--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:29:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -959.81          -962.95
2       -959.79          -962.80
--------------------------------------
TOTAL     -959.80          -962.88
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.886814    0.089835    0.372569    1.484912    0.850404   1311.18   1365.28    1.000
r(A<->C){all}   0.181000    0.023197    0.000059    0.490739    0.140454     91.91    143.18    1.006
r(A<->G){all}   0.171381    0.021104    0.000007    0.469425    0.132701    239.03    281.60    1.000
r(A<->T){all}   0.162604    0.018610    0.000091    0.435354    0.130305    125.70    163.28    1.005
r(C<->G){all}   0.168126    0.019947    0.000125    0.441893    0.129410    150.08    203.51    1.003
r(C<->T){all}   0.159770    0.019525    0.000012    0.443707    0.121128    132.20    218.94    1.000
r(G<->T){all}   0.157119    0.018060    0.000020    0.433644    0.120413    201.77    250.20    1.000
pi(A){all}      0.209931    0.000251    0.180279    0.242889    0.209687   1219.39   1330.38    1.000
pi(C){all}      0.280739    0.000294    0.246438    0.313759    0.280382   1268.20   1299.27    1.000
pi(G){all}      0.328884    0.000317    0.294117    0.362896    0.328518   1315.56   1408.28    1.000
pi(T){all}      0.180446    0.000203    0.153787    0.209039    0.180230   1080.18   1204.76    1.000
alpha{1,2}      0.419369    0.225127    0.000181    1.398486    0.250816   1026.29   1176.67    1.000
alpha{3}        0.449830    0.223991    0.000326    1.413658    0.289434    959.55   1171.41    1.001
pinvar{all}     0.997804    0.000007    0.992774    0.999999    0.998625   1304.50   1305.57    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-906.153463
Model 2: PositiveSelection	-906.153435
Model 0: one-ratio	-906.153467
Model 7: beta	-906.153482
Model 8: beta&w>1	-906.153435


Model 0 vs 1	7.999999979801942E-6

Model 2 vs 1	5.600000008598727E-5

Model 8 vs 7	9.400000021742017E-5
>C1
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C2
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C3
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C4
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C5
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C6
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=235 

C1              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C2              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C3              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C4              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C5              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C6              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
                **************************************************

C1              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C2              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C3              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C4              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C5              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C6              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
                **************************************************

C1              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C2              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C3              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C4              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C5              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C6              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
                **************************************************

C1              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C2              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C3              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C4              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C5              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C6              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
                **************************************************

C1              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C2              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C3              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C4              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C5              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C6              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
                ***********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  235 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  235 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7050]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7050]--->[7050]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.775 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C2              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C3              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C4              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C5              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C6              MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
                **************************************************

C1              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C2              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C3              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C4              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C5              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C6              DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
                **************************************************

C1              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C2              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C3              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C4              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C5              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C6              IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
                **************************************************

C1              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C2              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C3              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C4              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C5              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C6              KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
                **************************************************

C1              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C2              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C3              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C4              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C5              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C6              PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
                ***********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C2              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C3              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C4              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C5              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C6              ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
                **************************************************

C1              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C2              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C3              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C4              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C5              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C6              CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
                **************************************************

C1              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C2              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C3              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C4              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C5              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C6              CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
                **************************************************

C1              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C2              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C3              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C4              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C5              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C6              GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
                **************************************************

C1              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C2              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C3              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C4              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C5              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C6              CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
                **************************************************

C1              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C2              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C3              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C4              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C5              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C6              CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
                **************************************************

C1              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C2              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C3              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C4              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C5              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C6              ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
                **************************************************

C1              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C2              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C3              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C4              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C5              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C6              ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
                **************************************************

C1              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C2              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C3              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C4              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C5              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C6              GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
                **************************************************

C1              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C2              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C3              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C4              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C5              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C6              AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
                **************************************************

C1              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C2              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C3              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C4              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C5              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C6              ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
                **************************************************

C1              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C2              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C3              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C4              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C5              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C6              GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
                **************************************************

C1              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C2              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C3              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C4              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C5              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C6              CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
                **************************************************

C1              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C2              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C3              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C4              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C5              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C6              TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
                **************************************************

C1              AGGAG
C2              AGGAG
C3              AGGAG
C4              AGGAG
C5              AGGAG
C6              AGGAG
                *****



>C1
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C2
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C3
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C4
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C5
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C6
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C1
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C2
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C3
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C4
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C5
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C6
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 705 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789719
      Setting output file names to "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1188441707
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0360240304
      Seed = 269564717
      Swapseed = 1579789719
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1577.823798 -- -24.965149
         Chain 2 -- -1577.823558 -- -24.965149
         Chain 3 -- -1577.823707 -- -24.965149
         Chain 4 -- -1577.823798 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1577.823558 -- -24.965149
         Chain 2 -- -1577.823798 -- -24.965149
         Chain 3 -- -1577.823707 -- -24.965149
         Chain 4 -- -1577.823707 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1577.824] (-1577.824) (-1577.824) (-1577.824) * [-1577.824] (-1577.824) (-1577.824) (-1577.824) 
        500 -- (-979.713) (-984.628) [-971.818] (-977.940) * (-977.700) [-966.473] (-983.235) (-968.185) -- 0:00:00
       1000 -- [-967.512] (-974.609) (-975.676) (-978.303) * (-966.423) (-970.736) (-971.631) [-969.759] -- 0:00:00
       1500 -- [-967.280] (-972.356) (-974.503) (-983.543) * (-970.827) (-965.063) [-969.182] (-973.826) -- 0:00:00
       2000 -- (-965.798) [-964.533] (-973.489) (-967.025) * (-971.145) (-969.722) (-967.342) [-966.570] -- 0:08:19
       2500 -- (-970.164) (-969.569) [-961.716] (-966.345) * (-969.435) (-976.029) [-966.093] (-971.399) -- 0:06:39
       3000 -- (-964.854) (-963.132) [-968.972] (-975.453) * (-970.401) (-969.874) [-963.556] (-976.648) -- 0:05:32
       3500 -- (-974.072) (-982.987) [-967.001] (-970.160) * (-968.301) [-966.984] (-970.143) (-972.781) -- 0:04:44
       4000 -- (-971.990) (-970.139) [-965.299] (-967.543) * (-974.422) [-974.281] (-969.892) (-963.547) -- 0:04:09
       4500 -- (-971.027) [-976.668] (-976.224) (-963.944) * (-972.245) [-974.787] (-973.436) (-974.537) -- 0:03:41
       5000 -- [-970.886] (-977.721) (-970.837) (-964.925) * (-973.712) (-975.970) (-967.282) [-969.682] -- 0:03:19

      Average standard deviation of split frequencies: 0.117851

       5500 -- (-972.167) [-966.269] (-964.812) (-972.280) * [-974.219] (-970.551) (-974.656) (-970.649) -- 0:03:00
       6000 -- (-970.775) (-971.269) [-970.080] (-969.284) * (-965.859) [-970.406] (-977.111) (-967.717) -- 0:02:45
       6500 -- (-966.500) (-967.782) [-972.310] (-970.015) * [-964.918] (-972.273) (-969.954) (-971.336) -- 0:02:32
       7000 -- [-967.659] (-974.278) (-971.423) (-974.658) * [-967.840] (-963.002) (-970.414) (-968.642) -- 0:02:21
       7500 -- (-974.212) [-970.024] (-966.991) (-970.185) * (-981.992) [-970.778] (-959.919) (-972.779) -- 0:02:12
       8000 -- (-965.911) (-969.257) (-974.932) [-966.736] * (-971.273) (-966.604) [-959.552] (-970.922) -- 0:02:04
       8500 -- (-968.750) [-971.284] (-972.234) (-967.946) * (-968.864) (-969.437) (-961.223) [-969.326] -- 0:01:56
       9000 -- (-962.273) [-972.550] (-974.311) (-964.271) * (-977.377) [-968.033] (-960.566) (-981.246) -- 0:01:50
       9500 -- (-977.195) (-973.843) (-967.869) [-965.479] * (-964.847) (-973.729) [-959.135] (-975.636) -- 0:01:44
      10000 -- (-967.158) (-968.645) (-970.329) [-969.808] * (-974.808) (-966.212) [-959.632] (-970.418) -- 0:01:39

