255.349) (-1256.524) (-1253.825) * [-1252.941] (-1254.390) (-1255.793) (-1258.584) -- 0:00:30
531500 -- (-1253.663) (-1258.137) (-1259.114) [-1259.572] * [-1258.543] (-1254.425) (-1257.363) (-1255.662) -- 0:00:29
532000 -- (-1254.338) [-1254.335] (-1256.845) (-1255.094) * [-1258.627] (-1252.504) (-1253.602) (-1252.662) -- 0:00:29
532500 -- (-1255.019) (-1253.767) (-1255.120) [-1256.784] * (-1264.523) (-1258.319) [-1254.011] (-1252.804) -- 0:00:29
533000 -- (-1254.117) (-1255.278) [-1257.610] (-1255.884) * (-1255.416) (-1257.514) [-1252.458] (-1255.589) -- 0:00:29
533500 -- (-1253.994) (-1256.485) (-1256.769) [-1255.459] * (-1257.089) (-1253.144) [-1255.604] (-1253.987) -- 0:00:29
534000 -- (-1253.013) (-1260.455) [-1257.614] (-1257.589) * (-1256.237) (-1255.172) (-1255.033) [-1253.142] -- 0:00:29
534500 -- (-1253.928) (-1257.158) (-1259.859) [-1252.672] * (-1253.421) (-1253.337) (-1254.112) [-1253.286] -- 0:00:29
535000 -- [-1255.464] (-1254.890) (-1256.593) (-1252.586) * (-1253.547) (-1258.153) (-1252.801) [-1253.298] -- 0:00:29
Average standard deviation of split frequencies: 0.010456
535500 -- (-1252.797) (-1255.154) [-1254.433] (-1254.081) * (-1253.683) [-1253.701] (-1254.948) (-1254.749) -- 0:00:29
536000 -- (-1254.312) (-1257.500) [-1254.685] (-1258.463) * [-1254.458] (-1254.941) (-1255.951) (-1254.010) -- 0:00:29
536500 -- (-1256.034) (-1253.421) (-1255.777) [-1255.757] * [-1252.791] (-1255.167) (-1258.338) (-1257.800) -- 0:00:29
537000 -- (-1254.192) [-1255.167] (-1253.757) (-1254.000) * (-1254.035) (-1254.909) (-1255.961) [-1254.278] -- 0:00:29
537500 -- [-1257.126] (-1255.903) (-1257.732) (-1255.390) * [-1252.426] (-1254.558) (-1254.264) (-1260.954) -- 0:00:29
538000 -- (-1254.184) (-1254.788) (-1253.943) [-1253.310] * [-1253.458] (-1258.462) (-1256.137) (-1253.270) -- 0:00:30
538500 -- (-1258.391) (-1254.339) (-1254.146) [-1252.550] * (-1253.488) [-1253.086] (-1254.667) (-1258.703) -- 0:00:29
539000 -- (-1253.214) [-1252.674] (-1253.762) (-1254.210) * (-1255.601) [-1253.781] (-1256.123) (-1256.905) -- 0:00:29
539500 -- [-1257.269] (-1253.786) (-1255.034) (-1253.156) * (-1256.543) (-1255.167) [-1253.866] (-1253.837) -- 0:00:29
540000 -- [-1252.389] (-1252.800) (-1255.851) (-1253.312) * (-1255.255) (-1257.643) (-1253.704) [-1253.370] -- 0:00:29
Average standard deviation of split frequencies: 0.010844
540500 -- (-1254.858) [-1254.048] (-1256.609) (-1252.855) * (-1254.988) (-1258.096) (-1253.488) [-1257.631] -- 0:00:29
541000 -- (-1253.298) [-1254.335] (-1254.725) (-1254.307) * (-1254.451) (-1257.605) (-1255.035) [-1254.139] -- 0:00:29
541500 -- [-1253.598] (-1259.019) (-1257.312) (-1260.187) * (-1254.201) (-1257.449) [-1253.424] (-1254.429) -- 0:00:29
542000 -- [-1253.467] (-1259.420) (-1258.017) (-1256.782) * (-1253.837) (-1259.048) [-1252.841] (-1254.210) -- 0:00:29
542500 -- (-1256.976) (-1257.195) [-1255.652] (-1253.413) * (-1254.113) (-1255.601) [-1253.990] (-1253.843) -- 0:00:29
543000 -- (-1258.548) (-1253.866) (-1258.678) [-1252.708] * (-1253.264) (-1257.093) (-1254.855) [-1255.857] -- 0:00:29
543500 -- [-1255.142] (-1253.880) (-1256.772) (-1254.936) * (-1255.873) (-1257.548) [-1253.073] (-1257.357) -- 0:00:29
544000 -- [-1254.919] (-1254.275) (-1255.401) (-1253.652) * (-1255.408) (-1253.664) [-1253.920] (-1254.641) -- 0:00:29
544500 -- (-1253.587) [-1257.864] (-1253.183) (-1253.678) * (-1257.229) (-1259.944) [-1256.059] (-1254.904) -- 0:00:29
545000 -- (-1255.949) (-1257.424) (-1257.080) [-1255.499] * [-1254.478] (-1254.244) (-1255.886) (-1254.883) -- 0:00:29
Average standard deviation of split frequencies: 0.011128
545500 -- (-1255.908) (-1256.665) (-1255.742) [-1253.163] * (-1257.265) [-1252.990] (-1253.679) (-1253.688) -- 0:00:29
546000 -- [-1254.064] (-1255.169) (-1254.802) (-1254.812) * (-1254.993) (-1255.930) (-1257.810) [-1252.963] -- 0:00:29
546500 -- [-1254.160] (-1252.922) (-1254.703) (-1258.354) * (-1253.217) (-1256.025) (-1254.537) [-1253.716] -- 0:00:29
547000 -- (-1254.377) (-1255.481) [-1255.414] (-1255.922) * (-1256.327) (-1255.717) (-1256.846) [-1256.361] -- 0:00:28
547500 -- (-1257.038) [-1253.340] (-1254.140) (-1254.100) * [-1253.876] (-1255.103) (-1254.771) (-1252.562) -- 0:00:28
548000 -- (-1256.270) (-1254.163) [-1254.230] (-1253.280) * (-1253.295) (-1258.186) [-1255.296] (-1257.095) -- 0:00:28
548500 -- (-1253.092) (-1254.635) [-1255.037] (-1254.457) * (-1256.857) (-1253.562) [-1258.400] (-1256.119) -- 0:00:28
549000 -- (-1254.197) [-1256.563] (-1253.102) (-1253.631) * [-1253.530] (-1256.434) (-1254.492) (-1256.899) -- 0:00:28
549500 -- (-1254.628) (-1259.431) [-1254.203] (-1255.140) * (-1255.940) (-1253.215) (-1255.874) [-1255.842] -- 0:00:28
550000 -- [-1254.273] (-1255.535) (-1256.178) (-1255.153) * (-1255.129) (-1253.768) (-1255.197) [-1254.108] -- 0:00:28
Average standard deviation of split frequencies: 0.011319
550500 -- (-1256.402) [-1255.360] (-1256.456) (-1253.481) * [-1253.037] (-1253.734) (-1253.659) (-1253.323) -- 0:00:28
551000 -- [-1255.066] (-1253.431) (-1254.965) (-1256.944) * (-1254.114) (-1252.706) (-1252.702) [-1253.745] -- 0:00:28
551500 -- [-1255.118] (-1253.841) (-1257.155) (-1258.727) * (-1253.992) (-1258.989) (-1254.949) [-1253.428] -- 0:00:28
552000 -- (-1255.523) (-1255.002) (-1254.699) [-1254.674] * (-1253.228) (-1257.047) [-1254.767] (-1254.771) -- 0:00:28
552500 -- (-1253.089) (-1254.822) [-1253.572] (-1255.378) * (-1254.435) (-1255.149) (-1253.276) [-1254.149] -- 0:00:28
553000 -- (-1254.788) (-1256.310) [-1253.187] (-1252.971) * (-1254.241) (-1255.303) (-1254.748) [-1253.725] -- 0:00:28
553500 -- [-1254.868] (-1253.387) (-1253.528) (-1254.495) * (-1254.664) (-1253.544) (-1255.666) [-1254.873] -- 0:00:28
554000 -- (-1258.673) (-1254.247) [-1253.877] (-1254.959) * [-1257.583] (-1253.767) (-1259.654) (-1256.479) -- 0:00:28
554500 -- (-1258.338) (-1253.010) [-1253.206] (-1255.113) * (-1254.852) (-1253.509) (-1257.000) [-1253.124] -- 0:00:28
555000 -- (-1254.847) (-1254.560) [-1253.589] (-1256.438) * [-1254.345] (-1254.591) (-1253.860) (-1254.081) -- 0:00:28
Average standard deviation of split frequencies: 0.011446
555500 -- (-1255.720) (-1254.157) (-1255.439) [-1254.118] * (-1261.144) [-1253.700] (-1253.827) (-1254.150) -- 0:00:28
556000 -- (-1254.534) (-1255.463) (-1254.014) [-1255.524] * (-1256.255) [-1252.550] (-1255.083) (-1254.898) -- 0:00:28
556500 -- [-1253.251] (-1256.236) (-1253.197) (-1256.089) * (-1261.770) (-1255.103) [-1255.358] (-1254.691) -- 0:00:28
557000 -- (-1254.592) (-1253.284) [-1253.513] (-1258.031) * (-1254.081) (-1253.689) [-1252.851] (-1256.763) -- 0:00:28
557500 -- [-1253.235] (-1253.322) (-1254.533) (-1254.867) * [-1255.078] (-1257.100) (-1254.235) (-1258.385) -- 0:00:28
558000 -- (-1258.547) (-1259.221) (-1253.241) [-1254.963] * (-1253.769) (-1255.993) [-1253.304] (-1259.318) -- 0:00:28
558500 -- [-1253.196] (-1254.056) (-1256.447) (-1254.444) * (-1254.226) (-1253.606) [-1253.451] (-1256.642) -- 0:00:28
559000 -- [-1256.132] (-1253.059) (-1253.363) (-1259.260) * (-1254.855) [-1253.534] (-1258.118) (-1254.983) -- 0:00:28
559500 -- (-1254.702) (-1257.159) (-1254.510) [-1255.980] * (-1254.010) (-1257.155) [-1254.659] (-1256.639) -- 0:00:28
560000 -- (-1255.199) (-1258.278) [-1253.831] (-1253.471) * (-1253.814) (-1256.040) [-1253.614] (-1254.299) -- 0:00:28
Average standard deviation of split frequencies: 0.011508
560500 -- (-1256.449) (-1254.776) [-1255.023] (-1254.400) * (-1253.791) (-1255.543) [-1252.711] (-1252.736) -- 0:00:28
561000 -- [-1259.693] (-1252.643) (-1253.777) (-1252.758) * (-1257.406) [-1254.835] (-1254.680) (-1253.434) -- 0:00:28
561500 -- (-1254.985) [-1254.211] (-1257.024) (-1252.837) * (-1257.235) (-1255.500) (-1253.970) [-1256.445] -- 0:00:28
562000 -- (-1257.058) (-1253.321) (-1253.636) [-1254.103] * (-1253.439) (-1258.217) (-1256.190) [-1252.839] -- 0:00:28
562500 -- (-1254.211) (-1254.859) [-1255.293] (-1255.454) * (-1253.351) (-1255.204) (-1253.233) [-1252.986] -- 0:00:28
563000 -- (-1254.603) (-1253.642) (-1254.918) [-1255.459] * (-1254.186) (-1256.301) [-1255.053] (-1256.196) -- 0:00:27
563500 -- (-1259.155) [-1253.169] (-1254.150) (-1253.787) * [-1259.029] (-1256.967) (-1254.404) (-1252.577) -- 0:00:27
564000 -- (-1253.608) (-1252.843) [-1253.763] (-1253.549) * (-1261.078) (-1254.154) (-1253.556) [-1255.694] -- 0:00:27
564500 -- [-1254.075] (-1254.047) (-1254.864) (-1253.530) * (-1255.531) [-1254.565] (-1259.488) (-1258.808) -- 0:00:27
565000 -- (-1254.259) (-1253.304) (-1253.336) [-1253.923] * (-1256.276) (-1253.839) (-1253.296) [-1254.997] -- 0:00:27
Average standard deviation of split frequencies: 0.011920
565500 -- (-1257.383) [-1253.256] (-1253.617) (-1255.211) * (-1253.813) (-1257.201) [-1255.401] (-1259.531) -- 0:00:27
566000 -- (-1254.613) (-1259.086) (-1255.699) [-1254.856] * (-1253.146) [-1253.379] (-1252.829) (-1257.423) -- 0:00:27
566500 -- [-1252.981] (-1256.428) (-1252.759) (-1255.415) * (-1252.611) [-1252.558] (-1253.348) (-1257.475) -- 0:00:27
567000 -- [-1253.952] (-1253.197) (-1254.570) (-1252.910) * (-1252.611) (-1253.333) [-1254.648] (-1259.894) -- 0:00:27
567500 -- (-1255.224) (-1253.736) (-1254.169) [-1253.061] * [-1253.151] (-1256.280) (-1253.696) (-1256.071) -- 0:00:27
568000 -- [-1252.891] (-1253.052) (-1253.376) (-1255.271) * (-1253.258) (-1253.662) (-1256.997) [-1254.641] -- 0:00:27
568500 -- (-1253.442) (-1254.111) (-1255.145) [-1254.267] * (-1253.108) (-1253.594) (-1254.213) [-1253.738] -- 0:00:27
569000 -- (-1252.347) [-1253.553] (-1255.681) (-1254.075) * (-1256.973) [-1255.331] (-1254.432) (-1255.640) -- 0:00:27
569500 -- [-1252.316] (-1253.038) (-1252.874) (-1253.924) * (-1258.656) (-1255.695) (-1256.649) [-1253.704] -- 0:00:27
570000 -- (-1252.787) (-1255.138) (-1255.178) [-1259.849] * (-1255.023) (-1252.730) (-1254.240) [-1255.347] -- 0:00:27
Average standard deviation of split frequencies: 0.011565
570500 -- (-1256.275) (-1256.236) (-1257.262) [-1253.994] * (-1255.401) (-1252.834) (-1256.132) [-1252.323] -- 0:00:27
571000 -- (-1255.628) (-1255.912) [-1256.012] (-1258.007) * (-1258.033) [-1252.754] (-1252.743) (-1252.317) -- 0:00:27
571500 -- (-1253.184) [-1254.215] (-1255.807) (-1258.811) * (-1257.493) [-1254.367] (-1256.285) (-1253.943) -- 0:00:27
572000 -- (-1256.649) [-1253.683] (-1253.529) (-1255.172) * (-1256.616) (-1254.365) [-1255.663] (-1255.339) -- 0:00:27
572500 -- [-1254.954] (-1254.734) (-1257.153) (-1258.696) * (-1254.626) (-1261.595) (-1254.201) [-1253.734] -- 0:00:27
573000 -- (-1253.492) [-1261.408] (-1256.998) (-1258.606) * (-1253.433) (-1255.477) (-1256.638) [-1253.062] -- 0:00:27
573500 -- [-1253.857] (-1254.599) (-1253.087) (-1259.671) * (-1255.235) [-1252.602] (-1254.988) (-1253.355) -- 0:00:27
574000 -- (-1255.420) (-1254.339) [-1253.867] (-1261.039) * (-1255.558) (-1253.991) [-1253.467] (-1254.096) -- 0:00:27
574500 -- (-1253.721) [-1253.809] (-1254.855) (-1254.142) * (-1256.635) (-1254.392) [-1252.865] (-1253.367) -- 0:00:27
575000 -- (-1253.855) (-1254.907) [-1253.503] (-1255.172) * (-1254.409) (-1253.867) (-1252.561) [-1253.168] -- 0:00:27
Average standard deviation of split frequencies: 0.011602
575500 -- (-1257.332) (-1254.546) [-1254.276] (-1254.208) * (-1257.435) [-1255.224] (-1252.799) (-1254.725) -- 0:00:27
576000 -- (-1254.033) [-1252.768] (-1256.539) (-1256.803) * (-1256.137) (-1253.988) (-1258.093) [-1253.126] -- 0:00:27
576500 -- [-1254.038] (-1252.623) (-1252.719) (-1253.361) * [-1254.742] (-1254.926) (-1253.005) (-1252.852) -- 0:00:27
577000 -- (-1254.492) [-1256.146] (-1255.259) (-1254.911) * (-1256.397) (-1253.708) [-1253.371] (-1254.975) -- 0:00:27
577500 -- (-1252.725) (-1253.391) [-1254.975] (-1260.186) * (-1253.381) [-1257.544] (-1253.889) (-1258.844) -- 0:00:27
578000 -- (-1254.563) (-1253.158) [-1253.488] (-1258.995) * [-1253.481] (-1257.717) (-1253.674) (-1253.667) -- 0:00:27
578500 -- (-1256.344) (-1253.441) (-1253.770) [-1255.086] * (-1252.782) (-1262.235) [-1253.771] (-1257.584) -- 0:00:26
579000 -- (-1255.922) [-1256.255] (-1255.854) (-1256.364) * (-1253.352) (-1254.530) (-1256.278) [-1253.598] -- 0:00:26
579500 -- (-1254.936) [-1258.014] (-1255.281) (-1255.701) * (-1253.253) (-1254.968) (-1255.729) [-1255.055] -- 0:00:26
580000 -- (-1256.107) [-1256.474] (-1258.012) (-1254.525) * [-1253.595] (-1253.489) (-1256.893) (-1254.978) -- 0:00:26
Average standard deviation of split frequencies: 0.011112
580500 -- (-1253.379) [-1254.645] (-1254.676) (-1252.821) * [-1254.335] (-1253.564) (-1255.607) (-1256.810) -- 0:00:26
581000 -- (-1254.388) [-1253.522] (-1252.446) (-1253.621) * (-1256.850) (-1254.105) [-1253.125] (-1256.787) -- 0:00:26
581500 -- (-1254.226) [-1255.970] (-1252.900) (-1254.925) * (-1258.207) (-1257.907) [-1254.984] (-1254.349) -- 0:00:26
582000 -- (-1256.401) [-1254.922] (-1256.093) (-1254.130) * (-1252.742) [-1253.620] (-1257.782) (-1253.480) -- 0:00:26
582500 -- (-1254.084) [-1254.955] (-1257.003) (-1254.617) * [-1254.394] (-1254.078) (-1258.075) (-1254.060) -- 0:00:26
583000 -- (-1254.194) [-1254.130] (-1255.209) (-1256.363) * (-1255.898) (-1255.713) [-1253.044] (-1253.940) -- 0:00:26
583500 -- (-1253.984) (-1253.618) [-1254.504] (-1255.669) * [-1253.777] (-1253.966) (-1255.180) (-1253.897) -- 0:00:26
584000 -- [-1257.152] (-1255.179) (-1254.414) (-1254.395) * (-1254.084) (-1255.213) [-1256.287] (-1253.696) -- 0:00:26
584500 -- (-1256.000) [-1255.012] (-1260.044) (-1254.629) * (-1252.787) (-1257.184) [-1260.086] (-1255.775) -- 0:00:26
585000 -- (-1255.679) (-1253.429) [-1257.481] (-1253.500) * [-1253.008] (-1254.980) (-1256.689) (-1254.472) -- 0:00:26
Average standard deviation of split frequencies: 0.011452
585500 -- (-1260.474) [-1254.677] (-1258.367) (-1253.257) * (-1254.987) (-1256.981) [-1254.931] (-1256.642) -- 0:00:26
586000 -- [-1254.593] (-1252.917) (-1255.958) (-1253.871) * [-1255.469] (-1253.317) (-1254.450) (-1253.157) -- 0:00:26
586500 -- (-1253.619) (-1254.675) [-1256.925] (-1253.329) * (-1252.967) [-1253.553] (-1254.977) (-1252.420) -- 0:00:26
587000 -- [-1253.905] (-1256.976) (-1259.898) (-1255.705) * (-1254.784) (-1257.887) [-1258.266] (-1252.281) -- 0:00:26
587500 -- (-1253.223) (-1256.151) [-1253.875] (-1253.473) * [-1253.762] (-1254.821) (-1253.662) (-1253.799) -- 0:00:26
588000 -- (-1256.440) (-1254.016) [-1253.875] (-1257.507) * (-1253.799) [-1258.472] (-1254.926) (-1254.214) -- 0:00:26
588500 -- (-1255.018) (-1253.500) (-1253.837) [-1259.785] * (-1254.590) (-1255.518) (-1255.134) [-1253.862] -- 0:00:26
589000 -- (-1253.472) [-1252.768] (-1256.417) (-1254.065) * (-1254.403) (-1258.947) [-1256.685] (-1252.721) -- 0:00:26
589500 -- (-1254.061) [-1252.714] (-1256.054) (-1255.355) * (-1255.610) (-1259.506) [-1255.768] (-1257.332) -- 0:00:26
590000 -- (-1252.943) (-1253.008) (-1255.279) [-1257.649] * (-1256.306) (-1259.969) [-1253.518] (-1256.024) -- 0:00:26
Average standard deviation of split frequencies: 0.011173
590500 -- (-1255.175) (-1252.741) (-1252.934) [-1255.420] * (-1253.570) (-1256.461) [-1253.373] (-1255.600) -- 0:00:26
591000 -- (-1255.134) (-1257.217) [-1253.908] (-1252.742) * [-1253.169] (-1254.491) (-1252.437) (-1258.148) -- 0:00:26
591500 -- [-1257.865] (-1258.491) (-1255.497) (-1254.004) * (-1254.728) [-1255.453] (-1252.556) (-1255.109) -- 0:00:26
592000 -- (-1255.892) (-1253.744) (-1258.815) [-1254.144] * (-1253.898) (-1254.446) (-1252.739) [-1255.364] -- 0:00:26
592500 -- [-1253.482] (-1253.760) (-1254.230) (-1253.246) * [-1253.667] (-1253.833) (-1252.747) (-1256.613) -- 0:00:26
593000 -- (-1255.196) (-1255.012) [-1254.746] (-1256.461) * (-1252.611) [-1252.889] (-1256.108) (-1254.880) -- 0:00:26
593500 -- (-1258.092) (-1253.910) (-1255.012) [-1253.878] * (-1253.617) (-1253.719) (-1253.700) [-1252.728] -- 0:00:26
594000 -- (-1255.487) (-1253.825) (-1255.349) [-1256.225] * (-1254.140) (-1254.292) (-1253.838) [-1254.076] -- 0:00:25
594500 -- (-1253.499) (-1253.741) (-1254.134) [-1254.899] * (-1253.794) [-1253.525] (-1254.884) (-1253.847) -- 0:00:25
595000 -- (-1253.898) (-1254.163) (-1254.841) [-1253.049] * [-1253.305] (-1253.745) (-1253.619) (-1255.191) -- 0:00:25
Average standard deviation of split frequencies: 0.011492
595500 -- (-1255.506) (-1257.195) [-1253.593] (-1259.521) * (-1255.376) (-1255.389) [-1253.250] (-1255.977) -- 0:00:25
596000 -- [-1253.105] (-1256.814) (-1254.230) (-1257.165) * (-1259.818) [-1254.010] (-1255.114) (-1254.590) -- 0:00:25
596500 -- (-1256.152) (-1260.558) (-1253.672) [-1256.101] * [-1256.368] (-1252.987) (-1252.912) (-1252.837) -- 0:00:25
597000 -- (-1257.493) [-1255.205] (-1253.063) (-1255.489) * (-1253.559) (-1254.586) (-1253.501) [-1254.299] -- 0:00:25
597500 -- [-1253.861] (-1253.948) (-1253.063) (-1255.142) * [-1253.575] (-1252.960) (-1253.527) (-1254.055) -- 0:00:25
598000 -- [-1256.942] (-1253.717) (-1253.621) (-1256.778) * (-1253.561) (-1253.539) (-1254.957) [-1259.368] -- 0:00:25
598500 -- (-1257.359) (-1255.367) [-1255.803] (-1253.436) * [-1254.014] (-1253.838) (-1257.544) (-1252.965) -- 0:00:25
599000 -- (-1252.863) [-1253.242] (-1255.252) (-1255.369) * (-1254.942) (-1254.523) (-1256.007) [-1252.966] -- 0:00:25
599500 -- [-1252.833] (-1254.611) (-1254.192) (-1253.037) * [-1255.404] (-1253.729) (-1256.177) (-1254.885) -- 0:00:25