      Average standard deviation of split frequencies: 0.111538

      10500 -- (-967.626) [-974.207] (-972.395) (-970.562) * (-968.472) [-970.774] (-959.925) (-968.884) -- 0:01:34
      11000 -- (-978.826) (-968.854) (-972.278) [-965.607] * [-967.019] (-968.149) (-961.692) (-970.900) -- 0:01:29
      11500 -- [-971.457] (-976.130) (-970.576) (-964.892) * (-973.009) (-966.893) [-960.280] (-964.859) -- 0:01:25
      12000 -- (-968.633) (-974.920) [-968.166] (-979.275) * (-969.683) [-966.605] (-959.040) (-965.353) -- 0:01:22
      12500 -- (-976.280) [-965.949] (-968.275) (-970.897) * [-966.280] (-967.411) (-959.356) (-972.943) -- 0:01:19
      13000 -- [-965.168] (-963.631) (-963.880) (-979.416) * [-965.815] (-968.152) (-962.015) (-965.348) -- 0:01:15
      13500 -- [-968.015] (-974.022) (-969.524) (-971.234) * (-967.789) [-963.026] (-959.561) (-965.465) -- 0:01:13
      14000 -- (-968.080) (-969.942) [-970.960] (-974.234) * (-970.067) [-968.834] (-962.307) (-968.503) -- 0:01:10
      14500 -- (-972.056) (-975.366) (-963.766) [-965.346] * (-966.140) [-966.022] (-962.111) (-967.843) -- 0:01:07
      15000 -- (-970.039) (-964.979) [-967.572] (-970.508) * [-971.426] (-972.074) (-962.794) (-967.494) -- 0:01:05

      Average standard deviation of split frequencies: 0.073657

      15500 -- [-962.462] (-970.126) (-966.006) (-973.239) * [-970.076] (-967.913) (-966.914) (-972.286) -- 0:01:03
      16000 -- [-975.494] (-968.247) (-968.796) (-973.786) * (-965.834) (-973.462) (-959.311) [-972.205] -- 0:01:01
      16500 -- (-967.136) (-969.176) [-962.224] (-983.737) * (-976.019) (-969.367) (-959.064) [-969.790] -- 0:00:59
      17000 -- (-972.540) (-974.207) [-968.244] (-966.985) * (-978.075) (-963.205) [-959.566] (-967.155) -- 0:01:55
      17500 -- (-970.709) [-968.529] (-969.684) (-984.526) * (-965.524) (-971.472) [-959.775] (-977.493) -- 0:01:52
      18000 -- (-972.165) (-978.279) [-970.551] (-973.310) * (-968.911) (-969.437) [-959.737] (-971.310) -- 0:01:49
      18500 -- (-965.612) (-975.632) [-968.304] (-970.203) * (-972.941) (-973.280) (-960.387) [-971.731] -- 0:01:46
      19000 -- [-962.231] (-970.362) (-968.413) (-964.933) * (-962.914) [-976.137] (-963.060) (-967.685) -- 0:01:43
      19500 -- (-967.442) (-974.244) [-969.897] (-969.975) * [-967.908] (-985.895) (-961.553) (-967.726) -- 0:01:40
      20000 -- [-968.239] (-974.426) (-972.108) (-973.033) * (-965.374) (-972.254) [-960.855] (-974.677) -- 0:01:38

      Average standard deviation of split frequencies: 0.064153

      20500 -- (-971.474) [-965.729] (-972.867) (-976.636) * (-968.913) [-970.521] (-961.634) (-964.122) -- 0:01:35
      21000 -- (-968.163) (-972.943) (-971.317) [-967.531] * [-968.536] (-968.917) (-961.064) (-969.118) -- 0:01:33
      21500 -- [-970.317] (-972.320) (-971.592) (-978.449) * (-972.584) (-968.942) (-959.484) [-971.839] -- 0:01:31
      22000 -- [-965.344] (-968.722) (-971.714) (-967.421) * (-972.699) [-964.155] (-960.877) (-965.780) -- 0:01:28
      22500 -- [-965.748] (-969.662) (-972.078) (-967.248) * (-971.109) [-964.178] (-961.509) (-967.827) -- 0:01:26
      23000 -- (-969.795) (-978.591) (-967.696) [-964.934] * [-965.518] (-965.388) (-960.210) (-976.664) -- 0:01:24
      23500 -- [-972.206] (-970.602) (-975.814) (-973.566) * [-967.453] (-969.591) (-960.196) (-976.209) -- 0:01:23
      24000 -- (-981.176) (-976.250) [-968.785] (-970.798) * (-970.585) (-968.044) [-961.013] (-968.354) -- 0:01:21
      24500 -- (-977.399) [-970.493] (-964.727) (-966.164) * (-966.416) (-972.361) [-960.528] (-970.302) -- 0:01:19
      25000 -- (-970.954) (-967.875) (-965.905) [-969.297] * [-969.976] (-965.826) (-958.763) (-972.991) -- 0:01:18

      Average standard deviation of split frequencies: 0.041442

      25500 -- (-967.084) (-971.224) (-966.408) [-965.815] * (-967.362) [-962.977] (-958.732) (-966.809) -- 0:01:16
      26000 -- [-963.638] (-969.212) (-971.032) (-978.231) * (-964.806) (-977.098) [-959.233] (-970.463) -- 0:01:14
      26500 -- (-963.975) (-968.381) (-981.392) [-970.830] * (-971.750) (-968.462) (-960.639) [-969.869] -- 0:01:13
      27000 -- (-965.024) (-976.729) [-966.545] (-971.098) * (-971.304) [-970.267] (-960.179) (-969.758) -- 0:01:12
      27500 -- (-967.319) [-966.328] (-968.787) (-972.315) * (-966.741) (-971.200) [-962.713] (-967.335) -- 0:01:10
      28000 -- (-975.127) (-965.309) [-964.324] (-973.585) * (-970.958) [-965.520] (-959.613) (-976.270) -- 0:01:09
      28500 -- (-973.636) [-969.783] (-968.840) (-968.288) * (-972.380) [-964.942] (-959.806) (-963.751) -- 0:01:08
      29000 -- (-977.581) (-968.696) [-965.540] (-964.487) * (-971.113) (-968.772) (-959.156) [-967.584] -- 0:01:06
      29500 -- [-976.383] (-971.637) (-969.275) (-971.445) * (-970.071) (-967.117) [-961.542] (-967.853) -- 0:01:05
      30000 -- [-966.071] (-968.041) (-968.965) (-973.396) * (-973.252) [-970.076] (-959.353) (-969.731) -- 0:01:04

      Average standard deviation of split frequencies: 0.039128

      30500 -- [-966.865] (-969.017) (-973.540) (-967.915) * (-965.782) (-971.506) (-959.298) [-966.701] -- 0:01:03
      31000 -- (-972.780) (-967.938) (-971.892) [-967.786] * (-968.419) [-972.484] (-959.054) (-968.416) -- 0:01:02
      31500 -- [-965.247] (-969.419) (-975.170) (-968.861) * (-970.787) (-976.673) [-959.877] (-967.967) -- 0:01:01
      32000 -- [-968.011] (-971.627) (-971.345) (-970.678) * (-968.817) [-969.460] (-961.109) (-963.609) -- 0:01:00
      32500 -- [-966.588] (-976.154) (-969.522) (-966.437) * [-969.559] (-967.617) (-961.487) (-973.810) -- 0:00:59
      33000 -- (-972.186) (-980.824) [-975.727] (-969.189) * [-971.794] (-967.985) (-960.411) (-972.549) -- 0:01:27
      33500 -- (-973.422) [-972.841] (-966.610) (-976.003) * (-968.210) [-970.977] (-960.917) (-968.358) -- 0:01:26
      34000 -- (-973.821) (-970.650) (-971.774) [-970.381] * (-973.781) (-965.328) [-959.812] (-982.038) -- 0:01:25
      34500 -- [-966.019] (-967.081) (-969.978) (-971.887) * [-970.642] (-978.994) (-961.065) (-964.020) -- 0:01:23
      35000 -- [-967.175] (-981.672) (-978.969) (-968.693) * (-972.661) [-973.287] (-963.387) (-975.719) -- 0:01:22

      Average standard deviation of split frequencies: 0.036665

      35500 -- (-976.239) (-973.791) [-971.800] (-974.422) * (-983.347) (-965.937) (-959.429) [-973.713] -- 0:01:21
      36000 -- [-966.532] (-973.696) (-974.946) (-977.887) * (-980.414) (-966.694) [-963.159] (-967.418) -- 0:01:20
      36500 -- [-976.839] (-977.280) (-973.377) (-965.959) * [-970.366] (-963.799) (-960.577) (-966.312) -- 0:01:19
      37000 -- (-976.354) (-959.748) (-976.771) [-965.043] * (-971.970) [-960.228] (-961.496) (-965.486) -- 0:01:18
      37500 -- (-963.928) [-962.165] (-969.221) (-976.181) * (-971.315) (-961.366) (-962.194) [-958.363] -- 0:01:17
      38000 -- [-967.949] (-959.181) (-968.687) (-972.677) * (-968.576) (-964.727) [-961.619] (-963.519) -- 0:01:15
      38500 -- (-968.573) [-961.619] (-972.153) (-965.887) * (-966.670) [-959.529] (-961.231) (-960.717) -- 0:01:14
      39000 -- (-968.540) (-960.097) [-968.352] (-967.142) * (-974.305) (-959.749) [-958.874] (-960.860) -- 0:01:13
      39500 -- (-975.243) (-959.587) (-963.330) [-973.175] * (-970.656) [-959.509] (-958.647) (-961.375) -- 0:01:12
      40000 -- (-972.909) (-959.978) (-972.037) [-969.527] * (-974.522) [-959.544] (-959.620) (-962.500) -- 0:01:12

      Average standard deviation of split frequencies: 0.032457

      40500 -- (-971.218) (-961.691) [-969.835] (-971.071) * (-967.653) [-962.945] (-962.197) (-958.977) -- 0:01:11
      41000 -- [-966.384] (-962.108) (-964.438) (-967.237) * [-965.383] (-962.489) (-962.469) (-961.639) -- 0:01:10
      41500 -- (-970.363) [-959.744] (-973.860) (-975.154) * (-971.087) (-961.855) (-960.596) [-959.968] -- 0:01:09
      42000 -- (-967.651) [-959.753] (-971.478) (-972.263) * [-974.162] (-963.457) (-963.463) (-960.274) -- 0:01:08
      42500 -- (-967.744) (-960.032) (-976.096) [-977.628] * (-967.056) [-961.437] (-964.086) (-962.771) -- 0:01:07
      43000 -- [-972.143] (-959.312) (-966.469) (-966.244) * (-967.047) [-959.545] (-962.695) (-963.688) -- 0:01:06
      43500 -- [-967.669] (-958.980) (-968.673) (-974.234) * (-964.566) (-958.367) (-961.653) [-960.584] -- 0:01:05
      44000 -- (-966.176) (-960.906) (-970.521) [-977.207] * (-964.436) (-960.586) [-963.213] (-962.531) -- 0:01:05
      44500 -- (-969.236) (-959.806) [-968.812] (-971.678) * (-974.206) (-964.682) [-962.768] (-960.368) -- 0:01:04
      45000 -- [-969.274] (-960.819) (-965.742) (-974.248) * [-967.639] (-958.458) (-959.262) (-959.905) -- 0:01:03

      Average standard deviation of split frequencies: 0.030744

      45500 -- [-961.787] (-960.066) (-974.743) (-973.132) * (-972.164) (-962.234) (-959.438) [-959.567] -- 0:01:02
      46000 -- (-974.508) (-960.178) (-967.868) [-972.161] * (-968.950) (-960.212) [-960.106] (-959.231) -- 0:01:02
      46500 -- (-967.958) (-961.970) (-976.246) [-969.391] * (-968.749) (-962.717) [-960.483] (-961.889) -- 0:01:01
      47000 -- (-967.273) (-960.493) (-972.188) [-964.531] * (-971.571) (-959.786) [-959.626] (-965.180) -- 0:01:00
      47500 -- (-966.091) (-960.744) [-968.494] (-974.788) * (-970.403) [-959.867] (-962.587) (-967.677) -- 0:01:20
      48000 -- (-970.433) [-960.288] (-970.018) (-973.106) * (-973.306) (-963.058) [-961.906] (-959.558) -- 0:01:19
      48500 -- [-973.405] (-958.360) (-971.925) (-975.785) * (-970.115) (-959.397) [-959.751] (-958.137) -- 0:01:18
      49000 -- (-973.421) [-958.399] (-972.635) (-963.901) * [-967.366] (-960.383) (-962.479) (-965.107) -- 0:01:17
      49500 -- (-967.691) (-964.042) [-964.240] (-962.593) * (-971.982) (-960.646) [-962.891] (-966.555) -- 0:01:16
      50000 -- [-970.689] (-960.053) (-964.121) (-962.604) * (-965.913) (-958.473) (-962.779) [-960.324] -- 0:01:16

      Average standard deviation of split frequencies: 0.025254

      50500 -- (-968.098) [-962.102] (-973.521) (-964.014) * (-967.969) (-958.842) (-961.933) [-962.107] -- 0:01:15
      51000 -- [-968.674] (-959.386) (-965.526) (-959.583) * (-968.430) [-961.119] (-966.652) (-960.710) -- 0:01:14
      51500 -- [-967.276] (-959.769) (-973.005) (-962.118) * (-976.509) (-963.071) (-961.500) [-962.830] -- 0:01:13
      52000 -- (-970.549) [-958.892] (-964.891) (-961.017) * (-976.458) (-960.573) [-960.307] (-961.545) -- 0:01:12
      52500 -- (-969.649) (-960.703) (-977.401) [-959.120] * (-963.846) [-959.602] (-964.959) (-959.731) -- 0:01:12
      53000 -- (-971.823) (-959.609) (-975.704) [-958.655] * (-975.295) [-961.185] (-960.069) (-960.216) -- 0:01:11
      53500 -- [-963.050] (-960.034) (-960.377) (-960.440) * (-975.892) [-959.658] (-963.946) (-962.154) -- 0:01:10
      54000 -- (-963.035) [-961.377] (-962.040) (-960.101) * (-974.036) [-960.768] (-962.471) (-960.471) -- 0:01:10
      54500 -- (-968.668) (-959.316) (-959.921) [-961.181] * (-968.659) [-960.168] (-963.241) (-959.448) -- 0:01:09
      55000 -- (-968.342) [-959.614] (-961.428) (-960.269) * (-968.233) [-959.422] (-960.997) (-958.736) -- 0:01:08

      Average standard deviation of split frequencies: 0.023925

      55500 -- (-979.176) (-960.719) [-959.848] (-961.328) * (-971.977) (-960.342) [-958.760] (-962.194) -- 0:01:08
      56000 -- (-972.010) [-959.805] (-964.740) (-960.015) * [-968.432] (-958.391) (-962.022) (-958.759) -- 0:01:07
      56500 -- [-968.981] (-962.704) (-963.852) (-958.567) * (-969.508) (-960.770) (-961.675) [-959.860] -- 0:01:06
      57000 -- (-969.423) (-958.836) [-961.918] (-961.953) * (-971.054) [-963.474] (-960.519) (-958.993) -- 0:01:06
      57500 -- [-970.133] (-960.892) (-964.328) (-963.233) * (-968.305) [-962.476] (-964.079) (-960.144) -- 0:01:05
      58000 -- [-968.463] (-961.517) (-961.455) (-960.592) * (-972.989) (-960.225) (-960.421) [-961.924] -- 0:01:04
      58500 -- (-969.871) (-960.516) (-962.505) [-962.865] * [-973.263] (-960.255) (-960.286) (-958.797) -- 0:01:04
      59000 -- (-968.354) [-958.411] (-961.262) (-962.694) * (-965.969) (-964.616) (-961.149) [-959.869] -- 0:01:03
      59500 -- (-970.847) [-958.280] (-959.843) (-962.008) * (-962.553) (-961.576) [-959.332] (-962.431) -- 0:01:03
      60000 -- [-967.696] (-958.282) (-961.278) (-963.046) * (-960.826) (-959.262) (-961.056) [-958.546] -- 0:01:02