600000 -- (-1255.188) (-1252.572) (-1256.069) [-1254.326] * (-1255.941) (-1253.595) (-1252.721) [-1260.039] -- 0:00:25
Average standard deviation of split frequencies: 0.011911
600500 -- (-1254.609) [-1254.683] (-1253.540) (-1255.926) * (-1254.831) (-1253.543) (-1257.429) [-1259.245] -- 0:00:25
601000 -- (-1254.083) (-1253.795) [-1254.604] (-1254.517) * (-1254.867) (-1260.254) [-1254.726] (-1257.990) -- 0:00:25
601500 -- [-1252.947] (-1262.721) (-1253.679) (-1256.412) * (-1256.069) (-1256.276) (-1254.013) [-1255.497] -- 0:00:25
602000 -- (-1253.244) (-1261.578) [-1253.711] (-1258.008) * [-1255.226] (-1254.802) (-1253.927) (-1252.989) -- 0:00:25
602500 -- [-1255.656] (-1256.913) (-1253.722) (-1255.015) * (-1259.338) (-1258.307) (-1255.225) [-1252.644] -- 0:00:25
603000 -- (-1254.013) (-1254.757) (-1255.596) [-1255.953] * (-1257.592) (-1256.617) [-1254.062] (-1252.654) -- 0:00:25
603500 -- (-1254.243) (-1254.661) (-1254.236) [-1256.738] * (-1254.906) [-1252.486] (-1255.004) (-1252.654) -- 0:00:25
604000 -- (-1258.208) [-1254.163] (-1253.749) (-1256.561) * [-1255.386] (-1252.502) (-1254.702) (-1254.782) -- 0:00:25
604500 -- [-1254.271] (-1252.890) (-1253.677) (-1255.748) * (-1257.007) [-1254.897] (-1254.162) (-1253.926) -- 0:00:25
605000 -- (-1255.284) (-1253.649) (-1252.827) [-1253.538] * [-1256.730] (-1255.018) (-1255.899) (-1258.403) -- 0:00:25
Average standard deviation of split frequencies: 0.011577
605500 -- (-1252.919) [-1253.486] (-1253.554) (-1255.145) * (-1253.091) (-1254.213) (-1254.005) [-1255.435] -- 0:00:25
606000 -- [-1253.512] (-1254.463) (-1253.505) (-1255.075) * [-1252.768] (-1256.153) (-1256.200) (-1255.799) -- 0:00:25
606500 -- [-1253.260] (-1254.464) (-1253.339) (-1253.851) * (-1255.328) (-1259.646) (-1260.459) [-1255.583] -- 0:00:25
607000 -- [-1255.044] (-1253.855) (-1254.251) (-1253.903) * [-1254.541] (-1254.576) (-1255.466) (-1260.196) -- 0:00:25
607500 -- (-1253.691) [-1253.253] (-1258.269) (-1255.746) * [-1257.856] (-1253.871) (-1255.205) (-1259.481) -- 0:00:25
608000 -- (-1253.869) (-1259.274) [-1257.072] (-1254.340) * [-1252.755] (-1253.871) (-1256.948) (-1255.428) -- 0:00:25
608500 -- [-1256.026] (-1258.981) (-1255.513) (-1254.222) * (-1253.098) [-1252.796] (-1252.793) (-1256.115) -- 0:00:25
609000 -- [-1254.697] (-1256.192) (-1254.394) (-1258.068) * (-1255.302) (-1255.678) (-1254.275) [-1254.713] -- 0:00:25
609500 -- (-1255.100) (-1253.203) (-1255.065) [-1255.163] * (-1256.577) [-1255.275] (-1258.341) (-1258.218) -- 0:00:24
610000 -- (-1253.540) [-1252.910] (-1255.689) (-1253.484) * (-1253.674) [-1253.022] (-1258.313) (-1255.335) -- 0:00:24
Average standard deviation of split frequencies: 0.011988
610500 -- [-1256.768] (-1253.798) (-1256.105) (-1253.847) * (-1253.674) (-1255.146) (-1256.125) [-1254.751] -- 0:00:24
611000 -- (-1254.223) [-1257.062] (-1256.810) (-1253.667) * (-1253.478) (-1254.328) (-1253.247) [-1253.332] -- 0:00:24
611500 -- (-1256.557) (-1255.907) [-1253.132] (-1254.917) * [-1253.581] (-1255.255) (-1255.745) (-1253.677) -- 0:00:24
612000 -- [-1254.287] (-1255.527) (-1258.096) (-1254.113) * (-1253.965) (-1254.158) (-1254.684) [-1256.269] -- 0:00:24
612500 -- [-1254.385] (-1252.499) (-1254.505) (-1254.648) * (-1253.452) (-1256.240) (-1255.084) [-1255.255] -- 0:00:24
613000 -- (-1253.724) (-1253.421) (-1254.209) [-1255.939] * [-1255.296] (-1258.914) (-1253.981) (-1256.025) -- 0:00:24
613500 -- (-1254.330) (-1252.667) (-1255.459) [-1253.851] * (-1253.552) [-1255.810] (-1255.545) (-1254.701) -- 0:00:24
614000 -- (-1255.898) (-1255.080) [-1256.757] (-1255.932) * [-1254.151] (-1253.861) (-1253.060) (-1253.593) -- 0:00:24
614500 -- (-1255.954) [-1254.715] (-1256.343) (-1254.418) * (-1253.192) [-1255.790] (-1254.774) (-1254.462) -- 0:00:24
615000 -- (-1253.386) (-1257.648) (-1256.115) [-1254.905] * (-1253.797) (-1255.367) (-1255.509) [-1257.311] -- 0:00:24
Average standard deviation of split frequencies: 0.011839
615500 -- (-1252.530) (-1252.974) (-1255.797) [-1253.604] * [-1253.922] (-1254.193) (-1253.676) (-1253.422) -- 0:00:24
616000 -- (-1254.882) [-1252.690] (-1254.119) (-1254.734) * [-1254.713] (-1255.598) (-1256.290) (-1256.326) -- 0:00:24
616500 -- (-1256.033) [-1253.789] (-1254.244) (-1254.999) * (-1260.059) (-1253.845) (-1255.032) [-1256.276] -- 0:00:24
617000 -- (-1252.925) [-1252.602] (-1255.759) (-1252.941) * (-1254.891) [-1253.125] (-1256.859) (-1256.667) -- 0:00:24
617500 -- (-1256.503) (-1255.139) [-1255.099] (-1252.686) * [-1254.108] (-1253.627) (-1255.222) (-1255.296) -- 0:00:24
618000 -- (-1255.617) [-1253.363] (-1255.717) (-1253.143) * (-1254.638) [-1253.585] (-1254.661) (-1253.974) -- 0:00:24
618500 -- (-1253.038) [-1253.400] (-1254.235) (-1253.817) * (-1254.322) (-1253.876) [-1256.014] (-1257.926) -- 0:00:24
619000 -- (-1254.180) [-1252.467] (-1256.929) (-1255.071) * (-1254.912) (-1256.270) [-1258.215] (-1254.940) -- 0:00:24
619500 -- (-1261.098) [-1253.960] (-1256.088) (-1254.109) * [-1252.767] (-1253.884) (-1256.329) (-1256.157) -- 0:00:24
620000 -- (-1258.891) (-1253.249) (-1253.368) [-1254.265] * (-1254.315) [-1254.266] (-1253.676) (-1255.188) -- 0:00:24
Average standard deviation of split frequencies: 0.012197
620500 -- [-1252.764] (-1252.683) (-1257.127) (-1254.837) * (-1254.390) [-1256.337] (-1253.966) (-1254.459) -- 0:00:24
621000 -- (-1256.132) (-1253.607) [-1253.361] (-1254.870) * [-1254.653] (-1254.919) (-1253.204) (-1254.650) -- 0:00:24
621500 -- [-1257.714] (-1252.895) (-1253.313) (-1258.259) * (-1255.981) (-1254.870) [-1254.262] (-1257.443) -- 0:00:24
622000 -- [-1254.665] (-1253.287) (-1252.789) (-1256.151) * (-1255.415) [-1253.498] (-1254.043) (-1254.660) -- 0:00:24
622500 -- (-1253.566) [-1253.844] (-1253.529) (-1257.553) * (-1256.285) [-1252.841] (-1253.991) (-1254.603) -- 0:00:24
623000 -- (-1255.860) (-1255.102) [-1253.642] (-1253.932) * (-1253.766) (-1254.154) (-1259.045) [-1254.798] -- 0:00:24
623500 -- (-1256.696) [-1254.487] (-1253.480) (-1254.195) * [-1259.997] (-1259.484) (-1259.105) (-1253.053) -- 0:00:24
624000 -- (-1259.494) (-1254.810) (-1253.920) [-1256.913] * (-1255.980) (-1256.753) (-1256.532) [-1253.085] -- 0:00:24
624500 -- (-1253.690) (-1255.015) [-1253.549] (-1254.421) * (-1258.361) [-1256.988] (-1257.620) (-1253.538) -- 0:00:24
625000 -- (-1255.893) (-1254.895) (-1253.035) [-1255.095] * [-1255.963] (-1255.110) (-1253.123) (-1253.838) -- 0:00:24
Average standard deviation of split frequencies: 0.011547
625500 -- (-1256.680) (-1255.897) (-1253.826) [-1252.946] * [-1254.227] (-1254.010) (-1254.853) (-1254.419) -- 0:00:23
626000 -- (-1255.646) (-1257.607) (-1253.910) [-1254.152] * (-1255.126) [-1254.664] (-1252.959) (-1254.968) -- 0:00:23
626500 -- [-1257.494] (-1256.021) (-1253.867) (-1253.286) * (-1252.961) [-1253.001] (-1252.960) (-1256.711) -- 0:00:23
627000 -- (-1258.472) (-1255.553) [-1253.591] (-1252.842) * (-1254.671) (-1253.166) [-1253.528] (-1257.643) -- 0:00:23
627500 -- (-1254.307) (-1258.353) (-1253.122) [-1253.247] * [-1254.069] (-1253.539) (-1254.804) (-1254.169) -- 0:00:23
628000 -- (-1253.142) (-1252.698) (-1254.768) [-1254.084] * (-1253.409) [-1258.831] (-1255.866) (-1253.602) -- 0:00:23
628500 -- (-1253.362) [-1253.511] (-1254.936) (-1253.827) * (-1255.311) [-1255.014] (-1254.396) (-1254.564) -- 0:00:23
629000 -- (-1255.857) (-1253.966) [-1260.674] (-1253.864) * (-1255.556) (-1257.566) [-1254.926] (-1253.260) -- 0:00:23
629500 -- (-1253.867) [-1256.494] (-1255.631) (-1255.154) * (-1254.006) [-1253.364] (-1252.706) (-1254.594) -- 0:00:23
630000 -- (-1254.060) [-1253.435] (-1260.528) (-1257.521) * (-1254.064) (-1260.141) [-1255.107] (-1256.753) -- 0:00:23
Average standard deviation of split frequencies: 0.010465
630500 -- (-1253.510) [-1253.976] (-1256.809) (-1253.712) * [-1255.705] (-1256.018) (-1258.815) (-1253.981) -- 0:00:23
631000 -- (-1252.989) (-1256.885) (-1253.021) [-1255.533] * (-1256.952) (-1255.842) (-1254.323) [-1253.870] -- 0:00:23
631500 -- (-1254.228) (-1256.113) [-1252.469] (-1253.785) * (-1255.242) (-1253.062) (-1254.721) [-1253.196] -- 0:00:23
632000 -- [-1254.236] (-1257.751) (-1254.119) (-1257.194) * [-1254.371] (-1259.677) (-1256.784) (-1253.219) -- 0:00:23
632500 -- [-1254.230] (-1256.885) (-1255.345) (-1257.364) * (-1254.503) [-1255.032] (-1253.462) (-1254.360) -- 0:00:23
633000 -- (-1254.222) (-1252.835) [-1256.049] (-1253.935) * (-1253.396) (-1254.819) [-1254.789] (-1256.146) -- 0:00:23
633500 -- (-1253.095) [-1253.308] (-1257.597) (-1253.979) * (-1254.278) [-1255.195] (-1253.057) (-1253.322) -- 0:00:23
634000 -- (-1254.743) (-1255.289) (-1257.689) [-1253.633] * [-1253.288] (-1252.872) (-1253.494) (-1253.040) -- 0:00:23
634500 -- (-1255.312) [-1253.714] (-1255.415) (-1254.189) * [-1252.839] (-1253.207) (-1255.319) (-1253.927) -- 0:00:23
635000 -- (-1253.016) (-1254.134) (-1258.591) [-1253.117] * (-1254.445) (-1253.321) [-1255.318] (-1254.670) -- 0:00:23
Average standard deviation of split frequencies: 0.009941
635500 -- (-1252.803) (-1253.650) (-1257.701) [-1254.571] * (-1257.902) (-1256.456) (-1256.293) [-1253.172] -- 0:00:23
636000 -- (-1255.878) [-1253.646] (-1253.614) (-1253.260) * (-1253.653) (-1253.206) (-1255.304) [-1255.024] -- 0:00:23
636500 -- [-1252.998] (-1253.111) (-1252.840) (-1253.197) * (-1254.711) (-1255.108) (-1253.246) [-1253.618] -- 0:00:23
637000 -- (-1252.896) (-1260.308) [-1255.646] (-1255.299) * (-1254.719) (-1255.242) (-1257.697) [-1253.591] -- 0:00:23
637500 -- [-1254.771] (-1253.393) (-1254.272) (-1254.296) * (-1253.855) (-1255.358) [-1255.733] (-1253.748) -- 0:00:23
638000 -- (-1255.859) (-1258.220) (-1256.500) [-1253.800] * [-1257.821] (-1255.255) (-1253.247) (-1254.376) -- 0:00:23
638500 -- (-1254.114) [-1252.415] (-1256.466) (-1255.241) * (-1253.700) [-1255.304] (-1252.738) (-1254.936) -- 0:00:23
639000 -- [-1254.678] (-1254.832) (-1258.635) (-1255.570) * [-1254.913] (-1255.090) (-1259.680) (-1253.420) -- 0:00:23
639500 -- [-1253.904] (-1255.015) (-1254.279) (-1255.713) * (-1254.011) [-1255.692] (-1259.375) (-1252.761) -- 0:00:23
640000 -- [-1252.623] (-1255.599) (-1256.581) (-1253.638) * (-1252.897) [-1254.286] (-1253.527) (-1252.832) -- 0:00:23
Average standard deviation of split frequencies: 0.009320
640500 -- (-1252.561) (-1259.031) [-1255.873] (-1256.490) * (-1252.230) [-1253.914] (-1252.686) (-1253.206) -- 0:00:23
641000 -- (-1252.523) (-1256.215) [-1253.497] (-1255.677) * [-1254.047] (-1253.594) (-1254.113) (-1253.636) -- 0:00:22
641500 -- [-1254.816] (-1255.121) (-1253.472) (-1255.489) * [-1254.074] (-1255.054) (-1253.978) (-1256.618) -- 0:00:22
642000 -- (-1254.602) (-1255.128) [-1253.943] (-1255.187) * (-1257.502) (-1254.049) [-1254.623] (-1253.137) -- 0:00:22
642500 -- [-1255.010] (-1254.549) (-1253.945) (-1253.423) * [-1256.310] (-1257.596) (-1252.877) (-1255.672) -- 0:00:22
643000 -- (-1254.927) [-1253.701] (-1253.457) (-1253.470) * (-1255.138) [-1252.795] (-1254.521) (-1256.978) -- 0:00:22
643500 -- [-1253.161] (-1253.868) (-1254.638) (-1256.373) * [-1255.098] (-1255.027) (-1253.227) (-1257.031) -- 0:00:22
644000 -- (-1255.456) [-1254.541] (-1256.237) (-1257.900) * [-1254.276] (-1254.522) (-1252.667) (-1255.954) -- 0:00:22
644500 -- (-1255.521) (-1255.057) [-1253.560] (-1259.346) * (-1258.160) [-1253.844] (-1252.668) (-1254.330) -- 0:00:22
645000 -- (-1258.232) (-1256.046) (-1254.546) [-1255.800] * (-1257.264) [-1255.863] (-1253.367) (-1254.172) -- 0:00:22
Average standard deviation of split frequencies: 0.009229
645500 -- (-1256.995) [-1255.794] (-1254.405) (-1255.393) * (-1255.548) [-1254.768] (-1255.218) (-1258.720) -- 0:00:22
646000 -- (-1258.992) (-1256.867) [-1254.792] (-1256.098) * [-1254.006] (-1253.918) (-1254.223) (-1256.516) -- 0:00:22
646500 -- (-1255.597) (-1252.801) [-1255.761] (-1262.326) * (-1253.363) (-1252.534) [-1252.830] (-1256.896) -- 0:00:22
647000 -- (-1253.342) (-1252.497) (-1258.131) [-1257.557] * (-1252.596) (-1254.536) (-1253.692) [-1253.295] -- 0:00:22
647500 -- [-1255.221] (-1253.337) (-1255.294) (-1256.066) * (-1254.362) (-1255.739) [-1253.530] (-1254.459) -- 0:00:22
648000 -- [-1254.245] (-1258.380) (-1255.522) (-1257.100) * [-1255.647] (-1256.565) (-1259.314) (-1254.472) -- 0:00:22
648500 -- (-1254.147) (-1253.626) (-1255.692) [-1258.265] * (-1254.040) (-1255.966) (-1253.050) [-1258.776] -- 0:00:22
649000 -- (-1255.662) (-1253.404) [-1252.997] (-1254.602) * (-1253.572) (-1253.725) [-1252.869] (-1257.688) -- 0:00:22
649500 -- (-1254.902) (-1261.027) [-1252.498] (-1254.057) * (-1254.274) (-1253.766) (-1252.390) [-1253.337] -- 0:00:22
650000 -- (-1253.729) (-1252.888) (-1254.800) [-1253.163] * (-1252.806) (-1254.303) (-1252.325) [-1257.732] -- 0:00:22
Average standard deviation of split frequencies: 0.009853
650500 -- (-1254.226) (-1254.864) [-1253.444] (-1254.459) * (-1257.506) (-1253.545) [-1252.325] (-1256.515) -- 0:00:22
651000 -- [-1258.215] (-1254.239) (-1254.380) (-1255.256) * (-1253.977) (-1254.047) (-1253.075) [-1255.550] -- 0:00:22
651500 -- (-1257.431) [-1254.644] (-1255.768) (-1254.223) * (-1253.643) [-1255.813] (-1255.457) (-1254.160) -- 0:00:22
652000 -- (-1254.884) [-1254.611] (-1255.783) (-1256.246) * (-1252.773) (-1254.262) (-1254.869) [-1254.166] -- 0:00:22
652500 -- (-1256.664) (-1256.149) (-1255.331) [-1260.443] * [-1255.809] (-1255.533) (-1256.596) (-1255.381) -- 0:00:22
653000 -- (-1256.572) (-1254.675) (-1254.421) [-1253.946] * (-1256.214) (-1253.513) [-1256.459] (-1257.169) -- 0:00:22
653500 -- (-1255.716) (-1253.977) [-1260.649] (-1257.225) * [-1252.963] (-1253.290) (-1257.056) (-1257.402) -- 0:00:22
654000 -- [-1254.158] (-1254.656) (-1254.902) (-1259.468) * (-1252.729) [-1255.473] (-1252.660) (-1254.751) -- 0:00:22
654500 -- (-1253.686) (-1256.934) (-1255.538) [-1256.176] * (-1253.326) (-1252.921) (-1259.053) [-1253.437] -- 0:00:22
655000 -- (-1252.762) (-1254.132) (-1255.065) [-1253.919] * (-1253.929) [-1253.693] (-1254.006) (-1255.040) -- 0:00:22
Average standard deviation of split frequencies: 0.009677
655500 -- (-1255.471) (-1255.350) (-1259.233) [-1253.587] * (-1253.920) (-1252.979) [-1253.031] (-1253.747) -- 0:00:22
656000 -- (-1254.422) (-1255.785) (-1254.949) [-1253.843] * (-1253.825) (-1252.390) [-1258.144] (-1256.035) -- 0:00:22
656500 -- [-1254.344] (-1255.780) (-1254.732) (-1254.500) * (-1253.743) (-1252.379) [-1253.734] (-1254.907) -- 0:00:21
657000 -- (-1254.606) (-1255.166) [-1258.059] (-1255.171) * (-1252.498) [-1253.025] (-1254.426) (-1255.906) -- 0:00:21
657500 -- (-1256.292) (-1254.602) [-1256.486] (-1255.979) * (-1254.092) (-1260.732) [-1256.115] (-1256.496) -- 0:00:21
658000 -- [-1256.144] (-1253.508) (-1254.432) (-1253.472) * (-1255.856) (-1256.616) (-1255.797) [-1254.362] -- 0:00:21
658500 -- (-1254.978) [-1256.145] (-1255.161) (-1258.198) * [-1254.028] (-1253.574) (-1253.639) (-1253.892) -- 0:00:21
659000 -- [-1254.343] (-1256.000) (-1252.326) (-1257.774) * (-1255.440) (-1254.574) [-1253.622] (-1254.513) -- 0:00:21
659500 -- [-1259.362] (-1255.428) (-1252.409) (-1252.913) * (-1254.651) (-1254.465) [-1256.758] (-1254.529) -- 0:00:21
660000 -- (-1256.339) [-1255.157] (-1255.320) (-1257.855) * (-1254.737) (-1253.418) (-1254.599) [-1253.407] -- 0:00:21
Average standard deviation of split frequencies: 0.010034
660500 -- (-1253.810) [-1254.400] (-1254.923) (-1253.568) * [-1253.059] (-1254.059) (-1259.544) (-1254.678) -- 0:00:21
661000 -- (-1258.558) (-1254.381) (-1254.462) [-1258.113] * (-1253.748) (-1252.942) (-1255.293) [-1255.938] -- 0:00:21
661500 -- (-1254.921) (-1254.378) (-1254.317) [-1255.123] * (-1253.301) [-1254.478] (-1253.946) (-1255.412) -- 0:00:21
662000 -- (-1255.038) (-1255.216) (-1257.558) [-1254.493] * (-1254.482) (-1255.738) [-1254.945] (-1254.980) -- 0:00:21
662500 -- [-1252.742] (-1253.747) (-1253.531) (-1254.530) * (-1252.711) (-1255.661) [-1252.571] (-1255.195) -- 0:00:21
663000 -- (-1254.456) (-1254.552) (-1256.351) [-1257.179] * [-1254.243] (-1253.985) (-1255.402) (-1253.549) -- 0:00:21
663500 -- [-1255.099] (-1256.897) (-1258.836) (-1256.806) * [-1255.780] (-1252.905) (-1258.804) (-1253.392) -- 0:00:21
664000 -- [-1253.562] (-1254.342) (-1253.621) (-1257.672) * (-1259.002) (-1254.653) [-1254.194] (-1257.072) -- 0:00:21
664500 -- (-1254.749) (-1257.647) [-1253.129] (-1254.497) * (-1256.658) (-1255.762) (-1252.551) [-1253.599] -- 0:00:21
665000 -- (-1256.099) (-1255.247) [-1253.592] (-1257.644) * (-1254.542) (-1255.861) (-1253.014) [-1253.940] -- 0:00:21
Average standard deviation of split frequencies: 0.010263
665500 -- [-1253.268] (-1254.006) (-1255.972) (-1261.220) * [-1256.150] (-1253.425) (-1253.371) (-1254.655) -- 0:00:21
666000 -- (-1253.544) (-1254.056) [-1253.728] (-1254.124) * (-1254.693) (-1254.366) (-1254.440) [-1255.414] -- 0:00:21
666500 -- (-1253.397) (-1253.096) [-1253.677] (-1253.645) * (-1255.963) (-1256.791) (-1252.660) [-1254.095] -- 0:00:21
667000 -- (-1252.605) (-1253.034) (-1258.199) [-1254.332] * (-1256.501) (-1254.018) (-1254.270) [-1253.158] -- 0:00:21
667500 -- (-1254.690) (-1253.974) [-1254.416] (-1255.384) * (-1255.858) (-1254.468) [-1252.891] (-1257.544) -- 0:00:21
668000 -- [-1253.618] (-1255.290) (-1253.241) (-1254.798) * (-1256.704) (-1254.834) (-1255.112) [-1256.527] -- 0:00:21