      Average standard deviation of split frequencies: 0.020721

      60500 -- (-976.552) (-966.535) (-962.798) [-960.147] * (-960.746) (-959.357) [-959.853] (-959.154) -- 0:01:02
      61000 -- (-972.022) (-962.832) [-959.431] (-960.625) * (-962.294) (-964.200) (-958.792) [-959.150] -- 0:01:01
      61500 -- [-959.927] (-965.637) (-959.506) (-961.842) * (-961.848) (-960.630) [-960.958] (-958.458) -- 0:01:01
      62000 -- (-962.737) (-959.602) [-959.058] (-959.062) * (-962.655) [-962.622] (-960.506) (-958.660) -- 0:01:00
      62500 -- (-960.035) (-958.813) [-959.738] (-959.664) * (-960.653) [-965.896] (-959.734) (-959.119) -- 0:01:15
      63000 -- (-959.780) (-962.177) [-958.763] (-959.547) * (-963.515) (-964.953) (-958.962) [-959.273] -- 0:01:14
      63500 -- [-961.614] (-958.944) (-959.716) (-959.292) * (-961.191) [-960.898] (-961.478) (-959.512) -- 0:01:13
      64000 -- (-959.020) (-959.096) [-959.739] (-959.324) * [-959.902] (-961.265) (-959.998) (-960.556) -- 0:01:13
      64500 -- (-960.981) [-959.144] (-958.544) (-959.929) * (-958.218) [-961.166] (-962.459) (-963.255) -- 0:01:12
      65000 -- (-959.486) (-958.776) [-959.318] (-961.191) * (-961.112) (-961.281) (-959.851) [-960.782] -- 0:01:11

      Average standard deviation of split frequencies: 0.017499

      65500 -- (-959.460) [-959.168] (-959.124) (-960.968) * (-959.119) (-959.354) [-960.552] (-960.624) -- 0:01:11
      66000 -- (-961.224) (-960.269) [-959.817] (-962.216) * (-959.255) [-959.886] (-963.382) (-966.874) -- 0:01:10
      66500 -- (-958.960) [-959.768] (-959.626) (-961.500) * [-959.018] (-959.173) (-961.791) (-958.630) -- 0:01:10
      67000 -- (-958.704) (-961.707) [-960.289] (-960.176) * (-960.988) (-961.814) [-959.346] (-959.703) -- 0:01:09
      67500 -- (-960.296) (-960.160) (-962.715) [-959.839] * [-962.156] (-962.854) (-962.515) (-959.525) -- 0:01:09
      68000 -- (-961.681) (-959.272) (-959.204) [-962.945] * (-963.156) [-961.049] (-959.350) (-959.361) -- 0:01:08
      68500 -- [-960.599] (-959.249) (-959.390) (-962.886) * [-963.267] (-960.226) (-960.090) (-959.323) -- 0:01:07
      69000 -- (-959.732) [-963.490] (-960.327) (-960.553) * (-962.411) (-959.002) (-959.812) [-959.005] -- 0:01:07
      69500 -- [-963.799] (-966.880) (-961.705) (-959.922) * (-960.971) (-958.861) (-959.099) [-960.450] -- 0:01:06
      70000 -- [-963.823] (-968.242) (-961.005) (-961.469) * (-960.752) (-959.224) [-958.417] (-959.936) -- 0:01:06

      Average standard deviation of split frequencies: 0.021680

      70500 -- (-963.752) [-965.002] (-961.601) (-961.128) * (-961.393) (-960.117) [-959.000] (-964.379) -- 0:01:05
      71000 -- (-962.432) (-968.036) [-962.333] (-962.594) * (-961.146) (-961.137) (-960.026) [-961.231] -- 0:01:05
      71500 -- (-960.092) (-964.169) (-961.114) [-959.165] * (-960.627) [-960.533] (-962.713) (-962.856) -- 0:01:04
      72000 -- (-963.314) (-962.421) (-961.327) [-960.232] * (-960.721) (-960.811) [-962.052] (-960.648) -- 0:01:04
      72500 -- (-965.373) [-959.982] (-962.364) (-958.706) * (-964.045) (-969.183) [-963.882] (-963.386) -- 0:01:03
      73000 -- (-965.082) [-960.284] (-965.107) (-959.646) * (-958.765) (-966.286) (-963.303) [-958.386] -- 0:01:03
      73500 -- [-958.231] (-961.159) (-962.738) (-959.903) * (-959.113) (-966.266) [-959.972] (-958.971) -- 0:01:03
      74000 -- [-959.384] (-960.402) (-960.497) (-958.723) * [-964.028] (-967.703) (-963.313) (-958.180) -- 0:01:02
      74500 -- (-959.919) (-960.040) (-959.942) [-959.362] * (-962.211) (-959.612) (-962.089) [-958.740] -- 0:01:02
      75000 -- (-961.007) [-960.678] (-959.209) (-960.198) * (-959.207) [-959.377] (-961.417) (-959.896) -- 0:01:01

      Average standard deviation of split frequencies: 0.018890

      75500 -- (-960.052) (-962.557) (-959.483) [-958.974] * (-961.569) [-961.941] (-960.472) (-959.342) -- 0:01:01
      76000 -- (-960.331) (-959.894) [-962.510] (-958.718) * (-964.594) [-961.711] (-965.848) (-962.257) -- 0:01:00
      76500 -- (-959.207) (-961.701) (-960.548) [-959.230] * [-963.303] (-959.658) (-960.143) (-961.202) -- 0:01:00
      77000 -- (-959.713) (-961.882) [-960.432] (-962.063) * (-960.510) [-959.293] (-960.530) (-962.193) -- 0:00:59
      77500 -- (-959.164) [-962.236] (-963.202) (-958.451) * [-959.261] (-959.671) (-959.231) (-964.854) -- 0:00:59
      78000 -- (-959.164) (-960.386) (-961.965) [-958.483] * (-960.762) (-960.587) [-958.804] (-961.648) -- 0:00:59
      78500 -- (-958.490) [-961.167] (-960.997) (-959.637) * (-960.075) (-960.333) (-968.570) [-963.172] -- 0:01:10
      79000 -- (-959.621) [-959.656] (-958.530) (-958.893) * (-960.705) (-963.307) [-960.119] (-958.715) -- 0:01:09
      79500 -- (-960.936) (-960.790) [-959.741] (-960.203) * (-963.768) [-959.716] (-960.782) (-958.686) -- 0:01:09
      80000 -- (-960.783) (-964.404) (-959.730) [-958.890] * (-961.676) (-959.723) (-960.566) [-959.855] -- 0:01:09

      Average standard deviation of split frequencies: 0.018762

      80500 -- (-961.853) (-959.993) [-959.996] (-960.959) * (-960.485) (-960.728) [-959.880] (-962.927) -- 0:01:08
      81000 -- [-959.614] (-961.614) (-958.812) (-963.841) * (-961.142) (-959.433) [-960.768] (-962.785) -- 0:01:08
      81500 -- [-960.589] (-959.395) (-960.284) (-961.612) * [-961.965] (-960.474) (-959.423) (-962.461) -- 0:01:07
      82000 -- (-958.766) [-959.762] (-959.713) (-965.751) * [-959.200] (-962.252) (-961.492) (-960.097) -- 0:01:07
      82500 -- (-960.535) (-960.172) [-960.842] (-965.565) * (-959.990) (-961.581) [-963.324] (-959.284) -- 0:01:06
      83000 -- (-960.528) [-960.935] (-961.353) (-960.059) * (-961.263) (-961.765) [-961.662] (-965.232) -- 0:01:06
      83500 -- (-964.546) [-962.983] (-961.665) (-962.989) * [-959.476] (-962.259) (-962.417) (-964.705) -- 0:01:05
      84000 -- [-959.273] (-964.729) (-961.922) (-959.688) * (-961.233) (-962.502) (-961.073) [-962.432] -- 0:01:05
      84500 -- [-958.896] (-960.189) (-960.798) (-960.631) * (-961.348) (-960.551) (-961.538) [-958.487] -- 0:01:05
      85000 -- (-958.931) [-958.716] (-959.833) (-961.039) * (-960.618) (-959.078) [-958.205] (-961.773) -- 0:01:04

      Average standard deviation of split frequencies: 0.019055

      85500 -- [-963.034] (-959.370) (-959.535) (-958.616) * (-960.164) (-959.220) (-959.947) [-959.538] -- 0:01:04
      86000 -- (-959.717) (-959.799) (-960.804) [-959.076] * (-960.179) (-961.102) (-959.040) [-958.888] -- 0:01:03
      86500 -- [-959.136] (-960.112) (-960.158) (-959.320) * (-960.011) [-959.845] (-961.473) (-964.663) -- 0:01:03
      87000 -- (-961.466) (-964.005) (-959.495) [-958.931] * (-959.133) [-959.520] (-961.051) (-961.043) -- 0:01:02
      87500 -- (-961.047) [-958.930] (-959.257) (-961.716) * (-958.960) (-959.873) (-966.684) [-959.739] -- 0:01:02
      88000 -- (-961.600) (-963.953) [-959.479] (-958.982) * (-964.507) [-959.806] (-962.538) (-959.715) -- 0:01:02
      88500 -- (-963.403) [-961.222] (-961.569) (-966.064) * (-958.635) (-961.406) (-959.760) [-961.993] -- 0:01:01
      89000 -- (-959.522) (-961.664) [-959.443] (-959.821) * (-958.890) (-960.837) (-959.356) [-961.382] -- 0:01:01
      89500 -- (-962.318) (-960.102) (-960.364) [-962.102] * (-959.790) (-960.535) (-961.880) [-959.643] -- 0:01:01
      90000 -- (-964.138) (-961.160) (-958.916) [-964.669] * (-960.633) [-961.900] (-960.995) (-958.540) -- 0:01:00

      Average standard deviation of split frequencies: 0.016588

      90500 -- (-960.279) [-960.913] (-959.142) (-961.075) * (-961.872) (-962.657) [-959.925] (-960.456) -- 0:01:00
      91000 -- (-961.307) (-961.783) (-960.956) [-960.502] * (-963.565) [-961.387] (-963.545) (-958.401) -- 0:00:59
      91500 -- (-960.222) (-960.712) [-961.431] (-960.803) * [-961.051] (-967.823) (-961.351) (-962.117) -- 0:00:59
      92000 -- (-960.672) (-960.623) [-969.967] (-959.746) * (-960.735) (-963.219) [-960.499] (-960.992) -- 0:00:59
      92500 -- (-963.628) (-959.876) [-962.859] (-964.869) * (-962.996) (-965.854) [-959.806] (-964.026) -- 0:00:58
      93000 -- [-962.818] (-962.769) (-961.325) (-963.056) * (-958.957) [-960.785] (-961.311) (-959.856) -- 0:00:58
      93500 -- (-959.802) (-965.912) [-962.684] (-959.879) * (-964.748) (-959.110) [-960.324] (-958.663) -- 0:00:58
      94000 -- [-960.132] (-963.265) (-963.212) (-964.036) * (-966.546) (-959.355) [-961.706] (-959.034) -- 0:00:57
      94500 -- [-963.552] (-962.481) (-963.650) (-960.092) * (-959.565) (-960.295) (-958.441) [-958.900] -- 0:00:57
      95000 -- (-959.163) [-965.364] (-958.554) (-962.064) * (-958.932) (-959.499) [-960.855] (-958.790) -- 0:00:57

      Average standard deviation of split frequencies: 0.014030

      95500 -- (-960.033) (-962.136) [-959.846] (-962.821) * [-958.879] (-959.718) (-962.370) (-958.854) -- 0:01:06
      96000 -- (-958.925) [-959.393] (-959.159) (-962.930) * (-959.795) (-958.900) [-960.165] (-959.719) -- 0:01:05
      96500 -- (-958.738) (-959.138) (-964.473) [-963.548] * [-958.567] (-963.696) (-959.887) (-961.002) -- 0:01:05
      97000 -- [-959.033] (-959.222) (-959.994) (-960.785) * [-959.020] (-965.528) (-962.641) (-963.548) -- 0:01:05
      97500 -- (-961.232) (-960.622) (-958.568) [-959.365] * [-960.977] (-958.742) (-965.129) (-961.075) -- 0:01:04
      98000 -- [-960.474] (-959.926) (-959.947) (-965.877) * [-960.823] (-959.796) (-959.570) (-959.149) -- 0:01:04
      98500 -- (-958.679) (-964.590) (-959.484) [-962.704] * [-960.743] (-960.673) (-959.440) (-960.067) -- 0:01:04
      99000 -- (-959.806) (-963.481) (-961.606) [-959.494] * (-960.715) [-959.019] (-962.572) (-960.138) -- 0:01:03
      99500 -- (-962.811) (-960.808) [-961.129] (-959.682) * (-960.816) [-958.611] (-961.696) (-961.205) -- 0:01:03
      100000 -- (-961.640) (-960.826) [-960.459] (-961.818) * (-960.842) [-961.166] (-961.292) (-964.022) -- 0:01:02

      Average standard deviation of split frequencies: 0.016390

      100500 -- (-959.713) (-961.621) [-958.993] (-960.100) * (-961.023) (-962.333) (-966.143) [-962.811] -- 0:01:02
      101000 -- (-961.911) (-959.629) [-958.789] (-960.649) * (-964.045) (-960.606) [-961.139] (-961.178) -- 0:01:02
      101500 -- (-959.752) (-960.212) [-958.569] (-960.815) * (-967.262) [-962.214] (-960.696) (-958.598) -- 0:01:01
      102000 -- [-959.107] (-959.755) (-958.546) (-963.513) * (-963.942) [-961.258] (-958.977) (-959.019) -- 0:01:01
      102500 -- [-960.058] (-960.535) (-959.233) (-966.275) * [-959.488] (-960.900) (-958.846) (-961.617) -- 0:01:01
      103000 -- (-960.989) [-961.706] (-960.225) (-964.936) * (-963.906) [-960.693] (-961.456) (-963.500) -- 0:01:00
      103500 -- (-959.611) (-959.437) [-959.959] (-960.646) * [-961.833] (-959.600) (-958.976) (-958.568) -- 0:01:00
      104000 -- (-963.063) (-964.597) (-959.855) [-964.160] * [-962.442] (-959.090) (-961.538) (-958.790) -- 0:01:00
      104500 -- (-962.478) (-960.374) (-962.481) [-961.859] * [-961.440] (-961.347) (-962.201) (-960.976) -- 0:00:59
      105000 -- (-959.915) (-959.407) (-962.121) [-961.065] * (-962.608) [-961.637] (-961.510) (-961.865) -- 0:00:59

      Average standard deviation of split frequencies: 0.015916

      105500 -- (-959.982) (-960.905) [-960.254] (-959.773) * (-962.935) [-959.487] (-962.330) (-965.357) -- 0:00:59
      106000 -- (-963.190) (-961.233) [-963.320] (-962.108) * (-961.807) (-958.997) (-963.484) [-962.239] -- 0:00:59
      106500 -- (-959.661) [-962.148] (-960.206) (-958.997) * (-959.642) (-958.955) [-959.848] (-960.222) -- 0:00:58
      107000 -- (-962.895) (-960.067) [-960.037] (-960.894) * (-962.988) (-958.513) [-959.763] (-960.333) -- 0:00:58
      107500 -- (-962.381) (-960.660) (-961.063) [-959.426] * (-962.357) [-959.374] (-962.026) (-959.371) -- 0:00:58
      108000 -- (-959.134) (-961.606) (-959.311) [-960.977] * [-962.632] (-961.740) (-960.296) (-960.218) -- 0:00:57
      108500 -- (-962.828) [-962.231] (-959.455) (-961.331) * (-963.170) [-959.499] (-960.352) (-971.678) -- 0:00:57
      109000 -- (-958.920) [-960.608] (-962.351) (-959.986) * (-961.582) (-961.106) (-961.235) [-966.558] -- 0:00:57
      109500 -- (-959.009) [-965.042] (-960.868) (-960.035) * (-961.672) (-960.425) [-960.244] (-960.408) -- 0:00:56
      110000 -- (-961.395) (-962.762) (-962.409) [-960.753] * (-960.249) [-958.705] (-958.730) (-967.330) -- 0:00:56