668500 -- (-1256.310) (-1259.657) [-1255.141] (-1255.661) * (-1253.399) [-1256.941] (-1253.287) (-1258.644) -- 0:00:21
669000 -- (-1256.856) [-1255.365] (-1252.834) (-1257.494) * (-1253.380) [-1256.804] (-1253.278) (-1253.350) -- 0:00:21
669500 -- [-1255.217] (-1253.585) (-1254.659) (-1253.517) * (-1254.671) [-1255.657] (-1255.158) (-1254.358) -- 0:00:21
670000 -- [-1255.022] (-1254.813) (-1255.349) (-1258.198) * (-1254.703) (-1255.286) [-1254.488] (-1253.420) -- 0:00:21
Average standard deviation of split frequencies: 0.009653
670500 -- [-1256.243] (-1255.353) (-1256.939) (-1253.974) * (-1255.136) [-1253.022] (-1255.227) (-1255.268) -- 0:00:21
671000 -- (-1255.837) (-1256.522) [-1255.700] (-1253.816) * (-1254.588) (-1254.378) [-1255.972] (-1255.653) -- 0:00:21
671500 -- (-1254.088) [-1255.997] (-1254.245) (-1253.718) * [-1254.524] (-1253.227) (-1253.584) (-1254.420) -- 0:00:21
672000 -- (-1257.020) (-1259.388) [-1254.305] (-1255.008) * (-1258.027) (-1256.597) [-1254.124] (-1255.287) -- 0:00:20
672500 -- (-1254.578) (-1254.352) [-1255.810] (-1253.896) * (-1255.313) (-1253.828) [-1254.635] (-1259.079) -- 0:00:20
673000 -- [-1258.297] (-1254.158) (-1256.971) (-1255.635) * (-1254.783) (-1257.140) [-1256.695] (-1253.271) -- 0:00:20
673500 -- (-1256.497) [-1252.963] (-1258.749) (-1254.047) * [-1252.833] (-1254.936) (-1259.941) (-1257.295) -- 0:00:20
674000 -- [-1252.549] (-1253.609) (-1254.556) (-1254.405) * (-1253.174) [-1255.734] (-1255.514) (-1255.245) -- 0:00:20
674500 -- (-1255.628) (-1256.765) (-1254.872) [-1253.170] * (-1252.898) (-1257.253) [-1253.668] (-1255.097) -- 0:00:20
675000 -- (-1254.424) (-1255.421) (-1256.720) [-1256.081] * (-1252.819) [-1255.548] (-1257.324) (-1254.267) -- 0:00:20
Average standard deviation of split frequencies: 0.009902
675500 -- (-1255.484) (-1254.307) [-1254.407] (-1255.242) * (-1253.452) [-1254.186] (-1255.490) (-1254.179) -- 0:00:20
676000 -- (-1253.228) (-1257.904) [-1253.122] (-1258.387) * (-1253.872) (-1253.119) [-1255.390] (-1252.864) -- 0:00:20
676500 -- (-1255.609) (-1254.087) [-1255.660] (-1258.995) * (-1253.663) (-1253.725) [-1253.195] (-1255.749) -- 0:00:20
677000 -- (-1255.211) [-1253.692] (-1256.009) (-1256.006) * (-1254.324) (-1253.310) (-1253.296) [-1255.422] -- 0:00:20
677500 -- (-1254.216) [-1253.120] (-1255.570) (-1255.057) * (-1254.029) (-1253.809) (-1253.588) [-1252.783] -- 0:00:20
678000 -- (-1254.299) (-1255.532) (-1255.529) [-1253.341] * (-1256.288) (-1257.126) (-1256.162) [-1255.287] -- 0:00:20
678500 -- (-1253.230) [-1255.332] (-1253.066) (-1255.641) * (-1254.973) (-1253.328) (-1257.497) [-1254.620] -- 0:00:20
679000 -- (-1253.612) (-1254.060) [-1253.394] (-1256.355) * (-1254.203) [-1254.324] (-1253.934) (-1254.025) -- 0:00:20
679500 -- (-1253.940) (-1256.600) (-1255.036) [-1257.762] * [-1256.025] (-1254.607) (-1253.539) (-1255.166) -- 0:00:20
680000 -- (-1254.414) (-1256.262) [-1253.797] (-1256.178) * (-1255.863) (-1261.647) [-1256.057] (-1252.788) -- 0:00:20
Average standard deviation of split frequencies: 0.010065
680500 -- (-1257.043) (-1254.928) [-1254.187] (-1258.895) * (-1254.061) [-1258.532] (-1255.573) (-1256.179) -- 0:00:20
681000 -- [-1257.012] (-1254.513) (-1254.004) (-1254.481) * (-1254.187) (-1255.997) (-1254.904) [-1255.455] -- 0:00:20
681500 -- [-1253.381] (-1255.877) (-1257.219) (-1257.803) * (-1254.922) (-1253.792) [-1255.433] (-1258.831) -- 0:00:20
682000 -- (-1254.045) [-1253.040] (-1254.295) (-1256.785) * (-1252.518) (-1256.800) [-1253.947] (-1255.305) -- 0:00:20
682500 -- [-1254.285] (-1252.969) (-1261.708) (-1255.903) * (-1254.467) [-1254.572] (-1254.289) (-1255.307) -- 0:00:20
683000 -- (-1253.278) (-1253.814) [-1259.888] (-1255.966) * (-1255.965) (-1256.075) (-1256.576) [-1254.866] -- 0:00:20
683500 -- [-1253.892] (-1255.998) (-1257.245) (-1254.950) * (-1255.835) [-1257.534] (-1255.919) (-1257.048) -- 0:00:20
684000 -- (-1254.218) (-1253.938) (-1256.304) [-1256.060] * (-1255.774) (-1258.526) [-1255.559] (-1255.072) -- 0:00:20
684500 -- (-1253.071) (-1260.180) (-1255.205) [-1253.407] * [-1256.182] (-1254.091) (-1253.286) (-1253.930) -- 0:00:20
685000 -- (-1253.177) [-1252.411] (-1257.212) (-1255.846) * (-1254.695) (-1254.652) (-1254.120) [-1254.575] -- 0:00:20
Average standard deviation of split frequencies: 0.009575
685500 -- (-1253.937) (-1252.654) (-1261.541) [-1255.163] * (-1253.641) (-1256.556) [-1253.243] (-1253.475) -- 0:00:20
686000 -- (-1253.844) [-1252.431] (-1261.294) (-1253.083) * (-1252.593) (-1253.913) [-1253.218] (-1256.410) -- 0:00:20
686500 -- [-1252.674] (-1260.619) (-1258.194) (-1252.471) * [-1254.439] (-1252.934) (-1254.255) (-1253.907) -- 0:00:20
687000 -- (-1253.526) (-1258.768) [-1253.469] (-1253.483) * [-1253.567] (-1253.719) (-1255.888) (-1263.386) -- 0:00:20
687500 -- (-1256.185) [-1257.449] (-1255.730) (-1255.831) * (-1256.593) (-1253.200) (-1258.716) [-1256.322] -- 0:00:20
688000 -- (-1254.906) [-1257.551] (-1256.726) (-1254.502) * [-1257.571] (-1253.664) (-1256.897) (-1253.431) -- 0:00:19
688500 -- (-1256.072) (-1255.388) [-1253.781] (-1254.831) * [-1256.193] (-1254.054) (-1256.535) (-1255.403) -- 0:00:19
689000 -- (-1258.447) (-1253.857) [-1254.577] (-1255.223) * [-1254.323] (-1260.401) (-1254.174) (-1253.041) -- 0:00:19
689500 -- [-1259.184] (-1253.991) (-1258.457) (-1257.910) * (-1258.390) (-1257.094) [-1254.448] (-1253.516) -- 0:00:19
690000 -- (-1257.592) (-1256.737) [-1254.236] (-1256.251) * (-1253.165) (-1254.050) (-1256.687) [-1253.546] -- 0:00:19
Average standard deviation of split frequencies: 0.009829
690500 -- (-1257.266) (-1253.174) [-1256.384] (-1256.783) * (-1258.204) (-1253.098) [-1257.442] (-1256.149) -- 0:00:19
691000 -- (-1259.162) (-1253.137) (-1255.052) [-1253.136] * (-1253.604) (-1254.386) [-1254.642] (-1255.227) -- 0:00:19
691500 -- (-1252.715) (-1256.015) (-1256.929) [-1253.017] * (-1253.898) (-1261.267) [-1254.497] (-1257.449) -- 0:00:19
692000 -- (-1255.562) (-1256.405) (-1252.247) [-1255.799] * (-1253.940) (-1267.973) [-1254.717] (-1254.625) -- 0:00:19
692500 -- (-1252.439) [-1255.775] (-1254.621) (-1253.603) * (-1253.576) (-1254.026) (-1252.755) [-1255.737] -- 0:00:19
693000 -- (-1253.647) (-1254.989) [-1253.692] (-1252.673) * (-1253.446) [-1253.073] (-1255.928) (-1253.843) -- 0:00:19
693500 -- (-1254.113) [-1255.774] (-1256.018) (-1254.012) * (-1253.066) [-1254.633] (-1253.488) (-1259.751) -- 0:00:19
694000 -- (-1252.565) [-1254.242] (-1254.117) (-1254.791) * (-1257.604) [-1253.549] (-1256.974) (-1257.779) -- 0:00:19
694500 -- (-1253.749) (-1257.010) (-1256.871) [-1255.107] * (-1256.134) [-1253.054] (-1256.741) (-1254.582) -- 0:00:19
695000 -- [-1253.318] (-1257.242) (-1254.047) (-1255.369) * (-1254.548) (-1253.680) [-1255.671] (-1254.654) -- 0:00:19
Average standard deviation of split frequencies: 0.009934
695500 -- (-1254.409) (-1255.220) [-1253.290] (-1252.883) * (-1254.278) (-1254.459) (-1255.994) [-1254.931] -- 0:00:19
696000 -- [-1255.844] (-1256.276) (-1256.804) (-1254.159) * (-1253.241) (-1252.328) (-1256.469) [-1254.628] -- 0:00:19
696500 -- (-1254.652) (-1255.105) (-1253.502) [-1253.498] * (-1253.479) [-1252.679] (-1256.908) (-1255.620) -- 0:00:19
697000 -- [-1254.716] (-1255.875) (-1253.357) (-1253.973) * (-1252.910) (-1255.114) (-1255.978) [-1254.026] -- 0:00:19
697500 -- [-1253.699] (-1257.001) (-1254.200) (-1254.231) * [-1252.580] (-1254.482) (-1254.905) (-1256.974) -- 0:00:19
698000 -- [-1253.481] (-1255.083) (-1253.749) (-1255.231) * [-1252.524] (-1254.039) (-1256.161) (-1254.450) -- 0:00:19
698500 -- (-1254.347) (-1254.939) [-1254.280] (-1257.161) * (-1252.620) [-1257.888] (-1255.484) (-1256.347) -- 0:00:19
699000 -- (-1255.984) (-1256.173) (-1256.041) [-1255.769] * (-1253.551) (-1254.490) (-1255.882) [-1255.321] -- 0:00:19
699500 -- (-1254.570) (-1254.379) [-1252.996] (-1254.436) * (-1254.064) [-1255.861] (-1252.369) (-1254.947) -- 0:00:19
700000 -- (-1256.017) [-1253.484] (-1253.663) (-1260.810) * (-1255.835) (-1253.404) [-1259.123] (-1254.066) -- 0:00:19
Average standard deviation of split frequencies: 0.009599
700500 -- [-1253.753] (-1255.727) (-1254.250) (-1253.927) * (-1256.499) (-1254.849) (-1256.062) [-1253.480] -- 0:00:19
701000 -- (-1252.419) [-1252.386] (-1253.871) (-1253.895) * (-1259.030) (-1254.441) [-1254.349] (-1256.814) -- 0:00:19
701500 -- (-1252.445) [-1255.284] (-1254.373) (-1254.217) * (-1253.746) [-1253.660] (-1253.944) (-1255.959) -- 0:00:19
702000 -- (-1253.938) (-1256.096) (-1255.386) [-1254.142] * [-1253.325] (-1254.030) (-1253.262) (-1254.124) -- 0:00:19
702500 -- [-1255.882] (-1256.799) (-1253.357) (-1255.898) * (-1255.642) (-1254.335) (-1252.731) [-1255.234] -- 0:00:19
703000 -- [-1252.538] (-1252.710) (-1255.195) (-1253.601) * [-1253.494] (-1257.425) (-1255.235) (-1253.868) -- 0:00:19
703500 -- [-1254.175] (-1253.116) (-1253.933) (-1256.580) * (-1259.341) (-1254.012) (-1260.613) [-1253.808] -- 0:00:18
704000 -- [-1255.226] (-1253.561) (-1253.595) (-1253.304) * [-1255.456] (-1252.247) (-1255.675) (-1255.951) -- 0:00:18
704500 -- (-1257.778) [-1256.913] (-1253.729) (-1254.235) * (-1253.581) (-1255.452) [-1254.975] (-1260.411) -- 0:00:18
705000 -- [-1253.259] (-1256.359) (-1254.595) (-1255.841) * [-1254.754] (-1254.216) (-1252.582) (-1255.847) -- 0:00:18
Average standard deviation of split frequencies: 0.009392
705500 -- (-1255.980) (-1255.479) (-1254.695) [-1253.664] * [-1255.253] (-1253.930) (-1254.581) (-1252.950) -- 0:00:18
706000 -- (-1257.659) (-1255.903) [-1252.455] (-1257.618) * (-1258.325) (-1254.409) [-1257.113] (-1253.874) -- 0:00:18
706500 -- [-1261.393] (-1256.600) (-1261.769) (-1256.682) * (-1257.048) (-1253.254) (-1254.095) [-1256.654] -- 0:00:18
707000 -- (-1259.630) (-1255.583) (-1256.348) [-1256.641] * (-1253.800) [-1254.246] (-1258.235) (-1253.775) -- 0:00:18
707500 -- (-1258.311) (-1252.767) [-1256.351] (-1257.033) * (-1253.801) (-1253.745) [-1255.029] (-1254.800) -- 0:00:18
708000 -- (-1257.140) (-1255.323) [-1253.887] (-1254.424) * (-1259.239) (-1254.322) (-1256.410) [-1253.408] -- 0:00:18
708500 -- [-1254.475] (-1254.948) (-1254.797) (-1252.722) * (-1258.277) (-1253.532) (-1255.588) [-1254.721] -- 0:00:18
709000 -- [-1253.982] (-1255.925) (-1253.566) (-1253.761) * (-1253.673) (-1256.258) [-1255.144] (-1254.544) -- 0:00:18
709500 -- (-1255.045) (-1255.729) (-1254.788) [-1252.758] * [-1256.925] (-1256.847) (-1256.386) (-1253.198) -- 0:00:18
710000 -- [-1252.501] (-1258.470) (-1255.041) (-1254.575) * (-1254.194) (-1263.162) (-1253.925) [-1255.261] -- 0:00:18
Average standard deviation of split frequencies: 0.009419
710500 -- (-1255.614) (-1253.414) (-1256.501) [-1252.485] * (-1254.705) (-1255.045) (-1254.002) [-1256.215] -- 0:00:18
711000 -- (-1256.491) (-1253.521) (-1257.932) [-1252.945] * (-1253.938) (-1253.485) (-1256.511) [-1255.825] -- 0:00:18
711500 -- (-1253.477) [-1258.235] (-1256.504) (-1253.739) * (-1255.508) (-1255.660) (-1254.964) [-1255.827] -- 0:00:18
712000 -- (-1252.986) (-1257.912) [-1253.657] (-1253.547) * (-1254.833) (-1256.710) [-1253.113] (-1256.180) -- 0:00:18
712500 -- (-1253.842) (-1256.906) (-1256.200) [-1253.109] * (-1253.934) (-1257.778) [-1254.258] (-1255.393) -- 0:00:18
713000 -- [-1256.422] (-1254.659) (-1254.276) (-1253.816) * (-1254.559) (-1254.159) (-1253.424) [-1254.123] -- 0:00:18
713500 -- (-1256.759) (-1254.902) [-1254.027] (-1253.814) * (-1252.877) [-1252.749] (-1256.797) (-1253.307) -- 0:00:18
714000 -- [-1255.306] (-1254.027) (-1257.069) (-1253.989) * [-1252.560] (-1254.870) (-1253.826) (-1256.477) -- 0:00:18
714500 -- (-1254.862) (-1253.304) [-1254.479] (-1256.127) * (-1253.465) (-1253.003) [-1254.259] (-1260.375) -- 0:00:18
715000 -- (-1256.066) [-1253.080] (-1253.619) (-1253.881) * (-1255.448) (-1253.908) (-1253.723) [-1254.127] -- 0:00:18
Average standard deviation of split frequencies: 0.009525
715500 -- (-1257.755) (-1253.806) (-1254.893) [-1253.645] * (-1254.226) (-1256.586) (-1253.051) [-1253.132] -- 0:00:18
716000 -- (-1254.287) (-1256.240) (-1253.344) [-1253.411] * (-1253.328) (-1254.903) [-1255.561] (-1257.711) -- 0:00:18
716500 -- [-1256.077] (-1253.227) (-1253.624) (-1254.447) * (-1252.951) (-1254.677) (-1257.272) [-1256.040] -- 0:00:18
717000 -- (-1256.197) (-1255.292) (-1254.735) [-1254.648] * [-1253.552] (-1257.376) (-1253.306) (-1256.388) -- 0:00:18
717500 -- (-1254.069) (-1254.095) (-1254.169) [-1252.485] * (-1255.879) [-1257.744] (-1257.134) (-1253.638) -- 0:00:18
718000 -- (-1259.522) (-1253.411) (-1254.204) [-1252.734] * (-1253.444) (-1255.439) (-1254.233) [-1252.824] -- 0:00:18
718500 -- (-1256.137) [-1253.273] (-1253.568) (-1255.911) * [-1256.155] (-1256.019) (-1252.256) (-1252.730) -- 0:00:18
719000 -- (-1258.234) [-1254.291] (-1255.150) (-1252.897) * (-1256.909) (-1257.257) [-1252.829] (-1252.786) -- 0:00:17
719500 -- (-1254.278) (-1254.687) (-1254.084) [-1252.839] * (-1255.797) (-1256.439) (-1254.479) [-1257.916] -- 0:00:17
720000 -- (-1253.556) [-1253.938] (-1256.586) (-1252.320) * (-1254.049) [-1253.784] (-1254.497) (-1256.141) -- 0:00:17
Average standard deviation of split frequencies: 0.009245
720500 -- [-1255.571] (-1255.207) (-1253.981) (-1256.043) * (-1253.610) (-1253.476) [-1254.843] (-1254.935) -- 0:00:17
721000 -- [-1257.109] (-1256.320) (-1253.247) (-1253.917) * (-1255.805) [-1255.826] (-1253.733) (-1254.575) -- 0:00:17
721500 -- (-1255.934) (-1253.298) (-1253.680) [-1252.774] * (-1254.210) (-1257.587) (-1252.284) [-1254.546] -- 0:00:17
722000 -- [-1253.568] (-1255.340) (-1257.043) (-1252.814) * (-1258.898) (-1254.231) (-1252.562) [-1254.413] -- 0:00:17
722500 -- (-1254.135) [-1256.368] (-1254.253) (-1254.061) * (-1253.867) (-1255.192) (-1252.819) [-1253.030] -- 0:00:17
723000 -- (-1253.674) (-1255.168) (-1254.989) [-1255.318] * (-1255.872) [-1255.782] (-1253.986) (-1253.808) -- 0:00:17
723500 -- (-1252.968) (-1252.736) (-1254.746) [-1253.923] * [-1252.836] (-1253.152) (-1253.131) (-1256.350) -- 0:00:17
724000 -- (-1253.021) [-1254.590] (-1252.999) (-1254.974) * (-1253.595) (-1256.719) (-1253.911) [-1253.028] -- 0:00:17
724500 -- (-1254.586) (-1254.496) [-1254.634] (-1256.354) * [-1253.154] (-1258.187) (-1253.537) (-1252.393) -- 0:00:17
725000 -- (-1255.460) [-1256.137] (-1259.287) (-1254.575) * (-1262.810) [-1254.335] (-1253.455) (-1254.907) -- 0:00:17
Average standard deviation of split frequencies: 0.009577
725500 -- [-1255.543] (-1255.621) (-1253.942) (-1256.590) * (-1252.766) (-1253.228) (-1253.488) [-1253.961] -- 0:00:17
726000 -- [-1255.473] (-1257.311) (-1256.372) (-1255.005) * [-1254.551] (-1256.477) (-1252.965) (-1254.613) -- 0:00:17
726500 -- [-1255.500] (-1257.869) (-1254.012) (-1255.064) * [-1256.901] (-1260.667) (-1253.061) (-1256.032) -- 0:00:17
727000 -- (-1254.007) (-1254.735) (-1255.180) [-1254.811] * [-1254.111] (-1256.568) (-1254.598) (-1254.729) -- 0:00:17
727500 -- (-1252.997) (-1254.356) [-1254.237] (-1253.766) * (-1253.483) (-1254.944) (-1254.716) [-1253.700] -- 0:00:17
728000 -- (-1255.880) [-1255.059] (-1254.436) (-1254.337) * (-1253.403) [-1253.827] (-1254.674) (-1254.251) -- 0:00:17
728500 -- (-1255.611) [-1256.951] (-1256.940) (-1256.294) * (-1252.982) [-1254.114] (-1254.647) (-1258.147) -- 0:00:17
729000 -- (-1257.848) (-1253.616) [-1252.805] (-1258.709) * (-1253.256) (-1254.598) (-1259.347) [-1253.902] -- 0:00:17
729500 -- (-1254.974) (-1259.584) [-1252.194] (-1256.475) * (-1253.119) [-1255.594] (-1255.353) (-1254.514) -- 0:00:17
730000 -- (-1256.276) (-1255.594) [-1253.392] (-1253.819) * [-1254.336] (-1255.293) (-1254.150) (-1254.623) -- 0:00:17
Average standard deviation of split frequencies: 0.008946
730500 -- [-1253.996] (-1253.089) (-1253.921) (-1253.547) * (-1254.371) (-1253.990) [-1254.937] (-1255.553) -- 0:00:17
731000 -- [-1253.291] (-1253.393) (-1255.314) (-1253.499) * (-1255.420) (-1254.197) [-1253.075] (-1255.686) -- 0:00:17
731500 -- (-1256.555) (-1253.211) [-1253.948] (-1256.505) * (-1255.174) [-1253.917] (-1253.364) (-1256.806) -- 0:00:17
732000 -- (-1253.975) [-1253.997] (-1254.892) (-1255.844) * (-1253.199) [-1254.680] (-1254.903) (-1253.255) -- 0:00:17
732500 -- (-1257.336) (-1253.076) (-1255.141) [-1256.195] * (-1254.390) (-1259.928) [-1255.208] (-1253.503) -- 0:00:17
733000 -- (-1257.760) [-1254.196] (-1255.837) (-1255.052) * (-1254.497) (-1254.195) (-1258.839) [-1253.347] -- 0:00:17
733500 -- (-1253.515) [-1253.190] (-1253.655) (-1256.428) * (-1252.731) [-1257.253] (-1256.681) (-1255.131) -- 0:00:17
734000 -- (-1254.542) (-1253.044) (-1252.812) [-1252.887] * (-1253.500) (-1252.919) [-1254.073] (-1254.352) -- 0:00:17
734500 -- [-1257.015] (-1253.374) (-1255.990) (-1253.737) * [-1253.173] (-1253.838) (-1254.109) (-1253.040) -- 0:00:16
735000 -- (-1254.155) (-1253.308) [-1254.593] (-1253.236) * (-1253.700) [-1256.053] (-1254.077) (-1256.124) -- 0:00:16
Average standard deviation of split frequencies: 0.008887
735500 -- (-1253.324) (-1252.979) (-1253.879) [-1252.984] * [-1255.023] (-1253.346) (-1255.819) (-1254.143) -- 0:00:16
736000 -- (-1253.881) [-1257.924] (-1254.535) (-1253.099) * (-1254.127) (-1256.532) [-1255.475] (-1255.634) -- 0:00:16
736500 -- (-1256.878) (-1254.362) [-1255.155] (-1256.279) * (-1257.448) [-1255.451] (-1255.878) (-1256.297) -- 0:00:16