      Average standard deviation of split frequencies: 0.016565

      110500 -- (-959.003) (-962.546) (-964.942) [-959.745] * [-960.441] (-963.343) (-958.772) (-969.009) -- 0:00:56
      111000 -- (-960.476) (-960.562) [-961.593] (-961.937) * [-960.667] (-963.264) (-959.260) (-960.346) -- 0:00:56
      111500 -- (-962.013) [-959.154] (-965.363) (-960.779) * (-959.791) [-962.802] (-959.585) (-965.568) -- 0:01:03
      112000 -- (-959.416) [-959.669] (-964.475) (-958.701) * (-962.471) (-962.365) [-963.019] (-962.637) -- 0:01:03
      112500 -- (-962.813) [-962.181] (-962.571) (-959.485) * (-959.850) [-961.541] (-961.439) (-961.024) -- 0:01:03
      113000 -- (-960.462) (-958.954) (-959.715) [-959.532] * [-959.586] (-962.649) (-961.919) (-960.816) -- 0:01:02
      113500 -- (-962.256) [-961.262] (-960.833) (-959.894) * (-960.819) (-961.661) [-960.377] (-962.945) -- 0:01:02
      114000 -- (-961.347) (-959.658) [-960.558] (-959.715) * [-961.610] (-960.228) (-961.750) (-966.978) -- 0:01:02
      114500 -- (-959.278) (-958.371) [-961.370] (-958.799) * [-959.389] (-959.011) (-965.910) (-960.080) -- 0:01:01
      115000 -- (-964.456) [-958.748] (-961.944) (-959.066) * (-959.642) (-959.320) (-961.235) [-962.223] -- 0:01:01

      Average standard deviation of split frequencies: 0.018180

      115500 -- [-963.151] (-960.024) (-960.301) (-958.221) * [-960.109] (-959.404) (-959.350) (-961.390) -- 0:01:01
      116000 -- (-960.439) (-962.662) (-959.805) [-962.252] * (-960.135) (-961.072) [-960.290] (-961.118) -- 0:01:00
      116500 -- (-958.814) (-966.574) [-959.480] (-958.867) * (-959.542) (-960.094) [-961.082] (-961.508) -- 0:01:00
      117000 -- (-960.318) [-963.079] (-959.570) (-960.559) * (-959.055) (-959.175) (-958.842) [-963.350] -- 0:01:00
      117500 -- (-960.203) [-958.604] (-959.116) (-961.592) * (-959.563) (-958.980) (-959.986) [-959.005] -- 0:01:00
      118000 -- (-959.520) [-960.727] (-960.021) (-962.461) * (-959.307) (-959.174) [-962.753] (-962.395) -- 0:00:59
      118500 -- (-959.084) [-961.252] (-958.881) (-962.466) * (-961.273) (-958.490) [-959.456] (-961.749) -- 0:00:59
      119000 -- [-959.295] (-962.631) (-959.896) (-961.524) * (-958.930) [-959.086] (-959.415) (-962.307) -- 0:00:59
      119500 -- (-958.670) (-960.674) [-962.094] (-963.825) * (-958.975) [-960.816] (-962.667) (-958.979) -- 0:00:58
      120000 -- (-960.398) (-960.976) [-963.103] (-963.343) * (-960.566) [-960.150] (-960.588) (-964.325) -- 0:00:58

      Average standard deviation of split frequencies: 0.016244

      120500 -- [-960.867] (-960.590) (-960.547) (-968.767) * (-962.250) (-960.006) (-961.818) [-959.299] -- 0:00:58
      121000 -- (-959.921) (-962.826) [-961.927] (-965.133) * (-966.299) (-959.831) (-960.820) [-958.967] -- 0:00:58
      121500 -- (-958.384) (-959.481) (-958.898) [-959.768] * (-964.909) (-962.258) (-958.544) [-958.975] -- 0:00:57
      122000 -- [-960.249] (-960.423) (-959.611) (-960.289) * (-960.237) (-960.901) [-961.447] (-958.836) -- 0:00:57
      122500 -- (-958.538) (-962.572) [-959.006] (-961.903) * [-960.728] (-963.723) (-959.418) (-961.665) -- 0:00:57
      123000 -- [-958.737] (-961.232) (-958.892) (-960.835) * [-960.196] (-961.370) (-963.486) (-959.584) -- 0:00:57
      123500 -- (-960.516) [-962.539] (-960.190) (-961.136) * [-960.984] (-961.466) (-964.513) (-960.833) -- 0:00:56
      124000 -- (-960.859) (-963.084) [-958.513] (-959.581) * [-958.891] (-959.337) (-960.505) (-961.666) -- 0:00:56
      124500 -- (-961.059) (-961.846) [-959.584] (-959.466) * [-958.149] (-962.665) (-960.123) (-964.836) -- 0:00:56
      125000 -- (-962.704) [-960.324] (-959.563) (-959.569) * [-960.690] (-964.186) (-959.674) (-962.032) -- 0:00:56

      Average standard deviation of split frequencies: 0.012908

      125500 -- [-960.405] (-959.607) (-959.207) (-961.428) * (-962.683) (-961.612) [-960.650] (-960.346) -- 0:00:55
      126000 -- (-960.944) [-959.068] (-961.442) (-960.901) * [-959.038] (-962.463) (-960.997) (-961.783) -- 0:00:55
      126500 -- [-962.816] (-962.043) (-961.631) (-959.360) * (-959.698) (-961.418) [-959.664] (-961.182) -- 0:00:55
      127000 -- (-961.898) (-964.388) (-959.863) [-958.405] * (-959.440) (-963.209) (-960.709) [-958.951] -- 0:00:54
      127500 -- (-961.647) [-959.576] (-958.578) (-959.038) * (-958.582) (-961.914) [-960.010] (-959.388) -- 0:00:54
      128000 -- (-960.154) [-959.412] (-962.033) (-960.614) * (-958.331) (-960.553) (-962.029) [-958.874] -- 0:01:01
      128500 -- (-959.320) (-959.260) [-959.065] (-958.889) * (-962.167) (-962.777) [-963.449] (-959.743) -- 0:01:01
      129000 -- (-959.288) (-961.694) (-960.043) [-959.230] * (-962.093) (-959.299) [-966.309] (-961.363) -- 0:01:00
      129500 -- [-958.684] (-962.481) (-962.168) (-964.431) * [-960.071] (-959.802) (-962.184) (-963.771) -- 0:01:00
      130000 -- (-959.396) (-965.837) (-959.481) [-958.733] * (-961.116) (-959.211) (-966.836) [-962.334] -- 0:01:00

      Average standard deviation of split frequencies: 0.015000

      130500 -- (-959.297) [-960.293] (-958.260) (-960.049) * [-961.348] (-959.908) (-962.419) (-962.381) -- 0:00:59
      131000 -- (-962.073) (-960.523) (-959.472) [-958.201] * (-960.550) [-958.510] (-963.399) (-964.687) -- 0:00:59
      131500 -- (-962.725) (-963.128) [-960.386] (-958.542) * (-961.249) (-958.379) (-963.874) [-962.461] -- 0:00:59
      132000 -- (-959.829) (-967.808) [-960.232] (-959.115) * (-958.468) (-962.920) [-960.521] (-962.633) -- 0:00:59
      132500 -- (-961.368) [-960.775] (-961.882) (-959.112) * (-958.874) [-960.810] (-961.048) (-960.652) -- 0:00:58
      133000 -- [-961.027] (-963.302) (-960.687) (-959.264) * [-960.281] (-962.262) (-961.867) (-960.773) -- 0:00:58
      133500 -- [-964.972] (-960.173) (-961.072) (-959.479) * (-966.254) (-963.963) (-961.015) [-961.363] -- 0:00:58
      134000 -- (-959.466) [-959.767] (-961.681) (-960.723) * (-963.720) (-964.325) [-961.384] (-961.980) -- 0:00:58
      134500 -- (-959.536) (-965.720) (-963.421) [-959.414] * (-963.857) (-967.524) (-959.237) [-962.032] -- 0:00:57
      135000 -- (-960.520) [-962.158] (-960.338) (-959.247) * (-963.971) [-960.394] (-959.625) (-960.400) -- 0:00:57

      Average standard deviation of split frequencies: 0.016784

      135500 -- (-960.557) (-961.873) (-959.538) [-961.499] * (-962.391) (-963.568) [-958.611] (-965.929) -- 0:00:57
      136000 -- (-961.141) [-962.454] (-958.683) (-959.337) * [-960.444] (-961.800) (-958.451) (-963.445) -- 0:00:57
      136500 -- (-959.947) (-959.140) [-961.501] (-964.411) * (-958.964) (-961.912) [-958.614] (-964.691) -- 0:00:56
      137000 -- [-960.608] (-963.262) (-961.266) (-961.616) * (-966.650) (-959.661) [-960.226] (-964.807) -- 0:00:56
      137500 -- (-963.301) (-961.357) (-962.119) [-959.635] * (-959.905) (-959.549) [-959.543] (-963.531) -- 0:00:56
      138000 -- (-962.083) (-960.247) (-961.589) [-959.403] * (-965.956) [-958.865] (-958.766) (-960.690) -- 0:00:56
      138500 -- [-963.600] (-958.892) (-961.282) (-962.484) * (-967.924) [-960.067] (-960.641) (-961.818) -- 0:00:55
      139000 -- (-960.872) (-959.445) [-962.551] (-959.102) * (-966.135) (-958.459) (-962.233) [-960.670] -- 0:00:55
      139500 -- (-962.895) (-961.092) [-958.339] (-960.384) * [-958.779] (-959.692) (-959.322) (-959.401) -- 0:00:55
      140000 -- (-961.256) (-960.665) [-958.363] (-960.230) * [-961.821] (-962.090) (-960.437) (-959.101) -- 0:00:55

      Average standard deviation of split frequencies: 0.016756

      140500 -- (-960.213) (-959.820) [-959.143] (-959.500) * (-966.636) [-960.162] (-959.476) (-958.631) -- 0:00:55
      141000 -- [-962.850] (-961.138) (-959.109) (-960.356) * (-961.264) (-960.868) [-958.938] (-959.454) -- 0:00:54
      141500 -- (-960.041) (-964.950) [-959.297] (-962.720) * (-958.908) (-961.344) [-959.852] (-960.407) -- 0:00:54
      142000 -- (-961.266) (-963.086) [-958.909] (-963.710) * [-958.957] (-961.583) (-960.989) (-960.760) -- 0:00:54
      142500 -- (-958.813) (-961.895) [-961.446] (-964.577) * (-960.199) [-965.380] (-959.679) (-959.899) -- 0:00:54
      143000 -- (-958.926) (-959.398) [-959.653] (-971.605) * (-961.017) (-962.288) (-959.634) [-961.490] -- 0:00:53
      143500 -- [-960.561] (-962.686) (-960.772) (-960.803) * (-963.130) (-963.958) [-961.806] (-961.668) -- 0:00:53
      144000 -- (-965.167) [-964.026] (-966.848) (-958.584) * [-958.503] (-962.046) (-962.361) (-963.076) -- 0:00:53
      144500 -- (-960.085) (-962.143) (-959.278) [-960.357] * [-958.317] (-962.564) (-961.681) (-964.410) -- 0:00:59
      145000 -- [-961.008] (-961.365) (-962.408) (-962.267) * [-959.262] (-959.871) (-961.681) (-961.532) -- 0:00:58

      Average standard deviation of split frequencies: 0.015990

      145500 -- [-959.723] (-961.028) (-959.638) (-961.205) * (-959.397) [-959.242] (-961.017) (-959.351) -- 0:00:58
      146000 -- (-962.273) (-961.401) (-959.688) [-959.621] * (-961.214) (-958.785) (-961.544) [-959.977] -- 0:00:58
      146500 -- (-962.976) [-960.857] (-962.022) (-960.331) * [-963.241] (-958.593) (-961.883) (-960.599) -- 0:00:58
      147000 -- (-963.187) (-961.567) (-962.101) [-960.440] * (-962.077) (-958.787) [-959.374] (-960.190) -- 0:00:58
      147500 -- (-962.185) (-961.185) [-961.233] (-958.616) * (-963.485) [-959.304] (-962.766) (-958.812) -- 0:00:57
      148000 -- (-963.863) (-960.679) (-959.647) [-959.546] * [-961.003] (-964.583) (-966.422) (-959.459) -- 0:00:57
      148500 -- (-962.253) [-959.968] (-959.802) (-961.366) * (-961.132) (-959.197) [-962.531] (-959.240) -- 0:00:57
      149000 -- (-962.974) [-960.064] (-959.377) (-959.385) * (-958.345) (-960.111) [-960.987] (-958.843) -- 0:00:57
      149500 -- (-961.246) (-958.772) (-960.194) [-959.528] * (-960.338) (-958.833) [-960.745] (-961.790) -- 0:00:56
      150000 -- (-963.780) (-958.624) [-960.222] (-961.882) * [-960.344] (-966.050) (-963.083) (-966.304) -- 0:00:56

      Average standard deviation of split frequencies: 0.014452

      150500 -- (-965.285) (-961.093) (-960.121) [-960.432] * (-962.581) (-959.368) (-961.405) [-965.519] -- 0:00:56
      151000 -- (-963.264) (-964.045) [-959.221] (-962.248) * [-959.592] (-958.867) (-962.294) (-966.344) -- 0:00:56
      151500 -- (-964.605) (-960.218) (-961.504) [-959.782] * (-958.381) (-961.302) [-961.986] (-962.116) -- 0:00:56
      152000 -- (-964.398) (-959.592) (-960.268) [-960.661] * (-958.770) (-960.357) [-960.264] (-963.324) -- 0:00:55
      152500 -- (-963.376) [-961.980] (-960.707) (-959.715) * (-958.699) [-961.144] (-959.959) (-959.993) -- 0:00:55
      153000 -- (-966.397) [-960.981] (-961.365) (-959.384) * [-959.655] (-961.068) (-960.352) (-962.167) -- 0:00:55
      153500 -- (-961.460) (-958.685) [-958.891] (-959.700) * [-960.193] (-964.128) (-962.028) (-958.256) -- 0:00:55
      154000 -- (-961.878) (-959.073) [-961.027] (-959.637) * [-962.499] (-961.633) (-960.235) (-960.060) -- 0:00:54
      154500 -- (-961.522) (-960.479) (-959.687) [-959.876] * (-961.153) (-961.652) (-960.947) [-960.343] -- 0:00:54
      155000 -- (-960.769) (-963.273) (-962.026) [-959.663] * (-959.418) (-960.201) (-960.365) [-962.392] -- 0:00:54

      Average standard deviation of split frequencies: 0.013900

      155500 -- [-960.771] (-961.146) (-959.701) (-959.998) * [-958.696] (-965.073) (-958.497) (-961.328) -- 0:00:54
      156000 -- [-960.713] (-958.640) (-959.166) (-960.383) * (-959.964) (-963.656) [-959.733] (-959.761) -- 0:00:54
      156500 -- (-963.047) (-960.815) (-959.173) [-959.077] * [-960.163] (-961.435) (-960.737) (-958.681) -- 0:00:53
      157000 -- (-963.344) [-963.097] (-959.307) (-960.701) * (-958.586) (-964.142) [-958.820] (-959.087) -- 0:00:53
      157500 -- [-959.904] (-960.476) (-961.354) (-961.630) * (-960.026) (-962.725) (-959.938) [-961.986] -- 0:00:53
      158000 -- (-960.703) [-959.108] (-960.670) (-962.052) * (-962.525) (-961.828) (-960.077) [-959.424] -- 0:00:53
      158500 -- (-960.428) (-960.574) [-959.627] (-961.314) * (-962.817) (-961.214) (-959.976) [-959.058] -- 0:00:53
      159000 -- (-960.802) (-959.582) (-958.953) [-961.064] * (-962.013) [-961.513] (-959.418) (-961.635) -- 0:00:52
      159500 -- (-961.127) (-960.809) (-959.503) [-959.939] * [-964.934] (-960.733) (-961.219) (-964.045) -- 0:00:52
      160000 -- (-962.616) (-963.427) (-959.232) [-958.469] * (-959.591) (-962.287) [-963.135] (-959.542) -- 0:00:52

      Average standard deviation of split frequencies: 0.016678

      160500 -- [-962.287] (-958.930) (-960.285) (-961.820) * (-960.991) (-960.301) [-961.819] (-962.173) -- 0:00:57
      161000 -- (-959.210) [-959.136] (-960.985) (-959.105) * (-961.175) (-959.755) [-958.873] (-960.046) -- 0:00:57
      161500 -- [-959.200] (-959.144) (-966.664) (-959.377) * [-960.634] (-960.789) (-958.937) (-960.425) -- 0:00:57
      162000 -- [-959.261] (-963.122) (-960.139) (-960.046) * (-963.255) (-962.709) (-960.125) [-959.097] -- 0:00:56
      162500 -- [-958.989] (-960.700) (-961.953) (-958.948) * (-960.140) (-959.037) [-961.486] (-960.277) -- 0:00:56
      163000 -- (-961.290) (-961.050) (-960.455) [-963.395] * (-965.033) [-962.198] (-961.954) (-959.345) -- 0:00:56
      163500 -- [-961.648] (-960.461) (-964.431) (-960.977) * (-962.856) [-961.270] (-962.799) (-961.304) -- 0:00:56
      164000 -- (-960.629) (-960.875) [-960.596] (-964.397) * (-964.562) (-961.167) [-963.231] (-958.394) -- 0:00:56
      164500 -- (-958.574) [-960.134] (-960.184) (-963.025) * (-961.306) [-959.392] (-958.765) (-958.909) -- 0:00:55
      165000 -- [-959.897] (-959.657) (-961.621) (-960.274) * (-962.110) [-960.756] (-961.745) (-958.837) -- 0:00:55