737000 -- (-1257.841) (-1253.708) (-1254.597) [-1254.060] * [-1255.086] (-1264.799) (-1255.271) (-1255.829) -- 0:00:16
737500 -- (-1256.201) (-1255.844) (-1254.134) [-1253.610] * (-1254.719) [-1257.131] (-1253.361) (-1256.981) -- 0:00:16
738000 -- (-1255.140) [-1253.676] (-1254.051) (-1253.148) * (-1256.564) [-1258.641] (-1254.052) (-1254.787) -- 0:00:16
738500 -- (-1255.687) (-1258.257) (-1252.617) [-1253.258] * (-1257.050) (-1258.054) [-1252.931] (-1253.058) -- 0:00:16
739000 -- (-1254.678) [-1253.065] (-1253.536) (-1253.969) * [-1252.911] (-1255.469) (-1253.880) (-1256.712) -- 0:00:16
739500 -- (-1253.677) (-1253.337) (-1254.607) [-1253.722] * (-1255.704) (-1254.483) [-1254.809] (-1253.080) -- 0:00:16
740000 -- [-1253.461] (-1255.785) (-1254.955) (-1255.500) * (-1256.120) (-1254.177) [-1253.253] (-1253.514) -- 0:00:16
Average standard deviation of split frequencies: 0.008316
740500 -- (-1256.426) (-1254.864) (-1253.940) [-1256.674] * (-1255.689) (-1253.040) [-1253.560] (-1252.970) -- 0:00:16
741000 -- [-1255.341] (-1255.066) (-1257.869) (-1256.675) * (-1252.452) (-1253.717) [-1253.966] (-1257.392) -- 0:00:16
741500 -- (-1254.486) (-1255.174) [-1253.130] (-1254.338) * (-1255.273) (-1253.969) [-1255.256] (-1256.067) -- 0:00:16
742000 -- (-1254.162) (-1257.303) [-1254.703] (-1255.617) * (-1255.871) (-1253.543) (-1256.535) [-1259.071] -- 0:00:16
742500 -- [-1254.160] (-1255.438) (-1257.327) (-1252.903) * [-1255.775] (-1254.938) (-1255.460) (-1255.346) -- 0:00:16
743000 -- (-1258.520) (-1254.065) (-1255.100) [-1254.617] * (-1253.121) (-1253.950) [-1257.749] (-1253.838) -- 0:00:16
743500 -- (-1256.081) (-1254.423) [-1254.495] (-1259.116) * [-1252.646] (-1254.624) (-1256.350) (-1253.895) -- 0:00:16
744000 -- (-1254.205) (-1253.773) [-1253.453] (-1260.657) * (-1253.869) (-1255.425) (-1257.135) [-1256.314] -- 0:00:16
744500 -- [-1255.431] (-1254.610) (-1257.994) (-1261.817) * [-1254.050] (-1257.850) (-1257.655) (-1255.744) -- 0:00:16
745000 -- (-1255.087) (-1252.951) [-1255.255] (-1255.550) * [-1253.524] (-1258.598) (-1256.225) (-1254.438) -- 0:00:16
Average standard deviation of split frequencies: 0.009044
745500 -- (-1255.230) (-1255.615) (-1254.045) [-1257.566] * (-1254.972) [-1255.789] (-1255.164) (-1255.038) -- 0:00:16
746000 -- (-1253.707) (-1252.871) (-1260.162) [-1256.674] * (-1253.862) (-1255.140) [-1253.802] (-1260.770) -- 0:00:16
746500 -- (-1254.833) (-1256.381) (-1255.090) [-1252.217] * [-1254.177] (-1253.788) (-1253.200) (-1260.658) -- 0:00:16
747000 -- (-1254.491) [-1254.083] (-1255.129) (-1254.002) * (-1258.496) (-1254.673) (-1255.165) [-1253.975] -- 0:00:16
747500 -- [-1254.483] (-1255.618) (-1256.935) (-1255.965) * (-1254.486) (-1257.793) [-1253.537] (-1253.334) -- 0:00:16
748000 -- (-1255.488) (-1254.399) (-1253.478) [-1253.911] * (-1256.921) (-1255.608) (-1253.609) [-1253.934] -- 0:00:16
748500 -- [-1256.051] (-1257.046) (-1257.234) (-1256.478) * (-1253.579) (-1255.163) [-1255.293] (-1252.844) -- 0:00:16
749000 -- (-1255.567) [-1259.466] (-1253.798) (-1254.947) * [-1255.641] (-1256.102) (-1255.838) (-1255.868) -- 0:00:16
749500 -- [-1256.022] (-1259.077) (-1253.566) (-1252.916) * [-1257.179] (-1255.226) (-1253.973) (-1258.986) -- 0:00:16
750000 -- (-1259.101) (-1255.652) (-1252.937) [-1254.488] * (-1256.318) (-1254.554) (-1254.362) [-1257.252] -- 0:00:16
Average standard deviation of split frequencies: 0.009223
750500 -- (-1258.326) (-1253.670) (-1253.004) [-1253.705] * (-1258.876) (-1258.378) [-1253.374] (-1253.684) -- 0:00:15
751000 -- (-1254.748) (-1253.224) (-1253.132) [-1252.806] * (-1255.041) (-1253.691) (-1254.018) [-1255.022] -- 0:00:15
751500 -- (-1256.082) [-1254.359] (-1252.933) (-1253.113) * (-1255.359) [-1253.106] (-1256.163) (-1258.232) -- 0:00:15
752000 -- (-1252.635) (-1252.883) (-1253.326) [-1252.797] * (-1257.048) (-1256.992) (-1256.604) [-1253.179] -- 0:00:15
752500 -- [-1255.394] (-1252.883) (-1254.726) (-1252.777) * [-1253.287] (-1254.210) (-1253.197) (-1253.767) -- 0:00:15
753000 -- (-1254.260) (-1254.039) [-1253.821] (-1252.836) * (-1254.316) (-1255.230) (-1254.486) [-1256.672] -- 0:00:15
753500 -- (-1253.419) (-1253.772) [-1259.328] (-1255.367) * (-1258.547) (-1253.761) [-1254.092] (-1255.246) -- 0:00:15
754000 -- (-1257.632) [-1253.632] (-1258.310) (-1258.599) * (-1254.613) [-1252.830] (-1252.938) (-1255.086) -- 0:00:15
754500 -- [-1260.570] (-1254.460) (-1257.345) (-1256.453) * (-1258.549) (-1259.309) (-1255.535) [-1252.593] -- 0:00:15
755000 -- (-1257.126) (-1258.504) [-1256.751] (-1254.400) * (-1255.912) (-1253.950) [-1254.908] (-1256.940) -- 0:00:15
Average standard deviation of split frequencies: 0.009197
755500 -- (-1254.181) (-1254.903) (-1253.474) [-1256.293] * (-1252.842) [-1253.177] (-1255.114) (-1260.422) -- 0:00:15
756000 -- (-1254.068) [-1255.632] (-1254.306) (-1252.589) * (-1259.127) (-1252.926) (-1255.737) [-1255.810] -- 0:00:15
756500 -- [-1254.473] (-1258.810) (-1255.532) (-1252.697) * (-1256.280) [-1254.224] (-1256.570) (-1253.394) -- 0:00:15
757000 -- (-1256.472) (-1255.312) [-1253.175] (-1257.904) * [-1255.399] (-1254.350) (-1260.383) (-1253.604) -- 0:00:15
757500 -- [-1255.921] (-1253.944) (-1256.821) (-1255.128) * [-1256.053] (-1256.861) (-1254.814) (-1253.038) -- 0:00:15
758000 -- (-1256.194) [-1255.719] (-1253.592) (-1254.739) * (-1258.188) (-1255.465) [-1253.616] (-1259.663) -- 0:00:15
758500 -- (-1260.147) (-1260.724) (-1255.021) [-1252.718] * (-1253.982) [-1254.775] (-1254.191) (-1256.715) -- 0:00:15
759000 -- (-1253.905) (-1259.546) [-1253.239] (-1256.367) * (-1254.400) (-1253.432) (-1253.384) [-1253.656] -- 0:00:15
759500 -- (-1252.529) [-1257.985] (-1254.346) (-1256.290) * [-1253.071] (-1255.666) (-1254.465) (-1256.394) -- 0:00:15
760000 -- [-1253.931] (-1255.151) (-1253.231) (-1254.223) * (-1253.996) (-1256.342) [-1254.377] (-1254.052) -- 0:00:15
Average standard deviation of split frequencies: 0.008676
760500 -- [-1254.989] (-1257.749) (-1254.724) (-1255.826) * (-1257.852) (-1256.496) [-1255.915] (-1255.395) -- 0:00:15
761000 -- (-1255.053) (-1256.550) [-1252.516] (-1258.889) * (-1259.762) (-1255.979) (-1253.609) [-1253.611] -- 0:00:15
761500 -- [-1253.868] (-1256.202) (-1257.937) (-1254.801) * (-1254.663) (-1252.825) (-1257.846) [-1253.385] -- 0:00:15
762000 -- (-1254.049) (-1254.151) (-1254.326) [-1253.947] * [-1254.213] (-1252.776) (-1256.988) (-1254.242) -- 0:00:15
762500 -- [-1253.058] (-1256.923) (-1253.022) (-1253.981) * [-1252.908] (-1253.528) (-1257.316) (-1255.447) -- 0:00:15
763000 -- [-1253.898] (-1254.343) (-1253.373) (-1252.584) * (-1254.642) (-1255.959) (-1254.718) [-1253.137] -- 0:00:15
763500 -- (-1256.550) (-1258.919) [-1255.549] (-1254.586) * [-1253.348] (-1258.520) (-1254.911) (-1253.582) -- 0:00:15
764000 -- (-1259.971) [-1253.432] (-1254.321) (-1259.080) * (-1253.747) (-1254.113) [-1254.264] (-1253.968) -- 0:00:15
764500 -- (-1254.567) (-1253.873) [-1253.486] (-1254.191) * (-1253.958) (-1253.692) [-1252.604] (-1253.031) -- 0:00:15
765000 -- (-1253.936) (-1254.025) (-1255.512) [-1252.979] * (-1253.535) (-1254.096) (-1254.500) [-1254.071] -- 0:00:15
Average standard deviation of split frequencies: 0.009149
765500 -- (-1255.433) [-1258.570] (-1259.115) (-1254.686) * (-1253.660) (-1255.818) (-1253.784) [-1259.267] -- 0:00:15
766000 -- [-1253.191] (-1255.168) (-1253.311) (-1254.716) * (-1255.238) (-1253.450) [-1253.652] (-1254.530) -- 0:00:14
766500 -- (-1252.499) (-1255.101) (-1254.408) [-1254.964] * (-1256.490) [-1253.441] (-1253.660) (-1255.115) -- 0:00:14
767000 -- (-1253.668) [-1253.391] (-1254.278) (-1255.866) * (-1253.722) [-1255.915] (-1254.888) (-1255.248) -- 0:00:14
767500 -- (-1253.871) (-1255.406) (-1254.082) [-1257.302] * (-1253.768) (-1254.340) [-1255.330] (-1256.821) -- 0:00:14
768000 -- (-1256.064) (-1254.991) [-1255.196] (-1255.151) * (-1256.688) (-1257.476) [-1254.784] (-1254.427) -- 0:00:14
768500 -- (-1254.300) (-1253.095) [-1258.361] (-1253.900) * (-1255.376) (-1254.837) (-1253.782) [-1253.165] -- 0:00:14
769000 -- (-1252.220) (-1254.355) [-1255.454] (-1253.672) * (-1255.202) (-1253.920) (-1254.054) [-1253.292] -- 0:00:14
769500 -- (-1252.647) [-1255.750] (-1255.121) (-1254.902) * (-1256.282) (-1253.015) (-1254.426) [-1257.790] -- 0:00:14
770000 -- (-1253.103) (-1253.408) (-1255.996) [-1255.387] * (-1256.104) (-1255.749) [-1255.332] (-1254.797) -- 0:00:14
Average standard deviation of split frequencies: 0.009501
770500 -- (-1252.415) (-1253.245) (-1254.691) [-1252.708] * (-1254.147) (-1258.266) (-1256.687) [-1255.950] -- 0:00:14
771000 -- (-1253.629) (-1252.585) (-1253.326) [-1252.921] * (-1254.924) (-1253.397) (-1256.705) [-1255.287] -- 0:00:14
771500 -- (-1254.331) (-1255.411) [-1254.203] (-1252.905) * (-1253.553) [-1253.892] (-1254.155) (-1253.215) -- 0:00:14
772000 -- (-1253.789) (-1253.628) [-1253.957] (-1254.833) * (-1254.928) (-1255.297) (-1254.413) [-1254.188] -- 0:00:14
772500 -- [-1253.576] (-1253.881) (-1255.994) (-1255.905) * (-1254.346) (-1254.927) (-1255.041) [-1254.301] -- 0:00:14
773000 -- (-1255.466) (-1256.175) [-1254.169] (-1256.092) * (-1254.135) [-1253.619] (-1257.020) (-1253.600) -- 0:00:14
773500 -- [-1255.893] (-1257.730) (-1254.938) (-1253.083) * (-1255.175) [-1255.511] (-1255.491) (-1253.334) -- 0:00:14
774000 -- (-1255.580) [-1256.131] (-1254.425) (-1254.542) * (-1255.334) (-1255.101) [-1252.214] (-1254.781) -- 0:00:14
774500 -- [-1255.924] (-1258.017) (-1255.358) (-1253.746) * [-1253.017] (-1254.156) (-1253.036) (-1256.731) -- 0:00:14
775000 -- (-1257.517) (-1254.638) (-1253.204) [-1254.281] * (-1253.118) (-1257.492) (-1254.318) [-1254.809] -- 0:00:14
Average standard deviation of split frequencies: 0.009355
775500 -- (-1254.850) (-1253.059) (-1252.668) [-1252.532] * [-1254.172] (-1255.640) (-1254.391) (-1257.378) -- 0:00:14
776000 -- (-1256.055) (-1254.012) (-1256.797) [-1254.331] * (-1258.982) (-1255.045) (-1255.680) [-1254.240] -- 0:00:14
776500 -- (-1254.250) (-1255.718) (-1257.110) [-1253.668] * [-1255.289] (-1256.287) (-1253.455) (-1253.632) -- 0:00:14
777000 -- (-1256.091) (-1257.566) [-1256.690] (-1255.426) * (-1255.283) (-1254.169) (-1255.148) [-1252.228] -- 0:00:14
777500 -- (-1254.771) (-1259.558) [-1255.700] (-1254.039) * (-1256.379) (-1259.599) (-1256.480) [-1252.257] -- 0:00:14
778000 -- (-1255.364) [-1255.770] (-1258.780) (-1254.424) * (-1253.925) (-1255.413) [-1255.238] (-1254.317) -- 0:00:14
778500 -- (-1254.035) (-1254.121) [-1255.097] (-1252.769) * [-1254.430] (-1253.470) (-1257.079) (-1257.387) -- 0:00:14
779000 -- (-1258.032) [-1254.120] (-1255.633) (-1253.556) * (-1256.662) (-1253.032) [-1255.875] (-1256.267) -- 0:00:14
779500 -- (-1257.580) (-1254.801) [-1252.909] (-1254.859) * (-1253.958) [-1252.605] (-1255.835) (-1253.335) -- 0:00:14
780000 -- (-1253.209) [-1257.149] (-1255.600) (-1252.764) * (-1255.219) (-1256.096) [-1252.810] (-1258.543) -- 0:00:14
Average standard deviation of split frequencies: 0.009058
780500 -- [-1253.056] (-1253.615) (-1253.450) (-1254.673) * (-1256.166) (-1255.189) [-1253.798] (-1255.077) -- 0:00:14
781000 -- [-1253.845] (-1259.451) (-1254.902) (-1253.672) * (-1254.712) [-1256.929] (-1254.832) (-1255.218) -- 0:00:14
781500 -- [-1253.564] (-1253.792) (-1253.882) (-1253.682) * (-1257.197) (-1260.674) [-1255.294] (-1257.657) -- 0:00:13
782000 -- (-1256.955) (-1252.996) [-1253.696] (-1257.207) * (-1254.900) (-1257.119) (-1256.646) [-1255.760] -- 0:00:13
782500 -- (-1257.213) (-1256.859) [-1254.570] (-1256.850) * (-1252.844) (-1256.969) [-1254.817] (-1256.357) -- 0:00:13
783000 -- [-1255.792] (-1254.502) (-1254.256) (-1254.018) * (-1256.749) (-1253.097) (-1254.226) [-1255.237] -- 0:00:13
783500 -- (-1254.800) [-1253.822] (-1256.240) (-1254.084) * (-1258.795) [-1253.838] (-1257.677) (-1254.801) -- 0:00:13
784000 -- [-1256.850] (-1252.397) (-1254.511) (-1254.310) * (-1254.550) [-1259.123] (-1253.729) (-1253.494) -- 0:00:13
784500 -- (-1254.354) (-1256.778) (-1253.103) [-1256.021] * (-1255.814) (-1254.958) (-1257.596) [-1253.142] -- 0:00:13
785000 -- (-1254.832) [-1257.527] (-1253.969) (-1254.565) * [-1254.641] (-1254.756) (-1254.313) (-1253.639) -- 0:00:13
Average standard deviation of split frequencies: 0.009716
785500 -- (-1254.505) (-1256.573) (-1255.510) [-1255.997] * [-1254.873] (-1255.496) (-1253.168) (-1255.093) -- 0:00:13
786000 -- (-1253.079) (-1254.056) (-1254.579) [-1253.204] * [-1254.334] (-1255.676) (-1253.865) (-1253.165) -- 0:00:13
786500 -- (-1256.077) (-1253.309) [-1253.950] (-1254.767) * (-1255.105) (-1254.057) (-1253.758) [-1253.346] -- 0:00:13
787000 -- (-1253.991) (-1253.985) (-1253.736) [-1253.157] * (-1257.799) [-1252.851] (-1253.655) (-1255.880) -- 0:00:13
787500 -- (-1255.545) (-1255.370) [-1253.741] (-1255.265) * (-1256.667) (-1254.044) (-1254.213) [-1254.796] -- 0:00:13
788000 -- (-1255.974) (-1253.306) [-1254.437] (-1253.304) * (-1254.718) (-1253.528) (-1253.125) [-1256.020] -- 0:00:13
788500 -- (-1255.575) (-1252.634) [-1254.937] (-1257.525) * (-1253.339) (-1255.942) (-1256.411) [-1254.134] -- 0:00:13
789000 -- (-1255.003) [-1254.590] (-1252.867) (-1259.845) * (-1252.733) (-1253.138) (-1253.896) [-1254.948] -- 0:00:13
789500 -- (-1254.536) (-1254.943) [-1252.589] (-1258.497) * (-1254.020) (-1258.188) (-1256.387) [-1253.842] -- 0:00:13
790000 -- [-1253.215] (-1255.304) (-1253.775) (-1254.486) * (-1256.667) [-1255.258] (-1255.020) (-1255.429) -- 0:00:13
Average standard deviation of split frequencies: 0.009539
790500 -- [-1255.291] (-1254.172) (-1252.678) (-1257.330) * (-1257.435) [-1254.270] (-1255.548) (-1256.238) -- 0:00:13
791000 -- (-1253.723) (-1253.388) [-1253.780] (-1252.405) * (-1259.582) (-1252.539) (-1254.200) [-1253.434] -- 0:00:13
791500 -- (-1256.279) [-1254.881] (-1263.238) (-1256.370) * (-1263.774) [-1252.552] (-1253.919) (-1253.010) -- 0:00:13
792000 -- [-1258.509] (-1254.533) (-1254.605) (-1253.875) * [-1252.606] (-1254.864) (-1254.911) (-1256.898) -- 0:00:13
792500 -- (-1258.804) (-1256.664) [-1255.497] (-1256.067) * [-1253.792] (-1255.869) (-1256.037) (-1258.207) -- 0:00:13
793000 -- (-1258.549) [-1254.396] (-1255.545) (-1254.141) * (-1253.058) (-1256.168) (-1254.601) [-1257.500] -- 0:00:13
793500 -- (-1255.548) (-1254.452) (-1255.817) [-1254.150] * (-1253.256) (-1261.465) (-1255.733) [-1257.346] -- 0:00:13
794000 -- [-1256.023] (-1254.570) (-1254.614) (-1253.793) * (-1253.922) [-1252.891] (-1254.091) (-1255.133) -- 0:00:13
794500 -- (-1255.587) (-1255.023) (-1253.600) [-1254.797] * (-1255.401) (-1258.345) (-1253.816) [-1255.551] -- 0:00:13
795000 -- (-1259.498) (-1257.784) [-1255.366] (-1252.948) * (-1253.584) (-1254.190) [-1254.429] (-1255.441) -- 0:00:13
Average standard deviation of split frequencies: 0.009554
795500 -- (-1255.900) (-1254.466) [-1255.116] (-1253.302) * (-1254.981) [-1252.584] (-1256.152) (-1253.225) -- 0:00:13
796000 -- (-1254.214) [-1253.328] (-1253.048) (-1257.254) * [-1255.894] (-1252.794) (-1253.910) (-1253.519) -- 0:00:13
796500 -- (-1254.238) (-1255.244) [-1254.837] (-1258.956) * (-1254.941) (-1255.278) (-1252.983) [-1253.567] -- 0:00:13
797000 -- [-1254.214] (-1262.536) (-1254.200) (-1255.779) * (-1254.994) (-1258.367) [-1253.351] (-1257.811) -- 0:00:12
797500 -- [-1252.853] (-1257.676) (-1253.211) (-1254.560) * (-1254.845) [-1254.520] (-1252.944) (-1256.914) -- 0:00:12
798000 -- [-1253.544] (-1252.865) (-1252.908) (-1253.836) * (-1253.945) (-1257.521) (-1258.590) [-1252.310] -- 0:00:12
798500 -- [-1254.803] (-1252.808) (-1252.462) (-1255.207) * [-1254.041] (-1254.954) (-1253.461) (-1254.321) -- 0:00:12
799000 -- (-1255.528) (-1254.293) [-1254.564] (-1253.764) * (-1253.081) (-1258.075) (-1255.451) [-1254.597] -- 0:00:12
799500 -- (-1258.556) [-1254.002] (-1259.695) (-1254.837) * (-1257.039) (-1259.144) (-1255.721) [-1253.909] -- 0:00:12
800000 -- (-1258.491) (-1254.288) [-1253.720] (-1253.011) * (-1253.077) (-1257.265) (-1252.514) [-1252.788] -- 0:00:12
Average standard deviation of split frequencies: 0.009538
800500 -- (-1257.865) (-1253.251) (-1252.684) [-1252.835] * (-1255.770) [-1253.310] (-1252.855) (-1254.584) -- 0:00:12
801000 -- (-1254.801) (-1259.416) [-1255.011] (-1257.149) * (-1254.496) (-1256.309) [-1254.815] (-1257.014) -- 0:00:12
801500 -- [-1257.569] (-1255.115) (-1254.837) (-1254.716) * [-1255.886] (-1253.108) (-1256.628) (-1254.422) -- 0:00:12
802000 -- (-1257.636) (-1256.197) (-1257.226) [-1253.469] * [-1255.722] (-1253.467) (-1259.266) (-1256.652) -- 0:00:12
802500 -- (-1255.409) (-1257.526) [-1256.686] (-1259.952) * (-1252.984) (-1255.188) (-1254.369) [-1256.189] -- 0:00:12
803000 -- [-1254.271] (-1257.608) (-1257.481) (-1257.739) * (-1253.264) [-1253.939] (-1255.260) (-1256.302) -- 0:00:12
803500 -- [-1253.708] (-1254.166) (-1257.364) (-1260.132) * (-1253.573) [-1255.318] (-1256.117) (-1256.449) -- 0:00:12
804000 -- (-1253.428) (-1257.147) (-1255.885) [-1256.440] * (-1255.360) (-1259.934) [-1254.035] (-1255.316) -- 0:00:12
804500 -- [-1254.451] (-1258.134) (-1254.233) (-1254.958) * (-1253.221) (-1255.553) (-1255.811) [-1253.787] -- 0:00:12
805000 -- (-1254.287) [-1254.720] (-1253.297) (-1253.002) * [-1253.562] (-1254.378) (-1255.398) (-1254.683) -- 0:00:12
Average standard deviation of split frequencies: 0.009358
805500 -- (-1254.341) (-1257.631) [-1253.906] (-1254.083) * (-1254.671) (-1252.600) (-1255.816) [-1252.821] -- 0:00:12
806000 -- [-1254.543] (-1256.948) (-1256.769) (-1255.611) * [-1253.257] (-1253.996) (-1253.632) (-1255.613) -- 0:00:12
806500 -- (-1253.854) (-1254.142) [-1254.415] (-1255.326) * (-1253.595) (-1255.604) [-1253.451] (-1254.725) -- 0:00:12
807000 -- (-1258.259) [-1252.901] (-1255.002) (-1255.423) * (-1258.121) (-1255.242) (-1257.063) [-1253.311] -- 0:00:12
807500 -- [-1253.203] (-1252.641) (-1253.694) (-1252.960) * (-1255.010) [-1255.045] (-1252.604) (-1259.645) -- 0:00:12
808000 -- (-1253.726) [-1252.466] (-1253.945) (-1253.000) * [-1252.632] (-1253.744) (-1253.153) (-1255.810) -- 0:00:12
808500 -- (-1255.441) [-1254.031] (-1255.216) (-1255.389) * (-1253.511) [-1253.729] (-1255.800) (-1256.325) -- 0:00:12
809000 -- (-1261.925) [-1252.746] (-1255.145) (-1257.385) * (-1259.532) (-1253.217) [-1254.833] (-1254.989) -- 0:00:12
809500 -- (-1255.327) (-1252.940) [-1254.793] (-1256.998) * (-1254.598) (-1257.668) (-1253.900) [-1256.045] -- 0:00:12
810000 -- (-1255.902) (-1252.528) [-1253.417] (-1254.404) * [-1254.802] (-1255.134) (-1252.879) (-1253.807) -- 0:00:12
Average standard deviation of split frequencies: 0.009033
810500 -- (-1255.217) (-1254.968) (-1253.422) [-1253.716] * (-1257.483) (-1256.019) [-1252.892] (-1255.274) -- 0:00:12
811000 -- (-1254.442) (-1253.172) (-1253.281) [-1254.383] * (-1256.446) [-1254.098] (-1256.028) (-1255.163) -- 0:00:12
811500 -- (-1253.413) [-1255.150] (-1252.776) (-1254.977) * (-1258.549) [-1253.308] (-1254.703) (-1253.523) -- 0:00:12
812000 -- [-1254.074] (-1254.058) (-1253.040) (-1253.575) * (-1255.959) [-1255.950] (-1252.861) (-1254.456) -- 0:00:12
812500 -- (-1255.430) (-1253.364) [-1255.736] (-1256.143) * (-1252.844) (-1254.631) [-1253.282] (-1259.290) -- 0:00:12
813000 -- (-1254.303) (-1253.832) (-1254.349) [-1253.435] * (-1254.835) (-1253.417) (-1253.702) [-1256.945] -- 0:00:11
813500 -- (-1254.705) (-1254.753) (-1256.980) [-1252.831] * (-1256.018) [-1253.120] (-1254.863) (-1256.002) -- 0:00:11
814000 -- (-1255.399) (-1254.775) [-1255.477] (-1252.878) * (-1255.005) [-1253.814] (-1253.446) (-1254.478) -- 0:00:11
814500 -- (-1256.361) (-1255.142) (-1253.225) [-1254.811] * (-1255.298) (-1253.372) [-1255.175] (-1256.161) -- 0:00:11
815000 -- (-1256.536) (-1255.077) (-1259.659) [-1253.537] * [-1253.085] (-1256.918) (-1254.828) (-1255.912) -- 0:00:11
Average standard deviation of split frequencies: 0.008935
815500 -- (-1258.133) [-1254.722] (-1255.898) (-1254.223) * (-1256.231) [-1254.009] (-1257.686) (-1257.508) -- 0:00:11
816000 -- (-1254.461) (-1254.165) [-1255.594] (-1255.069) * (-1257.743) [-1254.168] (-1252.464) (-1252.967) -- 0:00:11
816500 -- (-1255.349) (-1254.765) (-1254.880) [-1254.829] * [-1254.061] (-1253.445) (-1253.078) (-1255.026) -- 0:00:11
817000 -- (-1255.882) [-1252.790] (-1256.017) (-1254.344) * [-1253.411] (-1257.607) (-1253.981) (-1256.629) -- 0:00:11
817500 -- (-1253.953) [-1254.152] (-1256.047) (-1256.065) * (-1255.058) (-1256.176) [-1253.671] (-1254.179) -- 0:00:11
818000 -- [-1252.887] (-1254.250) (-1253.075) (-1254.028) * [-1255.633] (-1257.682) (-1253.727) (-1256.968) -- 0:00:11
818500 -- (-1253.346) (-1255.926) (-1256.143) [-1255.048] * (-1256.022) (-1256.884) [-1253.936] (-1256.222) -- 0:00:11
819000 -- [-1253.545] (-1253.630) (-1253.247) (-1253.556) * (-1253.818) (-1254.229) [-1255.339] (-1258.370) -- 0:00:11
819500 -- (-1253.414) [-1253.630] (-1253.996) (-1254.665) * (-1253.574) [-1254.956] (-1256.596) (-1256.773) -- 0:00:11
820000 -- (-1254.352) (-1257.588) [-1255.060] (-1253.184) * (-1254.019) [-1253.261] (-1253.818) (-1257.600) -- 0:00:11
Average standard deviation of split frequencies: 0.008616
820500 -- [-1261.140] (-1259.763) (-1255.406) (-1253.578) * [-1259.789] (-1253.736) (-1254.761) (-1254.241) -- 0:00:11
821000 -- (-1253.631) (-1256.482) (-1257.756) [-1253.301] * (-1257.290) [-1252.961] (-1258.268) (-1254.169) -- 0:00:11
821500 -- (-1254.670) (-1253.685) (-1256.179) [-1255.344] * (-1257.761) (-1256.056) [-1256.760] (-1255.698) -- 0:00:11
822000 -- (-1256.741) [-1253.593] (-1255.742) (-1254.270) * (-1254.283) (-1255.872) (-1255.420) [-1255.258] -- 0:00:11
822500 -- (-1254.675) [-1254.884] (-1253.961) (-1252.862) * [-1253.329] (-1255.460) (-1256.640) (-1253.491) -- 0:00:11
823000 -- [-1255.121] (-1254.999) (-1255.584) (-1252.938) * [-1254.698] (-1254.365) (-1255.385) (-1253.850) -- 0:00:11
823500 -- (-1254.585) (-1255.488) (-1253.930) [-1252.543] * (-1259.049) (-1253.403) [-1252.554] (-1253.520) -- 0:00:11
824000 -- (-1257.469) (-1257.523) (-1259.025) [-1255.724] * (-1254.937) (-1254.999) [-1254.242] (-1252.822) -- 0:00:11
824500 -- (-1257.244) [-1253.795] (-1255.137) (-1256.312) * (-1254.992) (-1258.224) [-1256.121] (-1252.590) -- 0:00:11
825000 -- (-1257.451) [-1254.205] (-1254.414) (-1252.977) * (-1253.494) (-1254.818) (-1254.359) [-1253.118] -- 0:00:11
Average standard deviation of split frequencies: 0.008989
825500 -- (-1253.594) (-1257.208) (-1256.852) [-1253.307] * [-1255.052] (-1253.731) (-1254.357) (-1255.025) -- 0:00:11
826000 -- [-1254.089] (-1253.446) (-1257.173) (-1253.915) * (-1255.861) (-1253.731) [-1256.091] (-1255.629) -- 0:00:11
826500 -- [-1252.949] (-1253.781) (-1258.479) (-1253.430) * [-1258.555] (-1253.686) (-1254.952) (-1257.939) -- 0:00:11
827000 -- (-1252.890) (-1252.546) [-1255.355] (-1254.489) * (-1257.178) (-1254.078) (-1257.546) [-1256.677] -- 0:00:11
827500 -- (-1256.399) [-1252.560] (-1255.303) (-1259.130) * (-1257.909) (-1259.531) [-1252.647] (-1258.048) -- 0:00:11
828000 -- (-1253.764) (-1254.990) (-1257.288) [-1254.505] * (-1256.939) (-1255.112) (-1253.387) [-1254.141] -- 0:00:11
828500 -- (-1254.101) [-1253.377] (-1259.368) (-1254.629) * [-1258.952] (-1256.911) (-1254.239) (-1254.975) -- 0:00:10
829000 -- (-1254.034) (-1253.451) (-1255.886) [-1252.781] * [-1256.355] (-1254.097) (-1253.478) (-1256.980) -- 0:00:10
829500 -- (-1256.599) (-1254.490) (-1253.770) [-1252.653] * (-1253.107) (-1253.359) [-1256.035] (-1253.479) -- 0:00:10
830000 -- (-1253.497) [-1253.053] (-1255.308) (-1255.043) * [-1255.357] (-1255.349) (-1257.403) (-1254.889) -- 0:00:10
Average standard deviation of split frequencies: 0.008967
830500 -- (-1254.020) (-1256.761) (-1255.599) [-1252.920] * (-1254.153) (-1254.879) [-1255.900] (-1253.873) -- 0:00:10
831000 -- (-1254.910) (-1255.694) (-1252.377) [-1253.112] * (-1253.763) (-1254.411) (-1257.608) [-1254.096] -- 0:00:10
831500 -- (-1253.935) (-1256.483) (-1255.193) [-1252.699] * (-1254.798) [-1254.061] (-1255.067) (-1254.084) -- 0:00:10
832000 -- (-1252.691) [-1257.867] (-1255.278) (-1257.760) * [-1252.715] (-1254.582) (-1256.264) (-1253.236) -- 0:00:10
832500 -- (-1254.692) (-1254.030) [-1252.426] (-1254.163) * (-1255.265) (-1253.217) (-1261.368) [-1253.081] -- 0:00:10
833000 -- (-1256.384) (-1255.107) [-1255.850] (-1255.026) * (-1255.250) [-1254.170] (-1258.842) (-1253.055) -- 0:00:10
833500 -- (-1254.173) (-1254.796) (-1255.076) [-1253.259] * (-1254.711) (-1253.564) [-1254.791] (-1254.621) -- 0:00:10
834000 -- [-1254.021] (-1253.973) (-1258.316) (-1253.678) * (-1255.804) (-1253.550) (-1257.021) [-1255.555] -- 0:00:10
834500 -- (-1252.919) (-1256.866) [-1253.252] (-1255.191) * (-1255.452) (-1256.800) (-1258.285) [-1252.668] -- 0:00:10
835000 -- [-1253.986] (-1256.185) (-1253.790) (-1255.774) * (-1252.541) (-1254.010) [-1253.496] (-1264.229) -- 0:00:10
Average standard deviation of split frequencies: 0.008985
835500 -- [-1254.570] (-1253.299) (-1255.813) (-1254.172) * (-1254.837) [-1256.083] (-1254.275) (-1257.927) -- 0:00:10
836000 -- [-1254.350] (-1256.349) (-1253.010) (-1254.630) * (-1254.411) (-1255.563) [-1255.752] (-1254.056) -- 0:00:10
836500 -- (-1255.840) (-1256.146) [-1254.778] (-1255.874) * [-1254.384] (-1254.642) (-1256.183) (-1253.462) -- 0:00:10
837000 -- (-1255.759) (-1259.593) [-1252.830] (-1261.814) * (-1253.238) (-1255.026) (-1256.600) [-1254.312] -- 0:00:10
837500 -- [-1255.501] (-1254.161) (-1252.914) (-1254.687) * (-1253.238) (-1252.742) [-1254.604] (-1253.345) -- 0:00:10
838000 -- [-1256.613] (-1254.387) (-1259.562) (-1256.461) * (-1253.097) (-1255.554) [-1256.338] (-1253.681) -- 0:00:10
838500 -- (-1257.309) (-1255.895) (-1259.113) [-1254.558] * (-1254.341) (-1253.331) [-1254.526] (-1255.905) -- 0:00:10
839000 -- [-1257.243] (-1255.022) (-1253.561) (-1253.531) * [-1255.810] (-1254.674) (-1255.942) (-1254.151) -- 0:00:10
839500 -- [-1254.592] (-1261.597) (-1254.890) (-1253.921) * (-1252.653) (-1253.588) [-1256.745] (-1253.510) -- 0:00:10
840000 -- (-1256.827) [-1257.015] (-1256.383) (-1255.820) * [-1256.435] (-1254.821) (-1253.232) (-1254.004) -- 0:00:10
Average standard deviation of split frequencies: 0.008935
840500 -- (-1257.612) [-1255.719] (-1253.963) (-1254.923) * (-1255.202) [-1256.038] (-1256.351) (-1255.919) -- 0:00:10
841000 -- [-1253.278] (-1255.662) (-1260.959) (-1254.717) * (-1256.501) [-1254.920] (-1257.075) (-1255.156) -- 0:00:10
841500 -- (-1256.068) (-1264.113) [-1255.043] (-1254.612) * (-1253.506) (-1256.240) [-1253.760] (-1256.376) -- 0:00:10
842000 -- (-1257.518) (-1255.417) (-1255.762) [-1253.122] * (-1253.448) [-1252.581] (-1253.769) (-1252.644) -- 0:00:10
842500 -- [-1257.988] (-1254.307) (-1253.202) (-1258.050) * (-1253.874) (-1254.682) [-1253.778] (-1252.903) -- 0:00:10
843000 -- (-1257.809) (-1252.958) [-1255.048] (-1257.922) * (-1256.119) (-1256.852) (-1253.926) [-1253.328] -- 0:00:10
843500 -- [-1254.010] (-1254.068) (-1254.603) (-1255.880) * (-1257.191) [-1253.890] (-1254.055) (-1255.882) -- 0:00:10
844000 -- [-1253.974] (-1254.531) (-1255.577) (-1254.475) * (-1255.582) [-1255.734] (-1252.396) (-1255.151) -- 0:00:09
844500 -- [-1253.509] (-1254.879) (-1253.272) (-1255.332) * (-1256.396) (-1254.397) [-1252.954] (-1257.258) -- 0:00:09
845000 -- [-1257.575] (-1253.348) (-1255.246) (-1255.147) * (-1254.475) (-1253.259) (-1252.982) [-1256.262] -- 0:00:09
Average standard deviation of split frequencies: 0.008581
845500 -- [-1255.016] (-1254.556) (-1260.123) (-1258.278) * (-1253.284) [-1256.672] (-1254.619) (-1258.444) -- 0:00:09
846000 -- (-1252.897) (-1255.152) [-1259.083] (-1257.198) * (-1252.967) (-1253.521) [-1252.671] (-1253.927) -- 0:00:09
846500 -- (-1254.235) [-1254.947] (-1252.977) (-1260.034) * (-1255.466) (-1253.099) [-1254.020] (-1254.723) -- 0:00:09
847000 -- (-1255.276) [-1255.923] (-1252.974) (-1252.815) * (-1256.033) (-1253.097) [-1254.820] (-1256.215) -- 0:00:09
847500 -- (-1253.208) [-1257.068] (-1255.108) (-1255.742) * [-1254.237] (-1252.974) (-1252.781) (-1260.797) -- 0:00:09
848000 -- (-1253.164) (-1255.595) [-1253.521] (-1252.527) * [-1254.860] (-1255.543) (-1253.903) (-1263.029) -- 0:00:09
848500 -- (-1253.398) (-1256.478) (-1253.718) [-1258.430] * [-1255.464] (-1254.885) (-1253.216) (-1253.738) -- 0:00:09
849000 -- (-1252.323) [-1254.397] (-1256.764) (-1256.165) * [-1253.105] (-1254.576) (-1254.204) (-1257.687) -- 0:00:09
849500 -- (-1255.057) (-1254.302) [-1256.395] (-1257.955) * (-1256.984) [-1254.534] (-1258.362) (-1252.866) -- 0:00:09
850000 -- (-1254.971) [-1254.903] (-1259.113) (-1253.968) * (-1257.435) [-1254.801] (-1255.860) (-1253.619) -- 0:00:09
Average standard deviation of split frequencies: 0.008386
850500 -- [-1252.828] (-1255.768) (-1262.581) (-1253.791) * [-1255.589] (-1257.865) (-1252.895) (-1255.029) -- 0:00:09
851000 -- [-1253.571] (-1255.723) (-1253.614) (-1255.851) * (-1253.428) [-1263.039] (-1256.702) (-1253.489) -- 0:00:09
851500 -- (-1254.344) (-1255.059) (-1253.807) [-1253.379] * [-1256.251] (-1254.197) (-1258.365) (-1252.788) -- 0:00:09
852000 -- (-1253.923) [-1253.180] (-1254.222) (-1254.083) * [-1258.811] (-1253.726) (-1256.793) (-1253.512) -- 0:00:09
852500 -- [-1254.271] (-1252.845) (-1254.619) (-1254.187) * (-1257.490) [-1253.340] (-1253.367) (-1253.612) -- 0:00:09
853000 -- [-1253.767] (-1252.814) (-1256.730) (-1253.431) * [-1257.916] (-1253.962) (-1253.343) (-1254.480) -- 0:00:09
853500 -- (-1255.036) [-1256.284] (-1253.312) (-1254.234) * (-1253.675) (-1253.961) [-1254.050] (-1253.454) -- 0:00:09
854000 -- (-1257.277) (-1255.960) [-1253.250] (-1254.358) * (-1253.943) (-1252.872) (-1254.655) [-1254.410] -- 0:00:09
854500 -- (-1256.503) [-1255.971] (-1260.970) (-1253.300) * (-1254.954) [-1253.554] (-1259.445) (-1254.822) -- 0:00:09
855000 -- (-1253.547) [-1253.980] (-1257.646) (-1253.363) * (-1254.396) (-1255.432) (-1258.596) [-1254.381] -- 0:00:09
Average standard deviation of split frequencies: 0.008481
855500 -- (-1253.541) (-1254.827) (-1254.118) [-1256.373] * (-1253.796) (-1254.161) [-1257.030] (-1256.900) -- 0:00:09
856000 -- (-1258.171) (-1257.138) (-1254.183) [-1253.919] * (-1253.897) (-1258.363) [-1252.613] (-1253.995) -- 0:00:09
856500 -- (-1258.145) (-1254.722) (-1253.977) [-1254.206] * [-1253.019] (-1253.615) (-1254.238) (-1256.132) -- 0:00:09
857000 -- (-1254.447) (-1255.456) (-1254.296) [-1254.813] * (-1254.550) [-1255.597] (-1255.565) (-1253.022) -- 0:00:09
857500 -- (-1255.824) (-1254.298) (-1256.817) [-1253.792] * (-1253.457) (-1257.869) (-1254.747) [-1254.265] -- 0:00:09
858000 -- [-1257.520] (-1254.823) (-1257.303) (-1253.521) * [-1254.364] (-1255.992) (-1253.993) (-1254.495) -- 0:00:09
858500 -- (-1254.499) [-1256.524] (-1253.291) (-1254.386) * [-1255.469] (-1254.314) (-1256.058) (-1255.023) -- 0:00:09
859000 -- [-1255.064] (-1255.587) (-1252.907) (-1253.769) * (-1258.406) (-1258.876) [-1255.663] (-1259.462) -- 0:00:09
859500 -- (-1255.586) [-1253.360] (-1253.544) (-1253.792) * (-1254.439) (-1258.971) [-1254.915] (-1253.950) -- 0:00:08
860000 -- [-1254.531] (-1256.031) (-1252.819) (-1252.780) * (-1254.611) (-1258.123) (-1256.365) [-1253.613] -- 0:00:08
Average standard deviation of split frequencies: 0.008106
860500 -- [-1255.944] (-1255.270) (-1253.842) (-1255.577) * (-1259.091) (-1256.248) (-1255.539) [-1254.002] -- 0:00:08
861000 -- (-1255.311) (-1258.099) (-1252.428) [-1256.350] * (-1252.945) (-1256.410) [-1253.959] (-1254.873) -- 0:00:08
861500 -- (-1254.520) (-1253.786) (-1253.235) [-1253.862] * (-1256.193) (-1258.136) [-1254.060] (-1253.935) -- 0:00:08
862000 -- [-1254.125] (-1254.551) (-1256.797) (-1252.878) * (-1256.138) (-1257.806) [-1254.236] (-1253.351) -- 0:00:08
862500 -- (-1254.904) (-1253.531) [-1255.209] (-1256.366) * (-1255.765) (-1257.889) [-1252.821] (-1252.619) -- 0:00:08
863000 -- (-1258.949) [-1253.739] (-1255.425) (-1253.641) * (-1253.690) (-1255.137) [-1254.953] (-1257.114) -- 0:00:08
863500 -- (-1254.144) [-1257.242] (-1254.442) (-1254.916) * (-1254.808) [-1257.096] (-1254.250) (-1258.475) -- 0:00:08
864000 -- (-1260.208) (-1255.336) (-1255.429) [-1255.435] * (-1254.749) (-1253.822) [-1252.787] (-1256.338) -- 0:00:08
864500 -- (-1254.509) [-1255.687] (-1257.015) (-1255.095) * (-1254.424) (-1252.938) [-1254.420] (-1256.329) -- 0:00:08
865000 -- (-1253.732) [-1254.823] (-1255.774) (-1254.030) * (-1254.306) [-1253.446] (-1257.000) (-1255.736) -- 0:00:08
Average standard deviation of split frequencies: 0.008238
865500 -- (-1254.393) (-1253.788) [-1254.295] (-1254.491) * (-1255.975) (-1254.075) (-1255.311) [-1252.731] -- 0:00:08
866000 -- (-1257.505) [-1253.268] (-1258.208) (-1254.980) * (-1253.417) [-1254.289] (-1256.701) (-1252.907) -- 0:00:08
866500 -- (-1253.940) (-1256.106) (-1256.270) [-1254.794] * (-1254.481) (-1257.493) (-1256.764) [-1253.684] -- 0:00:08
867000 -- (-1255.595) (-1256.064) [-1257.106] (-1252.784) * [-1252.843] (-1256.261) (-1255.488) (-1254.377) -- 0:00:08
867500 -- (-1258.060) [-1257.148] (-1254.278) (-1254.484) * (-1253.325) [-1253.780] (-1254.657) (-1253.937) -- 0:00:08
868000 -- (-1253.739) (-1254.369) [-1256.625] (-1254.144) * (-1255.926) [-1253.205] (-1256.429) (-1255.065) -- 0:00:08
868500 -- [-1254.918] (-1257.225) (-1260.051) (-1254.294) * (-1253.684) (-1255.313) [-1253.749] (-1256.426) -- 0:00:08
869000 -- (-1254.081) [-1256.761] (-1257.101) (-1257.513) * (-1254.543) (-1255.465) [-1252.941] (-1253.775) -- 0:00:08
869500 -- [-1254.376] (-1253.725) (-1254.487) (-1255.927) * (-1256.448) [-1255.640] (-1255.386) (-1256.602) -- 0:00:08
870000 -- [-1255.627] (-1252.921) (-1252.548) (-1253.372) * [-1255.258] (-1257.395) (-1254.100) (-1259.749) -- 0:00:08
Average standard deviation of split frequencies: 0.008121
870500 -- (-1255.152) [-1255.484] (-1254.990) (-1252.975) * [-1257.266] (-1252.584) (-1252.951) (-1255.308) -- 0:00:08
871000 -- (-1254.647) [-1253.466] (-1255.013) (-1254.352) * [-1252.898] (-1254.219) (-1257.025) (-1254.883) -- 0:00:08
871500 -- (-1255.812) [-1255.380] (-1256.273) (-1252.988) * [-1253.448] (-1260.727) (-1254.357) (-1255.676) -- 0:00:08
872000 -- (-1254.243) [-1254.828] (-1256.626) (-1258.592) * (-1253.964) (-1253.327) (-1256.693) [-1256.774] -- 0:00:08
872500 -- [-1253.427] (-1254.218) (-1257.042) (-1257.211) * (-1255.525) (-1253.510) (-1253.919) [-1252.973] -- 0:00:08
873000 -- (-1256.220) (-1254.523) (-1255.428) [-1255.706] * (-1253.319) [-1252.581] (-1256.938) (-1256.337) -- 0:00:08
873500 -- (-1255.358) (-1254.663) (-1255.860) [-1253.188] * [-1254.126] (-1254.924) (-1257.816) (-1254.423) -- 0:00:08
874000 -- (-1256.842) [-1256.577] (-1255.600) (-1253.957) * (-1253.408) (-1253.379) (-1255.813) [-1255.434] -- 0:00:08
874500 -- (-1255.272) (-1254.605) [-1255.377] (-1253.645) * (-1253.064) (-1252.886) [-1253.846] (-1253.069) -- 0:00:08
875000 -- [-1254.628] (-1254.637) (-1253.910) (-1255.024) * [-1254.076] (-1253.599) (-1254.078) (-1257.070) -- 0:00:08
Average standard deviation of split frequencies: 0.007641
875500 -- [-1254.004] (-1257.645) (-1256.531) (-1253.321) * (-1256.029) [-1254.698] (-1252.660) (-1253.729) -- 0:00:07
876000 -- (-1254.139) [-1256.628] (-1260.105) (-1256.180) * (-1254.696) (-1254.616) (-1253.616) [-1253.628] -- 0:00:07
876500 -- (-1253.435) (-1253.621) [-1252.915] (-1256.503) * (-1257.704) [-1256.127] (-1256.021) (-1253.039) -- 0:00:07
877000 -- (-1253.310) (-1255.954) [-1252.918] (-1256.248) * [-1255.723] (-1256.552) (-1253.847) (-1253.682) -- 0:00:07
877500 -- (-1252.558) [-1252.666] (-1253.866) (-1252.935) * (-1255.195) [-1254.671] (-1253.752) (-1254.119) -- 0:00:07
878000 -- (-1252.506) [-1254.358] (-1254.012) (-1253.056) * (-1255.915) [-1254.280] (-1257.231) (-1256.281) -- 0:00:07
878500 -- [-1254.000] (-1254.558) (-1257.305) (-1254.525) * [-1253.729] (-1256.374) (-1255.690) (-1254.758) -- 0:00:07
879000 -- (-1256.289) (-1256.934) (-1257.908) [-1254.402] * [-1254.604] (-1254.559) (-1253.201) (-1256.387) -- 0:00:07
879500 -- (-1253.245) (-1254.510) [-1256.667] (-1253.372) * (-1253.885) (-1255.759) [-1257.981] (-1253.393) -- 0:00:07
880000 -- [-1253.764] (-1259.882) (-1256.469) (-1253.686) * (-1255.663) (-1254.042) (-1256.072) [-1252.876] -- 0:00:07
Average standard deviation of split frequencies: 0.007530
880500 -- (-1254.583) (-1257.114) [-1253.187] (-1255.761) * [-1254.100] (-1256.926) (-1254.807) (-1252.869) -- 0:00:07
881000 -- (-1253.041) [-1255.328] (-1253.715) (-1253.599) * (-1252.645) (-1254.913) (-1254.118) [-1254.856] -- 0:00:07
881500 -- (-1257.808) (-1253.590) (-1254.516) [-1256.160] * [-1254.163] (-1255.865) (-1254.466) (-1252.820) -- 0:00:07
882000 -- (-1258.858) (-1258.020) (-1258.419) [-1255.432] * (-1257.073) (-1255.712) [-1253.190] (-1254.294) -- 0:00:07
882500 -- (-1253.252) (-1255.262) [-1255.573] (-1254.704) * (-1252.657) (-1256.585) (-1253.390) [-1254.441] -- 0:00:07
883000 -- [-1255.046] (-1254.143) (-1253.065) (-1255.953) * [-1253.612] (-1256.842) (-1252.841) (-1253.257) -- 0:00:07
883500 -- (-1256.797) [-1253.080] (-1254.552) (-1255.791) * (-1253.840) (-1261.329) [-1253.339] (-1253.356) -- 0:00:07
884000 -- (-1255.425) [-1252.534] (-1254.910) (-1254.359) * (-1253.262) (-1254.921) (-1262.463) [-1253.553] -- 0:00:07
884500 -- (-1253.758) [-1253.022] (-1253.704) (-1252.465) * [-1252.270] (-1253.454) (-1260.519) (-1253.433) -- 0:00:07
885000 -- [-1252.696] (-1253.262) (-1253.760) (-1254.196) * (-1255.954) (-1259.695) (-1259.664) [-1254.368] -- 0:00:07
Average standard deviation of split frequencies: 0.007981
885500 -- [-1253.590] (-1255.711) (-1253.446) (-1254.545) * (-1255.771) (-1254.681) [-1254.005] (-1255.017) -- 0:00:07
886000 -- (-1253.472) [-1257.050] (-1258.219) (-1257.001) * [-1253.867] (-1255.701) (-1254.891) (-1255.585) -- 0:00:07
886500 -- [-1252.587] (-1255.066) (-1257.584) (-1257.966) * (-1254.417) [-1254.357] (-1256.807) (-1254.545) -- 0:00:07
887000 -- (-1255.676) (-1257.535) (-1254.891) [-1255.619] * [-1252.993] (-1252.817) (-1252.554) (-1253.213) -- 0:00:07
887500 -- [-1253.117] (-1254.925) (-1256.442) (-1252.778) * [-1254.213] (-1254.935) (-1254.499) (-1254.900) -- 0:00:07
888000 -- (-1254.702) (-1253.292) [-1256.403] (-1252.886) * (-1255.821) (-1257.174) [-1255.589] (-1254.916) -- 0:00:07
888500 -- (-1256.783) (-1255.767) [-1256.458] (-1252.542) * [-1254.207] (-1256.431) (-1253.570) (-1258.446) -- 0:00:07
889000 -- (-1253.915) (-1253.610) (-1253.702) [-1253.500] * (-1254.924) (-1254.305) [-1252.841] (-1254.159) -- 0:00:07
889500 -- (-1254.588) (-1260.113) [-1253.783] (-1252.734) * (-1254.834) (-1254.622) (-1255.072) [-1256.848] -- 0:00:07
890000 -- (-1253.416) (-1257.352) (-1254.338) [-1254.306] * (-1253.562) (-1254.224) [-1252.910] (-1254.078) -- 0:00:07
Average standard deviation of split frequencies: 0.007692
890500 -- (-1254.094) (-1253.474) [-1254.887] (-1253.379) * (-1252.829) (-1252.234) [-1253.625] (-1259.700) -- 0:00:07
891000 -- (-1253.033) [-1255.332] (-1254.085) (-1253.409) * (-1255.715) (-1253.233) [-1253.645] (-1260.263) -- 0:00:06
891500 -- (-1256.786) [-1253.624] (-1257.925) (-1255.407) * (-1255.155) (-1256.929) (-1252.675) [-1258.322] -- 0:00:06
892000 -- (-1259.590) [-1252.973] (-1255.030) (-1254.063) * (-1254.961) (-1256.311) [-1252.529] (-1258.568) -- 0:00:06
892500 -- (-1253.556) (-1257.634) (-1255.194) [-1253.840] * (-1259.833) [-1254.724] (-1254.123) (-1256.415) -- 0:00:06
893000 -- [-1252.876] (-1252.915) (-1255.659) (-1254.226) * [-1257.149] (-1254.393) (-1258.010) (-1252.357) -- 0:00:06
893500 -- [-1256.316] (-1253.460) (-1255.845) (-1253.691) * (-1253.855) [-1254.259] (-1253.149) (-1254.031) -- 0:00:06
894000 -- [-1256.074] (-1255.134) (-1257.833) (-1259.222) * (-1253.188) (-1255.038) [-1254.096] (-1253.772) -- 0:00:06
894500 -- (-1255.792) [-1257.333] (-1255.325) (-1257.859) * [-1253.356] (-1253.138) (-1253.251) (-1253.063) -- 0:00:06
895000 -- (-1254.854) (-1258.202) (-1252.549) [-1257.482] * [-1255.218] (-1255.044) (-1253.228) (-1256.975) -- 0:00:06
Average standard deviation of split frequencies: 0.007962
895500 -- (-1256.719) (-1255.194) (-1254.436) [-1257.499] * (-1255.843) (-1255.400) (-1259.184) [-1253.848] -- 0:00:06
896000 -- (-1253.550) (-1253.555) (-1254.466) [-1255.487] * (-1260.687) (-1260.185) [-1252.686] (-1253.210) -- 0:00:06
896500 -- (-1253.242) (-1254.380) [-1254.884] (-1253.585) * [-1255.743] (-1258.311) (-1255.883) (-1253.818) -- 0:00:06
897000 -- [-1253.582] (-1255.919) (-1253.286) (-1253.868) * (-1253.376) (-1255.089) [-1254.478] (-1254.252) -- 0:00:06
897500 -- [-1252.463] (-1252.990) (-1254.192) (-1253.385) * (-1255.035) [-1255.570] (-1256.242) (-1253.747) -- 0:00:06
898000 -- (-1254.843) [-1253.161] (-1255.689) (-1253.275) * (-1253.330) [-1252.902] (-1253.331) (-1253.063) -- 0:00:06
898500 -- (-1253.839) (-1254.138) [-1254.068] (-1256.797) * [-1254.040] (-1252.710) (-1255.399) (-1255.330) -- 0:00:06
899000 -- (-1255.984) (-1255.499) (-1254.324) [-1253.254] * (-1257.281) (-1256.228) [-1253.822] (-1254.009) -- 0:00:06
899500 -- (-1257.914) (-1254.431) [-1253.611] (-1256.834) * (-1253.676) (-1256.761) (-1255.074) [-1256.114] -- 0:00:06
900000 -- [-1253.066] (-1259.890) (-1253.801) (-1257.238) * (-1252.962) (-1254.438) [-1253.669] (-1255.330) -- 0:00:06
Average standard deviation of split frequencies: 0.007746
900500 -- (-1253.106) [-1255.155] (-1253.533) (-1254.208) * (-1253.005) (-1254.914) (-1254.313) [-1255.984] -- 0:00:06
901000 -- (-1253.174) (-1256.609) [-1256.811] (-1258.169) * (-1255.650) [-1253.003] (-1254.303) (-1256.882) -- 0:00:06
901500 -- (-1252.516) [-1255.438] (-1254.835) (-1258.066) * [-1253.802] (-1254.734) (-1253.663) (-1257.633) -- 0:00:06
902000 -- (-1253.079) [-1253.069] (-1256.839) (-1255.615) * (-1253.733) (-1258.019) [-1254.299] (-1255.148) -- 0:00:06
902500 -- [-1254.556] (-1254.455) (-1262.399) (-1254.848) * (-1254.459) (-1258.014) [-1253.589] (-1255.974) -- 0:00:06
903000 -- (-1255.175) (-1255.104) [-1252.715] (-1255.830) * (-1255.283) (-1254.024) (-1258.131) [-1255.013] -- 0:00:06
903500 -- (-1252.912) (-1255.992) (-1253.684) [-1258.431] * (-1254.207) (-1259.859) (-1253.075) [-1254.512] -- 0:00:06
904000 -- (-1256.848) (-1257.803) [-1256.640] (-1257.818) * [-1256.564] (-1253.400) (-1253.313) (-1252.460) -- 0:00:06
904500 -- (-1257.361) (-1255.671) [-1252.710] (-1254.626) * [-1252.418] (-1255.795) (-1253.992) (-1257.113) -- 0:00:06
905000 -- (-1259.761) [-1253.759] (-1255.911) (-1253.068) * (-1253.953) [-1255.992] (-1252.498) (-1258.251) -- 0:00:06
Average standard deviation of split frequencies: 0.007666
905500 -- (-1255.292) [-1253.362] (-1253.900) (-1255.297) * (-1253.816) (-1256.299) [-1254.176] (-1257.561) -- 0:00:06
906000 -- (-1253.492) (-1252.804) [-1254.957] (-1257.795) * (-1253.980) (-1256.050) [-1254.867] (-1255.921) -- 0:00:06
906500 -- (-1253.383) (-1255.811) (-1254.104) [-1258.526] * (-1256.324) (-1254.468) [-1253.465] (-1257.710) -- 0:00:05
907000 -- (-1254.174) [-1255.271] (-1253.056) (-1255.902) * (-1258.016) (-1254.733) (-1255.849) [-1252.688] -- 0:00:05
907500 -- (-1254.056) (-1257.991) (-1256.563) [-1253.639] * (-1254.648) (-1255.270) (-1253.928) [-1252.945] -- 0:00:05
908000 -- (-1252.623) (-1254.423) [-1254.578] (-1254.902) * (-1254.581) (-1257.480) [-1253.146] (-1253.005) -- 0:00:05
908500 -- (-1253.129) [-1255.540] (-1253.420) (-1254.688) * (-1255.001) (-1256.003) [-1253.577] (-1253.957) -- 0:00:05
909000 -- (-1255.223) [-1255.863] (-1253.438) (-1258.216) * (-1255.494) (-1256.650) (-1255.139) [-1254.362] -- 0:00:05
909500 -- [-1255.591] (-1253.885) (-1257.482) (-1254.165) * (-1259.071) (-1252.484) [-1253.250] (-1255.426) -- 0:00:05
910000 -- [-1253.820] (-1254.262) (-1254.807) (-1254.550) * (-1259.508) [-1257.312] (-1255.449) (-1254.142) -- 0:00:05
Average standard deviation of split frequencies: 0.007696
910500 -- (-1253.052) [-1253.645] (-1253.095) (-1259.402) * (-1256.649) [-1255.994] (-1253.880) (-1256.300) -- 0:00:05
911000 -- (-1252.515) (-1254.206) (-1256.590) [-1255.157] * (-1254.605) [-1255.337] (-1253.777) (-1253.940) -- 0:00:05
911500 -- (-1252.438) (-1253.445) [-1252.972] (-1256.706) * (-1254.736) (-1254.619) (-1253.633) [-1255.460] -- 0:00:05
912000 -- [-1252.461] (-1255.643) (-1255.237) (-1253.785) * (-1253.988) [-1253.419] (-1255.293) (-1254.268) -- 0:00:05
912500 -- (-1256.797) (-1254.270) [-1254.793] (-1253.367) * [-1255.346] (-1252.720) (-1254.436) (-1252.380) -- 0:00:05
913000 -- (-1253.292) (-1255.654) [-1258.118] (-1252.565) * (-1256.467) [-1253.956] (-1255.724) (-1253.876) -- 0:00:05
913500 -- [-1252.836] (-1259.966) (-1253.642) (-1253.049) * (-1257.746) [-1252.734] (-1256.288) (-1256.480) -- 0:00:05
914000 -- (-1254.623) (-1258.816) [-1253.289] (-1253.341) * (-1254.476) [-1253.232] (-1256.297) (-1255.475) -- 0:00:05
914500 -- (-1252.594) [-1257.087] (-1256.027) (-1253.990) * [-1253.545] (-1253.362) (-1261.439) (-1256.934) -- 0:00:05
915000 -- (-1252.706) (-1259.087) [-1253.782] (-1253.649) * [-1252.743] (-1252.846) (-1258.213) (-1253.982) -- 0:00:05
Average standard deviation of split frequencies: 0.007445
915500 -- (-1254.006) (-1258.467) (-1255.713) [-1254.506] * (-1254.607) (-1252.846) (-1254.857) [-1253.567] -- 0:00:05
916000 -- (-1253.747) (-1255.946) (-1254.083) [-1254.261] * (-1253.324) [-1255.240] (-1256.416) (-1255.833) -- 0:00:05
916500 -- (-1254.791) [-1253.865] (-1253.134) (-1255.853) * (-1253.287) (-1254.771) [-1253.912] (-1256.107) -- 0:00:05
917000 -- (-1256.228) [-1253.371] (-1254.805) (-1256.047) * [-1254.615] (-1253.609) (-1255.358) (-1257.546) -- 0:00:05
917500 -- [-1252.765] (-1255.139) (-1256.951) (-1252.941) * (-1255.531) (-1252.635) [-1254.008] (-1257.617) -- 0:00:05
918000 -- (-1254.308) (-1252.806) [-1255.351] (-1254.350) * (-1254.465) [-1255.348] (-1255.456) (-1257.765) -- 0:00:05
918500 -- [-1255.827] (-1252.380) (-1257.002) (-1254.087) * (-1254.655) (-1256.572) (-1253.572) [-1256.746] -- 0:00:05
919000 -- (-1257.078) [-1254.015] (-1260.124) (-1256.484) * [-1257.893] (-1254.870) (-1253.649) (-1256.100) -- 0:00:05
919500 -- [-1253.183] (-1253.133) (-1260.400) (-1255.998) * [-1254.313] (-1256.324) (-1254.202) (-1253.017) -- 0:00:05
920000 -- [-1253.384] (-1252.746) (-1256.654) (-1256.814) * (-1256.470) (-1253.327) [-1254.071] (-1253.729) -- 0:00:05
Average standard deviation of split frequencies: 0.007202
920500 -- (-1259.735) [-1254.106] (-1255.072) (-1256.175) * (-1259.908) [-1254.048] (-1252.553) (-1258.053) -- 0:00:05
921000 -- (-1256.720) (-1254.015) [-1252.884] (-1254.709) * (-1257.823) [-1252.964] (-1254.268) (-1252.731) -- 0:00:05
921500 -- (-1254.214) (-1256.144) (-1254.950) [-1255.536] * (-1255.237) (-1254.921) [-1254.393] (-1254.127) -- 0:00:05
922000 -- [-1254.108] (-1254.538) (-1259.849) (-1254.224) * [-1254.449] (-1254.044) (-1254.075) (-1253.688) -- 0:00:04
922500 -- (-1256.061) [-1254.605] (-1252.625) (-1253.288) * (-1254.412) (-1255.299) [-1253.488] (-1252.501) -- 0:00:04
923000 -- [-1255.993] (-1258.150) (-1257.348) (-1254.266) * (-1253.852) [-1256.348] (-1252.606) (-1253.330) -- 0:00:04
923500 -- [-1254.385] (-1254.767) (-1254.003) (-1254.849) * (-1253.597) (-1254.274) (-1253.554) [-1252.299] -- 0:00:04
924000 -- (-1253.365) [-1254.590] (-1254.218) (-1254.972) * [-1253.973] (-1254.016) (-1253.595) (-1253.154) -- 0:00:04
924500 -- [-1253.335] (-1256.526) (-1257.871) (-1257.697) * (-1256.187) [-1256.064] (-1256.547) (-1255.620) -- 0:00:04
925000 -- (-1254.638) (-1255.633) (-1256.549) [-1255.964] * (-1254.403) (-1259.074) [-1255.016] (-1255.947) -- 0:00:04
Average standard deviation of split frequencies: 0.006686
925500 -- (-1254.682) (-1256.955) (-1254.409) [-1253.664] * (-1257.385) (-1252.527) (-1253.674) [-1253.270] -- 0:00:04
926000 -- (-1253.711) (-1257.978) (-1253.954) [-1254.869] * (-1252.838) [-1254.478] (-1252.896) (-1253.973) -- 0:00:04
926500 -- (-1255.619) [-1257.800] (-1253.299) (-1254.987) * (-1253.921) [-1254.818] (-1253.319) (-1257.698) -- 0:00:04
927000 -- (-1255.341) [-1253.452] (-1254.383) (-1254.643) * (-1254.978) (-1256.914) [-1254.185] (-1254.791) -- 0:00:04
927500 -- (-1258.000) (-1254.333) [-1255.243] (-1258.695) * (-1256.382) [-1255.340] (-1253.036) (-1254.124) -- 0:00:04
928000 -- (-1258.400) [-1252.796] (-1255.483) (-1256.282) * (-1255.565) [-1256.581] (-1253.851) (-1255.836) -- 0:00:04
928500 -- [-1254.268] (-1253.373) (-1254.726) (-1256.689) * (-1254.616) (-1258.025) [-1253.639] (-1253.983) -- 0:00:04
929000 -- (-1252.917) (-1254.023) [-1254.974] (-1257.559) * [-1253.267] (-1256.172) (-1256.015) (-1254.424) -- 0:00:04
929500 -- (-1252.978) (-1252.886) (-1254.415) [-1255.266] * [-1253.277] (-1257.735) (-1252.863) (-1253.065) -- 0:00:04
930000 -- (-1252.428) [-1253.921] (-1255.063) (-1253.533) * (-1253.244) (-1260.157) [-1255.162] (-1252.912) -- 0:00:04
Average standard deviation of split frequencies: 0.006889
930500 -- (-1253.861) [-1252.762] (-1258.164) (-1253.357) * (-1253.496) (-1256.077) [-1256.079] (-1256.377) -- 0:00:04
931000 -- (-1254.684) [-1252.247] (-1254.488) (-1254.065) * (-1253.338) [-1254.264] (-1258.235) (-1256.790) -- 0:00:04
931500 -- [-1256.189] (-1252.648) (-1255.373) (-1252.960) * (-1253.956) [-1253.777] (-1253.401) (-1257.385) -- 0:00:04
932000 -- (-1254.962) (-1252.430) (-1254.937) [-1254.567] * (-1253.006) (-1254.922) [-1252.735] (-1254.661) -- 0:00:04
932500 -- (-1253.848) [-1256.100] (-1253.768) (-1254.999) * (-1254.058) (-1254.403) (-1252.740) [-1254.085] -- 0:00:04
933000 -- (-1258.589) (-1252.408) [-1253.603] (-1254.008) * (-1257.262) [-1254.014] (-1254.391) (-1259.329) -- 0:00:04
933500 -- [-1259.985] (-1255.530) (-1261.424) (-1255.009) * [-1254.477] (-1256.424) (-1253.667) (-1259.317) -- 0:00:04
934000 -- [-1256.575] (-1252.382) (-1256.488) (-1254.735) * [-1253.344] (-1258.533) (-1257.385) (-1256.076) -- 0:00:04
934500 -- [-1253.126] (-1254.206) (-1255.584) (-1255.358) * (-1254.017) (-1255.859) (-1258.192) [-1254.408] -- 0:00:04
935000 -- (-1254.916) (-1254.359) (-1254.587) [-1254.245] * [-1257.276] (-1253.823) (-1256.682) (-1258.216) -- 0:00:04
Average standard deviation of split frequencies: 0.006917
935500 -- (-1259.373) [-1255.687] (-1254.015) (-1258.532) * (-1258.047) [-1255.177] (-1254.912) (-1263.532) -- 0:00:04
936000 -- (-1259.334) [-1253.707] (-1257.805) (-1255.733) * (-1255.574) (-1256.772) [-1255.885] (-1254.959) -- 0:00:04
936500 -- (-1255.248) (-1257.571) [-1254.441] (-1254.911) * (-1253.907) [-1255.426] (-1255.640) (-1256.760) -- 0:00:04
937000 -- (-1254.816) (-1255.847) (-1255.395) [-1254.063] * (-1254.580) (-1255.519) [-1253.958] (-1256.422) -- 0:00:04
937500 -- (-1254.713) (-1253.888) (-1255.548) [-1256.025] * (-1254.064) (-1254.855) [-1257.525] (-1254.756) -- 0:00:04
938000 -- (-1255.296) [-1252.200] (-1252.409) (-1258.289) * (-1253.747) (-1255.240) (-1252.674) [-1252.313] -- 0:00:03
938500 -- [-1254.622] (-1252.952) (-1253.701) (-1256.338) * (-1253.964) (-1253.756) [-1253.586] (-1255.121) -- 0:00:03
939000 -- (-1254.849) (-1254.555) (-1257.417) [-1254.232] * (-1253.607) (-1253.680) (-1254.982) [-1253.387] -- 0:00:03
939500 -- (-1254.081) [-1252.971] (-1253.411) (-1252.787) * (-1253.419) [-1253.972] (-1254.126) (-1253.312) -- 0:00:03
940000 -- (-1252.824) [-1252.624] (-1257.422) (-1254.338) * (-1254.447) (-1258.320) (-1256.259) [-1257.936] -- 0:00:03
Average standard deviation of split frequencies: 0.006782
940500 -- (-1253.224) (-1252.794) [-1254.802] (-1252.940) * (-1252.402) [-1254.567] (-1257.765) (-1254.409) -- 0:00:03
941000 -- (-1253.000) (-1254.191) (-1255.664) [-1253.053] * (-1253.605) (-1253.598) [-1256.378] (-1257.572) -- 0:00:03
941500 -- [-1253.653] (-1254.087) (-1253.569) (-1253.832) * [-1253.181] (-1255.490) (-1255.874) (-1256.785) -- 0:00:03
942000 -- [-1257.512] (-1255.663) (-1254.312) (-1257.342) * (-1253.921) (-1258.564) [-1253.545] (-1253.443) -- 0:00:03
942500 -- (-1256.166) [-1255.615] (-1258.516) (-1253.836) * (-1259.407) (-1254.769) (-1257.561) [-1254.105] -- 0:00:03
943000 -- (-1254.528) (-1256.431) (-1255.126) [-1254.611] * (-1255.243) (-1255.064) [-1253.672] (-1254.202) -- 0:00:03
943500 -- (-1255.280) (-1255.642) [-1253.937] (-1256.703) * [-1257.778] (-1255.915) (-1258.207) (-1253.540) -- 0:00:03
944000 -- (-1255.241) (-1254.176) (-1254.492) [-1253.355] * (-1255.384) (-1258.989) (-1253.009) [-1252.659] -- 0:00:03
944500 -- [-1255.280] (-1255.033) (-1255.147) (-1254.820) * (-1254.961) (-1253.840) [-1252.878] (-1252.925) -- 0:00:03
945000 -- (-1252.903) (-1253.777) (-1255.824) [-1253.346] * (-1256.837) [-1255.158] (-1255.228) (-1254.062) -- 0:00:03
Average standard deviation of split frequencies: 0.006478
945500 -- (-1254.685) (-1256.588) (-1255.754) [-1252.847] * (-1256.994) [-1257.668] (-1254.320) (-1255.637) -- 0:00:03
946000 -- (-1253.294) (-1253.358) [-1255.194] (-1254.150) * [-1254.801] (-1258.368) (-1253.717) (-1253.564) -- 0:00:03
946500 -- (-1260.189) (-1254.528) [-1255.412] (-1257.566) * (-1254.767) (-1253.799) [-1254.556] (-1255.347) -- 0:00:03
947000 -- (-1252.908) [-1256.902] (-1256.563) (-1253.686) * (-1256.938) [-1253.227] (-1254.198) (-1255.201) -- 0:00:03
947500 -- (-1254.189) (-1255.807) [-1254.461] (-1254.855) * (-1254.519) (-1253.988) (-1253.765) [-1256.610] -- 0:00:03
948000 -- (-1254.815) (-1252.781) [-1255.813] (-1258.719) * [-1254.851] (-1255.456) (-1253.501) (-1256.713) -- 0:00:03
948500 -- (-1254.223) [-1253.632] (-1254.479) (-1253.607) * (-1252.755) (-1253.938) [-1253.093] (-1257.727) -- 0:00:03
949000 -- (-1257.314) (-1253.598) [-1252.679] (-1253.591) * (-1253.754) (-1254.414) (-1253.778) [-1255.300] -- 0:00:03
949500 -- [-1255.164] (-1255.737) (-1253.529) (-1256.380) * (-1256.012) [-1253.598] (-1253.123) (-1255.875) -- 0:00:03
950000 -- (-1256.646) (-1254.974) (-1259.735) [-1255.990] * (-1257.605) [-1255.413] (-1253.747) (-1253.971) -- 0:00:03
Average standard deviation of split frequencies: 0.006545
950500 -- (-1258.717) (-1252.824) [-1254.848] (-1258.688) * [-1254.299] (-1265.376) (-1259.733) (-1256.577) -- 0:00:03
951000 -- (-1255.220) [-1255.733] (-1255.168) (-1253.404) * [-1253.920] (-1255.747) (-1256.328) (-1256.967) -- 0:00:03
951500 -- (-1256.244) (-1256.949) (-1254.539) [-1252.979] * (-1253.547) (-1254.685) [-1259.494] (-1254.147) -- 0:00:03
952000 -- (-1254.817) (-1257.379) [-1253.580] (-1255.161) * (-1252.784) (-1255.168) [-1257.070] (-1254.528) -- 0:00:03
952500 -- (-1255.326) (-1255.232) (-1254.518) [-1255.384] * [-1253.098] (-1253.132) (-1254.475) (-1253.228) -- 0:00:03
953000 -- (-1256.089) (-1255.408) [-1254.213] (-1253.115) * [-1253.536] (-1254.892) (-1254.908) (-1254.293) -- 0:00:03
953500 -- (-1252.753) (-1257.620) (-1254.019) [-1254.540] * (-1254.887) (-1257.011) [-1256.315] (-1255.322) -- 0:00:02
954000 -- (-1253.051) (-1258.229) (-1258.132) [-1256.778] * (-1253.921) (-1256.651) [-1253.742] (-1253.896) -- 0:00:02
954500 -- [-1253.457] (-1256.410) (-1255.566) (-1254.007) * (-1255.038) (-1253.787) (-1255.529) [-1254.212] -- 0:00:02
955000 -- (-1255.034) [-1254.215] (-1253.863) (-1253.160) * (-1255.801) (-1256.719) [-1254.099] (-1254.433) -- 0:00:02
Average standard deviation of split frequencies: 0.006443
955500 -- (-1256.748) [-1254.567] (-1255.395) (-1254.829) * (-1253.572) [-1253.420] (-1254.533) (-1253.173) -- 0:00:02
956000 -- (-1255.814) [-1254.570] (-1253.706) (-1253.888) * (-1258.294) (-1253.024) (-1255.487) [-1252.536] -- 0:00:02
956500 -- [-1256.352] (-1254.983) (-1253.712) (-1255.393) * (-1254.272) (-1255.520) [-1254.737] (-1252.659) -- 0:00:02
957000 -- [-1253.268] (-1255.775) (-1253.712) (-1256.326) * (-1253.536) [-1253.429] (-1254.759) (-1255.898) -- 0:00:02
957500 -- (-1254.209) [-1254.556] (-1253.769) (-1257.072) * (-1254.128) (-1254.308) (-1254.550) [-1254.377] -- 0:00:02
958000 -- (-1255.015) (-1252.733) [-1253.293] (-1253.657) * (-1253.502) [-1253.330] (-1253.576) (-1252.501) -- 0:00:02
958500 -- (-1254.576) (-1255.432) [-1255.561] (-1254.079) * (-1257.410) [-1254.295] (-1253.596) (-1256.973) -- 0:00:02
959000 -- [-1254.578] (-1253.575) (-1253.452) (-1254.444) * (-1253.703) (-1254.522) (-1253.938) [-1257.124] -- 0:00:02
959500 -- (-1253.619) (-1254.603) [-1253.595] (-1254.067) * (-1257.825) (-1254.472) (-1253.872) [-1252.605] -- 0:00:02
960000 -- (-1254.023) (-1253.084) [-1253.131] (-1256.318) * (-1263.744) [-1254.145] (-1258.563) (-1252.915) -- 0:00:02
Average standard deviation of split frequencies: 0.006019
960500 -- (-1253.509) (-1254.258) (-1262.986) [-1252.528] * (-1259.609) (-1254.792) [-1252.963] (-1254.822) -- 0:00:02
961000 -- (-1254.154) (-1255.171) (-1263.191) [-1253.414] * (-1252.881) (-1255.791) [-1255.569] (-1255.099) -- 0:00:02
961500 -- (-1255.594) (-1256.040) (-1259.043) [-1253.166] * (-1256.697) (-1254.611) [-1255.399] (-1255.489) -- 0:00:02
962000 -- (-1259.498) (-1255.168) [-1259.354] (-1255.186) * (-1253.494) [-1252.524] (-1254.042) (-1254.024) -- 0:00:02
962500 -- (-1253.640) (-1253.401) (-1254.415) [-1253.854] * (-1254.096) (-1253.607) (-1253.988) [-1252.920] -- 0:00:02
963000 -- (-1253.482) [-1255.255] (-1256.266) (-1260.210) * (-1253.132) (-1254.080) (-1253.256) [-1254.757] -- 0:00:02
963500 -- (-1252.726) [-1254.725] (-1252.904) (-1254.046) * [-1253.400] (-1255.410) (-1258.515) (-1255.098) -- 0:00:02
964000 -- [-1255.849] (-1256.213) (-1255.302) (-1254.494) * [-1255.258] (-1255.921) (-1256.132) (-1254.313) -- 0:00:02
964500 -- (-1253.941) (-1255.044) (-1252.816) [-1257.839] * (-1255.829) (-1254.942) [-1255.013] (-1254.350) -- 0:00:02
965000 -- (-1254.567) (-1254.347) (-1260.831) [-1253.138] * (-1259.241) (-1257.845) (-1252.955) [-1255.002] -- 0:00:02
Average standard deviation of split frequencies: 0.005661
965500 -- (-1253.478) (-1253.038) [-1254.543] (-1252.914) * (-1255.112) (-1254.163) [-1252.629] (-1256.680) -- 0:00:02
966000 -- [-1253.899] (-1252.722) (-1254.479) (-1257.193) * (-1255.516) (-1254.359) [-1255.997] (-1255.109) -- 0:00:02
966500 -- [-1255.237] (-1256.342) (-1254.504) (-1254.185) * (-1256.264) (-1255.299) (-1257.844) [-1253.882] -- 0:00:02
967000 -- (-1256.430) (-1254.323) [-1255.111] (-1253.497) * (-1253.092) (-1255.649) (-1257.237) [-1252.407] -- 0:00:02
967500 -- (-1256.628) (-1256.841) (-1257.223) [-1254.727] * (-1254.831) (-1257.049) [-1256.080] (-1255.000) -- 0:00:02
968000 -- (-1256.988) [-1255.649] (-1258.713) (-1253.350) * (-1255.729) (-1256.514) (-1253.575) [-1257.082] -- 0:00:02
968500 -- [-1258.510] (-1253.003) (-1256.026) (-1257.205) * [-1253.706] (-1259.897) (-1257.048) (-1256.908) -- 0:00:02
969000 -- (-1259.175) (-1255.279) (-1257.182) [-1256.359] * (-1254.767) (-1252.472) [-1257.526] (-1257.084) -- 0:00:01
969500 -- [-1254.628] (-1253.627) (-1253.575) (-1257.773) * [-1253.335] (-1252.541) (-1255.802) (-1252.684) -- 0:00:01
970000 -- (-1258.287) (-1253.027) (-1253.874) [-1253.458] * [-1254.504] (-1252.738) (-1255.923) (-1256.446) -- 0:00:01
Average standard deviation of split frequencies: 0.005569
970500 -- (-1253.637) [-1255.962] (-1256.671) (-1253.371) * (-1254.982) [-1256.767] (-1257.973) (-1254.549) -- 0:00:01
971000 -- (-1256.164) [-1254.537] (-1254.624) (-1253.316) * (-1254.149) (-1255.793) [-1253.340] (-1257.551) -- 0:00:01
971500 -- (-1253.758) (-1253.498) [-1256.996] (-1253.792) * [-1256.861] (-1253.285) (-1253.381) (-1254.650) -- 0:00:01
972000 -- (-1255.136) [-1252.665] (-1253.944) (-1253.999) * (-1253.934) [-1252.593] (-1256.274) (-1253.659) -- 0:00:01
972500 -- (-1256.078) (-1254.104) [-1253.351] (-1254.598) * [-1252.396] (-1257.068) (-1253.392) (-1254.119) -- 0:00:01
973000 -- [-1254.310] (-1256.076) (-1254.603) (-1252.791) * (-1254.124) [-1253.681] (-1253.429) (-1253.372) -- 0:00:01
973500 -- (-1255.554) [-1254.944] (-1253.686) (-1258.142) * (-1254.864) (-1255.559) (-1256.139) [-1252.946] -- 0:00:01
974000 -- (-1252.460) [-1253.025] (-1255.661) (-1255.237) * [-1254.521] (-1257.602) (-1255.569) (-1253.478) -- 0:00:01
974500 -- (-1256.687) [-1253.119] (-1261.079) (-1252.893) * (-1253.433) [-1252.951] (-1252.905) (-1254.309) -- 0:00:01
975000 -- [-1253.214] (-1252.905) (-1254.394) (-1256.550) * [-1255.491] (-1255.393) (-1252.955) (-1253.705) -- 0:00:01
Average standard deviation of split frequencies: 0.005603
975500 -- (-1252.973) [-1253.583] (-1253.451) (-1253.746) * [-1258.406] (-1252.508) (-1254.798) (-1254.638) -- 0:00:01
976000 -- (-1255.955) (-1256.792) (-1255.993) [-1253.796] * (-1257.088) (-1253.205) (-1259.827) [-1253.313] -- 0:00:01
976500 -- (-1256.881) [-1252.806] (-1252.541) (-1258.281) * (-1252.625) (-1255.374) (-1256.766) [-1255.929] -- 0:00:01
977000 -- (-1254.404) [-1255.649] (-1253.148) (-1255.446) * (-1254.931) (-1255.374) (-1255.768) [-1253.249] -- 0:00:01
977500 -- (-1257.181) [-1257.520] (-1254.015) (-1253.057) * (-1259.525) [-1252.755] (-1255.338) (-1254.581) -- 0:00:01
978000 -- [-1253.566] (-1254.988) (-1255.632) (-1255.065) * (-1260.153) (-1257.202) (-1259.605) [-1254.557] -- 0:00:01
978500 -- [-1254.007] (-1255.312) (-1252.942) (-1253.254) * (-1256.050) [-1254.712] (-1261.417) (-1254.723) -- 0:00:01
979000 -- (-1254.373) (-1253.426) (-1253.413) [-1254.822] * (-1256.002) (-1255.722) [-1254.909] (-1256.016) -- 0:00:01
979500 -- (-1255.626) (-1254.911) (-1252.523) [-1253.849] * (-1255.186) (-1255.912) (-1254.820) [-1253.781] -- 0:00:01
980000 -- (-1255.003) (-1254.631) [-1257.600] (-1255.071) * (-1255.135) [-1253.999] (-1256.707) (-1253.719) -- 0:00:01
Average standard deviation of split frequencies: 0.005768
980500 -- (-1259.341) (-1256.246) (-1254.280) [-1253.479] * (-1257.425) (-1253.368) (-1254.041) [-1253.438] -- 0:00:01
981000 -- (-1256.679) (-1256.701) [-1254.004] (-1253.429) * [-1257.281] (-1254.051) (-1256.420) (-1258.338) -- 0:00:01
981500 -- (-1256.469) [-1252.949] (-1253.981) (-1254.782) * (-1253.231) (-1255.568) [-1253.012] (-1255.856) -- 0:00:01
982000 -- [-1256.165] (-1252.958) (-1253.006) (-1255.861) * [-1252.920] (-1254.946) (-1255.467) (-1256.333) -- 0:00:01
982500 -- (-1253.873) (-1254.757) (-1253.014) [-1254.315] * (-1259.129) (-1253.115) (-1254.491) [-1253.889] -- 0:00:01
983000 -- (-1253.663) (-1259.204) [-1254.615] (-1256.929) * (-1254.782) [-1252.834] (-1256.369) (-1254.804) -- 0:00:01
983500 -- (-1255.914) (-1256.105) [-1252.813] (-1255.037) * (-1255.730) (-1253.810) [-1253.613] (-1253.375) -- 0:00:01
984000 -- (-1255.346) (-1255.044) [-1254.501] (-1254.780) * (-1256.110) (-1253.084) (-1253.878) [-1254.382] -- 0:00:01
984500 -- [-1255.621] (-1253.714) (-1252.932) (-1253.829) * (-1254.606) (-1255.540) [-1253.397] (-1255.353) -- 0:00:00
985000 -- (-1253.717) (-1252.536) [-1252.756] (-1257.037) * (-1253.003) (-1254.923) [-1254.536] (-1254.422) -- 0:00:00
Average standard deviation of split frequencies: 0.005833
985500 -- (-1253.804) [-1256.432] (-1254.270) (-1253.150) * [-1257.351] (-1253.112) (-1254.281) (-1257.919) -- 0:00:00
986000 -- (-1253.415) (-1252.818) [-1254.203] (-1254.192) * [-1254.555] (-1253.324) (-1253.513) (-1259.042) -- 0:00:00
986500 -- (-1254.802) (-1256.056) (-1255.256) [-1254.605] * (-1254.004) (-1253.659) [-1253.001] (-1256.614) -- 0:00:00
987000 -- (-1253.744) (-1254.464) [-1253.053] (-1253.760) * [-1253.457] (-1255.237) (-1254.136) (-1252.718) -- 0:00:00
987500 -- (-1254.524) (-1253.414) (-1254.186) [-1254.938] * (-1253.850) (-1253.831) [-1253.068] (-1252.537) -- 0:00:00
988000 -- [-1253.242] (-1254.167) (-1255.519) (-1254.770) * (-1254.451) (-1252.996) (-1257.411) [-1252.375] -- 0:00:00
988500 -- [-1253.241] (-1253.102) (-1256.644) (-1260.935) * (-1252.207) (-1254.842) [-1256.986] (-1253.435) -- 0:00:00
989000 -- [-1254.783] (-1256.248) (-1255.794) (-1254.862) * (-1253.623) (-1254.330) (-1256.004) [-1254.862] -- 0:00:00
989500 -- (-1252.571) (-1252.977) [-1256.300] (-1252.522) * (-1255.530) (-1256.581) (-1257.047) [-1257.775] -- 0:00:00
990000 -- (-1252.989) [-1252.424] (-1255.184) (-1255.036) * (-1254.040) (-1254.207) (-1255.576) [-1253.363] -- 0:00:00
Average standard deviation of split frequencies: 0.005488
990500 -- (-1254.641) (-1253.570) (-1252.850) [-1253.614] * (-1255.129) (-1255.584) (-1256.471) [-1252.944] -- 0:00:00
991000 -- (-1254.174) [-1258.421] (-1252.324) (-1257.639) * (-1252.414) [-1254.069] (-1253.773) (-1256.243) -- 0:00:00
991500 -- [-1253.386] (-1255.695) (-1261.136) (-1255.192) * (-1257.730) (-1256.541) [-1252.969] (-1257.296) -- 0:00:00
992000 -- (-1254.728) [-1254.884] (-1259.118) (-1254.552) * (-1253.435) (-1254.705) [-1256.033] (-1255.289) -- 0:00:00
992500 -- (-1254.890) [-1255.514] (-1258.037) (-1256.475) * (-1255.153) (-1255.420) (-1253.902) [-1253.873] -- 0:00:00
993000 -- (-1254.643) (-1254.558) (-1254.496) [-1256.770] * (-1254.201) [-1256.646] (-1254.385) (-1253.137) -- 0:00:00
993500 -- (-1252.202) (-1255.934) [-1254.163] (-1253.645) * (-1255.013) [-1254.086] (-1253.086) (-1254.463) -- 0:00:00
994000 -- (-1252.844) (-1257.409) (-1256.071) [-1254.252] * [-1253.767] (-1258.751) (-1253.423) (-1253.150) -- 0:00:00
994500 -- (-1255.084) (-1255.696) [-1254.022] (-1254.319) * (-1254.777) (-1253.282) (-1258.647) [-1252.612] -- 0:00:00
995000 -- (-1255.446) [-1252.621] (-1252.954) (-1253.347) * (-1255.294) [-1258.285] (-1253.832) (-1259.620) -- 0:00:00
Average standard deviation of split frequencies: 0.005553
995500 -- (-1253.821) (-1256.281) (-1253.704) [-1255.610] * (-1253.701) (-1252.831) (-1252.997) [-1256.302] -- 0:00:00
996000 -- [-1254.984] (-1253.040) (-1254.678) (-1253.492) * (-1252.293) (-1256.146) (-1254.257) [-1254.622] -- 0:00:00
996500 -- (-1256.814) (-1255.012) (-1253.453) [-1253.941] * [-1253.478] (-1255.985) (-1253.543) (-1257.709) -- 0:00:00
997000 -- (-1255.767) (-1252.191) [-1253.733] (-1256.310) * (-1254.420) (-1253.611) [-1252.756] (-1254.863) -- 0:00:00
997500 -- (-1253.255) [-1253.140] (-1254.204) (-1253.683) * (-1256.259) (-1256.334) (-1255.240) [-1254.436] -- 0:00:00
998000 -- (-1254.694) [-1253.713] (-1257.090) (-1254.959) * [-1253.683] (-1259.072) (-1259.161) (-1256.184) -- 0:00:00
998500 -- [-1254.900] (-1258.756) (-1254.056) (-1252.905) * (-1254.569) [-1254.204] (-1256.494) (-1253.723) -- 0:00:00
999000 -- (-1254.010) (-1254.366) (-1253.191) [-1252.943] * (-1258.045) (-1256.180) [-1255.910] (-1257.324) -- 0:00:00
999500 -- (-1254.178) [-1254.746] (-1255.610) (-1254.601) * [-1254.445] (-1258.146) (-1253.853) (-1255.688) -- 0:00:00
1000000 -- [-1255.341] (-1255.883) (-1256.858) (-1253.290) * (-1254.863) (-1256.114) [-1253.639] (-1258.244) -- 0:00:00
Average standard deviation of split frequencies: 0.005810
Analysis completed in 1 mins 4 seconds
Analysis used 62.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1252.14
Likelihood of best state for "cold" chain of run 2 was -1252.14
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
25.8 % ( 27 %) Dirichlet(Pi{all})
28.3 % ( 29 %) Slider(Pi{all})
78.4 % ( 57 %) Multiplier(Alpha{1,2})
78.0 % ( 50 %) Multiplier(Alpha{3})
17.2 % ( 17 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.3 % ( 21 %) Dirichlet(Pi{all})
27.9 % ( 18 %) Slider(Pi{all})
78.9 % ( 60 %) Multiplier(Alpha{1,2})
77.7 % ( 63 %) Multiplier(Alpha{3})
18.3 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166667 0.82 0.67
3 | 167337 167189 0.84
4 | 166500 166332 165975
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166692 0.82 0.67
3 | 166183 166906 0.84
4 | 166983 166415 166821
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1253.79
| 1 |
| 2 11 |
| 1 2 2 |
| 2 2 1 2 2 1 2 * 2 |
| 212 1 2 * 2 2 1 2* 1 2* |
|1 21 * 12 112 111 2 *1 1 1 21 * 2 2 * *|
| 1 2 1 1 1 2 1 1 * 1 1 2 |
| 21 2 2 2 1 1 222 2 1 11 2 1 1 |
|2 2 21 2 1 1 1 |
| 1 22 2 2 2 2 2 |
| 2 1 2 2 |
| 1 1 1 |
| 21 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1255.72
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1253.85 -1256.81
2 -1253.83 -1256.94
--------------------------------------
TOTAL -1253.84 -1256.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898705 0.085387 0.385365 1.480998 0.872931 1303.00 1402.00 1.000
r(A<->C){all} 0.167710 0.021247 0.000029 0.463662 0.123782 160.64 162.51 1.007
r(A<->G){all} 0.149962 0.017290 0.000001 0.424789 0.109323 135.96 199.17 1.001
r(A<->T){all} 0.181012 0.021967 0.000045 0.489565 0.142195 222.82 251.61 1.000
r(C<->G){all} 0.164556 0.018998 0.000024 0.443148 0.126614 128.07 235.10 1.007
r(C<->T){all} 0.164036 0.020033 0.000051 0.452767 0.123293 195.81 215.43 1.007
r(G<->T){all} 0.172724 0.018734 0.000122 0.450881 0.141874 258.75 301.55 1.014
pi(A){all} 0.165584 0.000144 0.142613 0.189158 0.165218 1271.87 1348.10 1.000
pi(C){all} 0.308444 0.000223 0.279491 0.337897 0.308233 1114.76 1133.76 1.000
pi(G){all} 0.336457 0.000243 0.303549 0.365017 0.336027 1183.27 1269.66 1.000
pi(T){all} 0.189516 0.000161 0.162321 0.212206 0.189553 1328.78 1329.63 1.000
alpha{1,2} 0.426122 0.234215 0.000153 1.381222 0.259450 1184.70 1342.85 1.000
alpha{3} 0.477306 0.271584 0.000358 1.539124 0.294914 1135.83 1193.03 1.000
pinvar{all} 0.998422 0.000004 0.994843 0.999998 0.999023 1014.41 1257.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ..****
9 -- ...**.
10 -- ..**..
11 -- ....**
12 -- .*.*..
13 -- .***.*
14 -- .****.
15 -- ..*..*
16 -- ...*.*
17 -- .*...*
18 -- .*..*.
19 -- ..*.*.
20 -- .**...
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.004711 0.149900 0.156562 2
8 459 0.152898 0.004240 0.149900 0.155896 2
9 455 0.151566 0.003298 0.149234 0.153897 2
10 449 0.149567 0.008009 0.143904 0.155230 2
11 443 0.147568 0.001413 0.146569 0.148568 2
12 441 0.146902 0.000471 0.146569 0.147235 2
13 433 0.144237 0.009893 0.137242 0.151233 2
14 430 0.143238 0.005653 0.139241 0.147235 2
15 418 0.139241 0.008480 0.133245 0.145237 2
16 418 0.139241 0.001884 0.137908 0.140573 2
17 415 0.138241 0.011777 0.129913 0.146569 2
18 413 0.137575 0.003298 0.135243 0.139907 2
19 412 0.137242 0.000942 0.136576 0.137908 2
20 391 0.130247 0.005182 0.126582 0.133911 2
21 366 0.121919 0.017901 0.109260 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rmlD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098155 0.009433 0.000032 0.299000 0.067850 1.000 2
length{all}[2] 0.100969 0.009610 0.000070 0.300177 0.070790 1.000 2
length{all}[3] 0.100071 0.009775 0.000130 0.292049 0.069000 1.000 2
length{all}[4] 0.098901 0.009774 0.000054 0.295505 0.068470 1.000 2
length{all}[5] 0.100066 0.009180 0.000013 0.295725 0.071523 1.000 2
length{all}[6] 0.102938 0.010561 0.000020 0.303366 0.072015 1.000 2
length{all}[7] 0.104369 0.011921 0.000436 0.296940 0.074958 0.999 2
length{all}[8] 0.095833 0.009512 0.000142 0.299961 0.065268 1.006 2
length{all}[9] 0.106402 0.010149 0.000296 0.315615 0.074013 1.001 2
length{all}[10] 0.098779 0.010043 0.000406 0.303208 0.073104 1.000 2
length{all}[11] 0.099013 0.009644 0.000365 0.280293 0.064097 0.998 2
length{all}[12] 0.102901 0.010831 0.000091 0.306817 0.069833 1.009 2
length{all}[13] 0.089495 0.008439 0.000233 0.289126 0.058686 0.998 2
length{all}[14] 0.102871 0.011749 0.000088 0.311804 0.071466 0.998 2
length{all}[15] 0.091643 0.008793 0.000090 0.271908 0.060433 0.998 2
length{all}[16] 0.089054 0.007957 0.000240 0.257676 0.060703 0.998 2
length{all}[17] 0.100461 0.011350 0.000115 0.288905 0.066067 1.000 2
length{all}[18] 0.103572 0.011361 0.000151 0.326258 0.070986 0.998 2
length{all}[19] 0.100749 0.009289 0.000021 0.296716 0.073284 0.999 2
length{all}[20] 0.104853 0.008821 0.000665 0.280165 0.079930 0.998 2
length{all}[21] 0.095378 0.008805 0.000294 0.277604 0.065581 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005810
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 933
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 311 / 311 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 311 / 311 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053715 0.083097 0.061428 0.076302 0.095777 0.035207 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1340.010088
Iterating by ming2
Initial: fx= 1340.010088
x= 0.05372 0.08310 0.06143 0.07630 0.09578 0.03521 0.30000 1.30000
1 h-m-p 0.0000 0.0001 743.8864 ++ 1276.058049 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0034 89.1762 ++ 1274.665385 m 0.0034 24 | 2/8
3 h-m-p 0.0000 0.0001 1041.5274 ++ 1269.252541 m 0.0001 35 | 3/8
4 h-m-p 0.0001 0.0023 598.8052 +++ 1243.346786 m 0.0023 47 | 4/8
5 h-m-p 0.0000 0.0002 161.0977 ++ 1239.743330 m 0.0002 58 | 5/8
6 h-m-p 0.0000 0.0001 349.8868 ++ 1231.047394 m 0.0001 69 | 6/8
7 h-m-p 0.0160 8.0000 2.5740 -------------.. | 6/8
8 h-m-p 0.0000 0.0000 424.2649 ++ 1226.602669 m 0.0000 102 | 7/8
9 h-m-p 0.0160 8.0000 0.9253 -------------.. | 7/8
10 h-m-p 0.0000 0.0001 296.7243 ++ 1216.092423 m 0.0001 136 | 8/8
11 h-m-p 0.0160 8.0000 0.0000 N 1216.092423 0 0.0160 147 | 8/8
12 h-m-p 0.0160 8.0000 0.0000 N 1216.092423 0 0.0160 158
Out..
lnL = -1216.092423
159 lfun, 159 eigenQcodon, 954 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032188 0.087628 0.021136 0.071917 0.048999 0.103300 0.000100 0.674612 0.464842
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.007474
np = 9
lnL0 = -1325.805361
Iterating by ming2
Initial: fx= 1325.805361
x= 0.03219 0.08763 0.02114 0.07192 0.04900 0.10330 0.00011 0.67461 0.46484
1 h-m-p 0.0000 0.0000 722.4499 ++ 1324.475515 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 399.8072 +++ 1287.393155 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0001 290.4492 ++ 1275.079823 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0012 249.9983 ++ 1216.131123 m 0.0012 51 | 4/9
5 h-m-p 0.0000 0.0000 483.1418 ++ 1216.114481 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 165.2063 ++ 1216.109849 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0034 35.6702 --------.. | 6/9
8 h-m-p 0.0000 0.0000 307.6148 ++ 1216.092416 m 0.0000 105 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 +Y 1216.092416 0 0.0640 118 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1216.092416 m 8.0000 163 | 7/9
12 h-m-p 0.0054 2.6978 0.3988 +++++ 1216.092412 m 2.6978 180 | 8/9
13 h-m-p 1.6000 8.0000 0.0002 Y 1216.092412 0 0.4000 194 | 8/9
14 h-m-p 0.0001 0.0677 2.7113 Y 1216.092412 0 0.0000 207 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 Y 1216.092412 0 1.6000 219 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 N 1216.092412 0 0.0160 232
Out..
lnL = -1216.092412
233 lfun, 699 eigenQcodon, 2796 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.066990 0.076217 0.023970 0.094440 0.094556 0.014129 0.000100 0.995390 0.289700 0.390514 2.380691
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.432199
np = 11
lnL0 = -1321.602139
Iterating by ming2
Initial: fx= 1321.602139
x= 0.06699 0.07622 0.02397 0.09444 0.09456 0.01413 0.00011 0.99539 0.28970 0.39051 2.38069
1 h-m-p 0.0000 0.0000 653.5864 ++ 1320.741870 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 233.4180 +++ 1293.706785 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0001 243.7564 ++ 1282.018422 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0025 120.2439 ++ 1243.293909 m 0.0025 59 | 4/11
5 h-m-p 0.0007 0.0035 48.8274 ++ 1237.898108 m 0.0035 73 | 5/11
6 h-m-p 0.0000 0.0000 606.7600 ++ 1237.354578 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0020 113.9419 +++ 1234.652078 m 0.0020 102 | 7/11
8 h-m-p 0.0010 0.0093 234.5388 ++ 1230.849444 m 0.0093 116 | 7/11
9 h-m-p -0.0000 -0.0000 12.5582
h-m-p: -4.57383577e-18 -2.28691789e-17 1.25582166e+01 1230.849444
.. | 7/11
10 h-m-p 0.0000 0.0002 300.0761 +++ 1216.092413 m 0.0002 142 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 1216.092413 m 8.0000 156 | 8/11
12 h-m-p 0.2906 8.0000 0.0000 +++ 1216.092413 m 8.0000 174 | 8/11
13 h-m-p 0.0001 0.0007 0.3634 ----Y 1216.092413 0 0.0000 195 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.092413 m 8.0000 215 | 8/11
15 h-m-p 0.0160 8.0000 0.1661 +++++ 1216.092411 m 8.0000 235 | 8/11
16 h-m-p 0.0134 0.0672 19.7935 ---------C 1216.092411 0 0.0000 261 | 8/11
17 h-m-p 0.4098 8.0000 0.0000 ----C 1216.092411 0 0.0004 279 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 N 1216.092411 0 0.0040 296
Out..
lnL = -1216.092411
297 lfun, 1188 eigenQcodon, 5346 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1216.099645 S = -1216.087175 -0.004773
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:02
did 20 / 57 patterns 0:02
did 30 / 57 patterns 0:03
did 40 / 57 patterns 0:03
did 50 / 57 patterns 0:03
did 57 / 57 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105483 0.054093 0.068494 0.046577 0.028490 0.103024 0.000100 0.986676 1.932306
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.731318
np = 9
lnL0 = -1336.069207
Iterating by ming2
Initial: fx= 1336.069207
x= 0.10548 0.05409 0.06849 0.04658 0.02849 0.10302 0.00011 0.98668 1.93231
1 h-m-p 0.0000 0.0000 698.3018 ++ 1335.298399 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0178 55.3393 +++++ 1310.164726 m 0.0178 29 | 2/9
3 h-m-p 0.0000 0.0001 1976.3307 ++ 1243.221348 m 0.0001 41 | 3/9
4 h-m-p 0.0005 0.0023 84.3458 ++ 1237.317885 m 0.0023 53 | 4/9
5 h-m-p 0.0000 0.0001 356.5079 ++ 1230.773320 m 0.0001 65 | 5/9
6 h-m-p 0.0001 0.0010 348.0209 ++ 1228.112796 m 0.0010 77 | 6/9
7 h-m-p 0.0000 0.0002 68.1396 ++ 1221.378095 m 0.0002 89 | 7/9
8 h-m-p 0.0160 8.0000 1.0198 -------------.. | 7/9
9 h-m-p 0.0000 0.0001 302.3308 ++ 1216.092423 m 0.0001 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 -Y 1216.092423 0 0.1000 137 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 1216.092423 0 1.6000 150
Out..
lnL = -1216.092423
151 lfun, 1661 eigenQcodon, 9060 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.054341 0.068435 0.040253 0.034177 0.068929 0.062224 0.000100 0.900000 1.030109 1.825311 2.386483
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.917152
np = 11
lnL0 = -1308.602920
Iterating by ming2
Initial: fx= 1308.602920
x= 0.05434 0.06843 0.04025 0.03418 0.06893 0.06222 0.00011 0.90000 1.03011 1.82531 2.38648
1 h-m-p 0.0000 0.0000 640.5259 ++ 1307.753503 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 616.0050 +++ 1251.910525 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 29416.5152 ++ 1243.270986 m 0.0000 45 | 3/11
4 h-m-p 0.0010 0.0607 25.7895 ++
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
+ 1225.016894 m 0.0607 60
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.149412e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110639e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33126) = 1.110640e-160 2000 rounds
| 4/11
5 h-m-p 0.0000 0.0001 500.4918
QuantileBeta(0.15, 0.00500, 2.33577) = 1.107976e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.34930) = 1.100060e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
+ 1224.183480 m 0.0001 74
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.135758e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097446e-160 2000 rounds
| 5/11
6 h-m-p 0.0000 0.0000 689825.0407
QuantileBeta(0.15, 0.00500, 2.34054) = 1.105170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30074) = 1.128999e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+ 1219.353927 m 0.0000 88
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 6/11
7 h-m-p 0.0009 0.0045 176.3445
QuantileBeta(0.15, 0.00500, 2.35446) = 1.097071e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30422) = 1.126876e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29166) = 1.134579e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28852) = 1.136521e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28774) = 1.137008e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28754) = 1.137129e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28749) = 1.137160e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137167e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137169e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 6/11
8 h-m-p 0.0000 0.0000 430.4345
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+ 1218.945350 m 0.0000 125
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 7/11
9 h-m-p 0.0001 0.0618 8.5695
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 7/11
10 h-m-p 0.0000 0.0000 304.0955
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+ 1216.092410 m 0.0000 161
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28748) = 1.137169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 8/11
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
Y 1216.092410 0 6.4000 176
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.176868e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28760) = 1.137093e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28735) = 1.137247e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
| 8/11
12 h-m-p 0.5326 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
C 1216.092410 0 0.0021 196
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
Out..
lnL = -1216.092410
197 lfun, 2364 eigenQcodon, 13002 P(t)
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1216.097460 S = -1216.086477 -0.004819
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:09
did 20 / 57 patterns 0:09
did 30 / 57 patterns 0:09
did 40 / 57 patterns 0:09
did 50 / 57 patterns 0:10
did 57 / 57 patterns 0:10
QuantileBeta(0.15, 0.00500, 2.28747) = 1.137170e-160 2000 rounds
Time used: 0:10
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/11res/rmlD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 311
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 6 6 6 6 6 6 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 3 3 3 3 3 3 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 6 6 6 6 6 6 | CCA 0 0 0 0 0 0 | Gln CAA 5 5 5 5 5 5 | CGA 4 4 4 4 4 4
CTG 7 7 7 7 7 7 | CCG 12 12 12 12 12 12 | CAG 6 6 6 6 6 6 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 4 4 4 4 4 4 | Ser AGT 2 2 2 2 2 2
ATC 2 2 2 2 2 2 | ACC 13 13 13 13 13 13 | AAC 4 4 4 4 4 4 | AGC 7 7 7 7 7 7
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 1 1 1 1 1 1 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 13 13 13 13 13 13 | Asp GAT 10 10 10 10 10 10 | Gly GGT 6 6 6 6 6 6
GTC 14 14 14 14 14 14 | GCC 23 23 23 23 23 23 | GAC 8 8 8 8 8 8 | GGC 15 15 15 15 15 15
GTA 3 3 3 3 3 3 | GCA 4 4 4 4 4 4 | Glu GAA 5 5 5 5 5 5 | GGA 1 1 1 1 1 1
GTG 13 13 13 13 13 13 | GCG 14 14 14 14 14 14 | GAG 8 8 8 8 8 8 | GGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907905_1_786_MLBR_RS03705
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
#2: NC_002677_1_NP_301581_1_453_rmlD
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
#3: NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
#4: NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
#5: NZ_CP029543_1_WP_010907905_1_807_rfbD
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
#6: NZ_AP014567_1_WP_010907905_1_818_rfbD
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 18 | Tyr Y TAT 36 | Cys C TGT 6
TTC 30 | TCC 18 | TAC 24 | TGC 18
Leu L TTA 12 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 36 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 24
CTC 18 | CCC 24 | CAC 12 | CGC 36
CTA 36 | CCA 0 | Gln Q CAA 30 | CGA 24
CTG 42 | CCG 72 | CAG 36 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 24 | Ser S AGT 12
ATC 12 | ACC 78 | AAC 24 | AGC 42
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 6
Met M ATG 18 | ACG 18 | AAG 6 | AGG 18
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 78 | Asp D GAT 60 | Gly G GGT 36
GTC 84 | GCC 138 | GAC 48 | GGC 90
GTA 18 | GCA 24 | Glu E GAA 30 | GGA 6
GTG 78 | GCG 84 | GAG 48 | GGG 48
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13505 C:0.22186 A:0.16077 G:0.48232
position 2: T:0.23151 C:0.33119 A:0.21543 G:0.22186
position 3: T:0.20257 C:0.37299 A:0.11897 G:0.30547
Average T:0.18971 C:0.30868 A:0.16506 G:0.33655
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1216.092423 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907905_1_786_MLBR_RS03705: 0.000004, NC_002677_1_NP_301581_1_453_rmlD: 0.000004, NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855: 0.000004, NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800: 0.000004, NZ_CP029543_1_WP_010907905_1_807_rfbD: 0.000004, NZ_AP014567_1_WP_010907905_1_818_rfbD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 681.6 251.4 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1216.092412 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.816579
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907905_1_786_MLBR_RS03705: 0.000004, NC_002677_1_NP_301581_1_453_rmlD: 0.000004, NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855: 0.000004, NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800: 0.000004, NZ_CP029543_1_WP_010907905_1_807_rfbD: 0.000004, NZ_AP014567_1_WP_010907905_1_818_rfbD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.81658 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 681.6 251.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1216.092411 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.232460 0.498137 0.000001 2.143568
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907905_1_786_MLBR_RS03705: 0.000004, NC_002677_1_NP_301581_1_453_rmlD: 0.000004, NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855: 0.000004, NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800: 0.000004, NZ_CP029543_1_WP_010907905_1_807_rfbD: 0.000004, NZ_AP014567_1_WP_010907905_1_818_rfbD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.23246 0.49814 0.26940
w: 0.00000 1.00000 2.14357
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
7..2 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
7..3 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
7..4 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
7..5 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
7..6 0.000 681.6 251.4 1.0756 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907905_1_786_MLBR_RS03705)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907905_1_786_MLBR_RS03705)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1216.092423 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.045930
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907905_1_786_MLBR_RS03705: 0.000004, NC_002677_1_NP_301581_1_453_rmlD: 0.000004, NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855: 0.000004, NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800: 0.000004, NZ_CP029543_1_WP_010907905_1_807_rfbD: 0.000004, NZ_AP014567_1_WP_010907905_1_818_rfbD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.04593
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 681.6 251.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1216.092410 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.471361 0.005000 2.287474 3.355097
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907905_1_786_MLBR_RS03705: 0.000004, NC_002677_1_NP_301581_1_453_rmlD: 0.000004, NZ_LVXE01000001_1_WP_010907905_1_171_A3216_RS00855: 0.000004, NZ_LYPH01000001_1_WP_010907905_1_160_A8144_RS00800: 0.000004, NZ_CP029543_1_WP_010907905_1_807_rfbD: 0.000004, NZ_AP014567_1_WP_010907905_1_818_rfbD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.47136 p = 0.00500 q = 2.28747
(p1 = 0.52864) w = 3.35510
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04714 0.04714 0.04714 0.04714 0.04714 0.04714 0.04714 0.04714 0.04714 0.04714 0.52864
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.35510
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
7..2 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
7..3 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
7..4 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
7..5 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
7..6 0.000 681.6 251.4 1.7736 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907905_1_786_MLBR_RS03705)
Pr(w>1) post mean +- SE for w
1 V 0.529 1.774
2 S 0.529 1.774
3 D 0.529 1.774
4 R 0.529 1.774
5 S 0.529 1.774
6 G 0.529 1.774
7 R 0.529 1.774
8 L 0.529 1.774
9 V 0.529 1.774
10 I 0.529 1.774
11 T 0.529 1.774
12 G 0.529 1.774
13 A 0.529 1.774
14 G 0.529 1.774
15 G 0.529 1.774
16 Q 0.529 1.774
17 L 0.529 1.774
18 G 0.529 1.774
19 S 0.529 1.774
20 A 0.529 1.774
21 L 0.529 1.774
22 A 0.529 1.774
23 A 0.529 1.774
24 Q 0.529 1.774
25 A 0.529 1.774
26 T 0.529 1.774
27 A 0.529 1.774
28 A 0.529 1.774
29 G 0.529 1.774
30 R 0.529 1.774
31 D 0.529 1.774
32 V 0.529 1.774
33 L 0.529 1.774
34 A 0.529 1.774
35 L 0.529 1.774
36 T 0.529 1.774
37 S 0.529 1.774
38 S 0.529 1.774
39 Q 0.529 1.774
40 W 0.529 1.774
41 D 0.529 1.774
42 I 0.529 1.774
43 T 0.529 1.774
44 D 0.529 1.774
45 A 0.529 1.774
46 A 0.529 1.774
47 V 0.529 1.774
48 A 0.529 1.774
49 E 0.529 1.774
50 R 0.529 1.774
51 M 0.529 1.774
52 G 0.529 1.774
53 R 0.529 1.774
54 S 0.529 1.774
55 A 0.529 1.774
56 L 0.529 1.774
57 K 0.529 1.774
58 K 0.529 1.774
59 N 0.529 1.774
60 D 0.529 1.774
61 V 0.529 1.774
62 V 0.529 1.774
63 V 0.529 1.774
64 N 0.529 1.774
65 C 0.529 1.774
66 A 0.529 1.774
67 A 0.529 1.774
68 Y 0.529 1.774
69 T 0.529 1.774
70 N 0.529 1.774
71 V 0.529 1.774
72 D 0.529 1.774
73 G 0.529 1.774
74 A 0.529 1.774
75 E 0.529 1.774
76 S 0.529 1.774
77 N 0.529 1.774
78 E 0.529 1.774
79 L 0.529 1.774
80 A 0.529 1.774
81 A 0.529 1.774
82 Y 0.529 1.774
83 A 0.529 1.774
84 V 0.529 1.774
85 N 0.529 1.774
86 A 0.529 1.774
87 T 0.529 1.774
88 G 0.529 1.774
89 P 0.529 1.774
90 E 0.529 1.774
91 Y 0.529 1.774
92 I 0.529 1.774
93 A 0.529 1.774
94 R 0.529 1.774
95 A 0.529 1.774
96 C 0.529 1.774
97 R 0.529 1.774
98 C 0.529 1.774
99 A 0.529 1.774
100 G 0.529 1.774
101 A 0.529 1.774
102 A 0.529 1.774
103 L 0.529 1.774
104 I 0.529 1.774
105 H 0.529 1.774
106 V 0.529 1.774
107 S 0.529 1.774
108 T 0.529 1.774
109 D 0.529 1.774
110 Y 0.529 1.774
111 V 0.529 1.774
112 F 0.529 1.774
113 S 0.529 1.774
114 G 0.529 1.774
115 D 0.529 1.774
116 F 0.529 1.774
117 G 0.529 1.774
118 S 0.529 1.774
119 G 0.529 1.774
120 A 0.529 1.774
121 N 0.529 1.774
122 R 0.529 1.774
123 V 0.529 1.774
124 A 0.529 1.774
125 P 0.529 1.774
126 R 0.529 1.774
127 P 0.529 1.774
128 Y 0.529 1.774
129 E 0.529 1.774
130 P 0.529 1.774
131 T 0.529 1.774
132 D 0.529 1.774
133 E 0.529 1.774
134 T 0.529 1.774
135 G 0.529 1.774
136 P 0.529 1.774
137 L 0.529 1.774
138 G 0.529 1.774
139 V 0.529 1.774
140 Y 0.529 1.774
141 G 0.529 1.774
142 R 0.529 1.774
143 S 0.529 1.774
144 K 0.529 1.774
145 L 0.529 1.774
146 A 0.529 1.774
147 G 0.529 1.774
148 E 0.529 1.774
149 Q 0.529 1.774
150 A 0.529 1.774
151 V 0.529 1.774
152 L 0.529 1.774
153 A 0.529 1.774
154 A 0.529 1.774
155 M 0.529 1.774
156 P 0.529 1.774
157 E 0.529 1.774
158 A 0.529 1.774
159 T 0.529 1.774
160 V 0.529 1.774
161 V 0.529 1.774
162 R 0.529 1.774
163 T 0.529 1.774
164 A 0.529 1.774
165 W 0.529 1.774
166 V 0.529 1.774
167 Y 0.529 1.774
168 T 0.529 1.774
169 G 0.529 1.774
170 G 0.529 1.774
171 T 0.529 1.774
172 G 0.529 1.774
173 K 0.529 1.774
174 D 0.529 1.774
175 F 0.529 1.774
176 V 0.529 1.774
177 A 0.529 1.774
178 V 0.529 1.774
179 M 0.529 1.774
180 R 0.529 1.774
181 R 0.529 1.774
182 L 0.529 1.774
183 A 0.529 1.774
184 A 0.529 1.774
185 G 0.529 1.774
186 D 0.529 1.774
187 G 0.529 1.774
188 P 0.529 1.774
189 V 0.529 1.774
190 Y 0.529 1.774
191 V 0.529 1.774
192 V 0.529 1.774
193 D 0.529 1.774
194 D 0.529 1.774
195 Q 0.529 1.774
196 I 0.529 1.774
197 G 0.529 1.774
198 S 0.529 1.774
199 P 0.529 1.774
200 T 0.529 1.774
201 Y 0.529 1.774
202 V 0.529 1.774
203 V 0.529 1.774
204 D 0.529 1.774
205 L 0.529 1.774
206 A 0.529 1.774
207 A 0.529 1.774
208 A 0.529 1.774
209 L 0.529 1.774
210 L 0.529 1.774
211 Q 0.529 1.774
212 V 0.529 1.774
213 A 0.529 1.774
214 D 0.529 1.774
215 G 0.529 1.774
216 S 0.529 1.774
217 V 0.529 1.774
218 H 0.529 1.774
219 G 0.529 1.774
220 S 0.529 1.774
221 V 0.529 1.774
222 L 0.529 1.774
223 H 0.529 1.774
224 A 0.529 1.774
225 A 0.529 1.774
226 N 0.529 1.774
227 E 0.529 1.774
228 G 0.529 1.774
229 E 0.529 1.774
230 V 0.529 1.774
231 S 0.529 1.774
232 R 0.529 1.774
233 F 0.529 1.774
234 G 0.529 1.774
235 Q 0.529 1.774
236 A 0.529 1.774
237 R 0.529 1.774
238 A 0.529 1.774
239 V 0.529 1.774
240 F 0.529 1.774
241 E 0.529 1.774
242 E 0.529 1.774
243 C 0.529 1.774
244 G 0.529 1.774
245 A 0.529 1.774
246 D 0.529 1.774
247 P 0.529 1.774
248 L 0.529 1.774
249 Q 0.529 1.774
250 V 0.529 1.774
251 Q 0.529 1.774
252 P 0.529 1.774
253 V 0.529 1.774
254 S 0.529 1.774
255 T 0.529 1.774
256 A 0.529 1.774
257 Q 0.529 1.774
258 N 0.529 1.774
259 P 0.529 1.774
260 R 0.529 1.774
261 S 0.529 1.774
262 A 0.529 1.774
263 A 0.529 1.774
264 R 0.529 1.774
265 P 0.529 1.774
266 A 0.529 1.774
267 Y 0.529 1.774
268 S 0.529 1.774
269 A 0.529 1.774
270 L 0.529 1.774
271 S 0.529 1.774
272 G 0.529 1.774
273 R 0.529 1.774
274 Q 0.529 1.774
275 S 0.529 1.774
276 V 0.529 1.774
277 A 0.529 1.774
278 A 0.529 1.774
279 G 0.529 1.774
280 L 0.529 1.774
281 T 0.529 1.774
282 P 0.529 1.774
283 L 0.529 1.774
284 R 0.529 1.774
285 P 0.529 1.774
286 W 0.529 1.774
287 R 0.529 1.774
288 S 0.529 1.774
289 A 0.529 1.774
290 L 0.529 1.774
291 V 0.529 1.774
292 E 0.529 1.774
293 A 0.529 1.774
294 L 0.529 1.774
295 A 0.529 1.774
296 V 0.529 1.774
297 S 0.529 1.774
298 R 0.529 1.774
299 S 0.529 1.774
300 L 0.529 1.774
301 P 0.529 1.774
302 V 0.529 1.774
303 D 0.529 1.774
304 R 0.529 1.774
305 P 0.529 1.774
306 L 0.529 1.774
307 P 0.529 1.774
308 S 0.529 1.774
309 T 0.529 1.774
310 R 0.529 1.774
311 D 0.529 1.774
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907905_1_786_MLBR_RS03705)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:10