      Average standard deviation of split frequencies: 0.017039

      165500 -- [-959.969] (-960.439) (-958.512) (-959.879) * (-964.930) (-959.198) [-958.947] (-960.047) -- 0:00:55
      166000 -- (-958.946) (-960.341) (-958.376) [-958.713] * (-961.560) (-959.655) (-961.382) [-960.585] -- 0:00:55
      166500 -- (-959.533) (-963.038) (-958.290) [-959.265] * (-960.794) (-959.032) (-960.873) [-959.230] -- 0:00:55
      167000 -- (-959.660) [-962.290] (-960.354) (-960.797) * (-959.936) (-960.682) (-960.288) [-960.401] -- 0:00:54
      167500 -- (-959.578) [-959.354] (-959.935) (-960.250) * (-959.725) [-959.937] (-960.251) (-960.947) -- 0:00:54
      168000 -- (-960.732) [-961.937] (-960.593) (-962.347) * (-961.917) (-960.669) [-960.724] (-964.245) -- 0:00:54
      168500 -- (-959.040) (-959.999) [-961.031] (-959.996) * (-960.068) (-961.939) [-960.098] (-962.425) -- 0:00:54
      169000 -- [-961.821] (-959.761) (-962.010) (-959.579) * (-958.684) (-962.790) [-963.683] (-960.750) -- 0:00:54
      169500 -- (-959.273) [-959.349] (-965.557) (-962.614) * [-963.120] (-961.423) (-963.672) (-959.252) -- 0:00:53
      170000 -- [-958.884] (-959.852) (-963.853) (-960.591) * (-960.761) [-961.251] (-958.906) (-960.071) -- 0:00:53

      Average standard deviation of split frequencies: 0.015991

      170500 -- (-960.930) (-958.851) (-962.296) [-960.771] * [-958.871] (-959.492) (-959.316) (-961.847) -- 0:00:53
      171000 -- [-959.855] (-959.302) (-962.208) (-958.464) * [-959.306] (-959.638) (-959.373) (-960.896) -- 0:00:53
      171500 -- [-960.623] (-960.401) (-960.855) (-958.500) * [-961.455] (-959.124) (-959.697) (-958.905) -- 0:00:53
      172000 -- (-961.314) (-958.851) (-959.520) [-959.782] * (-959.749) (-960.551) [-959.391] (-958.809) -- 0:00:52
      172500 -- (-964.536) [-959.985] (-960.309) (-959.543) * [-961.359] (-958.329) (-963.926) (-959.484) -- 0:00:52
      173000 -- (-961.294) (-958.640) (-958.215) [-960.543] * (-959.452) (-959.954) [-960.674] (-960.044) -- 0:00:52
      173500 -- (-962.316) [-958.588] (-960.477) (-961.077) * (-959.285) (-960.259) (-960.201) [-959.908] -- 0:00:52
      174000 -- (-959.774) (-958.608) (-958.578) [-960.556] * [-959.873] (-961.048) (-964.405) (-962.235) -- 0:00:52
      174500 -- (-959.918) [-958.527] (-959.637) (-962.330) * (-960.336) (-960.974) (-959.844) [-962.077] -- 0:00:52
      175000 -- (-961.498) [-959.169] (-958.342) (-959.280) * (-960.033) (-961.009) [-959.835] (-959.964) -- 0:00:51

      Average standard deviation of split frequencies: 0.016453

      175500 -- [-959.507] (-967.166) (-959.421) (-960.064) * [-959.474] (-964.860) (-961.604) (-960.674) -- 0:00:51
      176000 -- (-961.592) (-962.699) [-960.747] (-959.582) * (-959.842) (-961.519) [-961.699] (-960.893) -- 0:00:51
      176500 -- (-961.387) [-959.031] (-963.067) (-960.075) * (-961.294) [-958.785] (-962.315) (-962.302) -- 0:00:51
      177000 -- [-960.546] (-959.434) (-961.115) (-958.445) * (-960.525) [-958.413] (-963.225) (-961.714) -- 0:00:51
      177500 -- (-960.483) (-959.326) (-964.331) [-959.187] * (-959.194) (-958.626) [-964.273] (-961.127) -- 0:00:55
      178000 -- [-961.382] (-960.114) (-963.002) (-958.545) * (-960.482) (-960.965) (-963.671) [-961.736] -- 0:00:55
      178500 -- (-959.238) [-958.440] (-958.796) (-959.951) * (-959.772) (-959.435) (-958.930) [-959.552] -- 0:00:55
      179000 -- (-958.447) (-959.826) (-963.036) [-961.744] * [-960.324] (-958.617) (-959.022) (-961.801) -- 0:00:55
      179500 -- (-958.660) (-961.779) [-965.640] (-959.992) * [-962.560] (-960.448) (-961.152) (-958.443) -- 0:00:54
      180000 -- (-959.263) (-959.540) [-962.617] (-959.285) * (-962.588) (-960.594) [-959.070] (-958.683) -- 0:00:54

      Average standard deviation of split frequencies: 0.016380

      180500 -- (-959.535) (-959.093) [-962.146] (-960.474) * [-962.119] (-960.458) (-959.853) (-959.792) -- 0:00:54
      181000 -- [-959.649] (-958.216) (-963.295) (-963.317) * (-962.893) (-960.255) (-960.718) [-960.737] -- 0:00:54
      181500 -- (-959.398) (-959.726) [-963.975] (-965.404) * (-960.939) [-961.340] (-960.948) (-959.420) -- 0:00:54
      182000 -- [-959.253] (-959.328) (-962.300) (-966.863) * [-961.979] (-960.816) (-961.283) (-958.303) -- 0:00:53
      182500 -- (-960.461) (-960.148) (-963.232) [-959.450] * (-962.368) (-964.777) (-963.107) [-958.654] -- 0:00:53
      183000 -- (-966.291) [-961.387] (-961.732) (-960.444) * [-963.157] (-961.041) (-963.309) (-961.170) -- 0:00:53
      183500 -- (-963.963) (-961.965) (-958.959) [-959.521] * (-963.348) [-961.320] (-959.928) (-961.538) -- 0:00:53
      184000 -- [-968.577] (-962.834) (-958.793) (-960.275) * (-965.900) (-962.089) [-960.219] (-963.076) -- 0:00:53
      184500 -- (-964.876) (-959.512) (-959.387) [-959.854] * (-964.638) (-961.033) [-961.951] (-964.411) -- 0:00:53
      185000 -- (-959.618) [-959.974] (-960.980) (-958.510) * (-963.720) [-962.092] (-958.792) (-959.522) -- 0:00:52

      Average standard deviation of split frequencies: 0.013339

      185500 -- [-959.164] (-960.381) (-964.066) (-961.291) * (-960.255) (-960.965) [-959.692] (-962.699) -- 0:00:52
      186000 -- (-959.347) [-959.617] (-961.813) (-959.289) * (-959.557) (-960.003) [-960.175] (-963.945) -- 0:00:52
      186500 -- (-963.710) (-962.367) (-962.341) [-960.971] * (-958.800) [-959.986] (-962.571) (-962.564) -- 0:00:52
      187000 -- (-962.604) (-965.711) [-960.776] (-961.059) * (-960.076) [-960.565] (-961.386) (-963.567) -- 0:00:52
      187500 -- (-961.352) [-959.191] (-961.029) (-958.811) * (-961.542) (-959.726) [-958.875] (-960.032) -- 0:00:52
      188000 -- (-958.748) [-959.067] (-967.135) (-960.696) * (-962.640) [-963.109] (-958.946) (-961.401) -- 0:00:51
      188500 -- (-959.458) [-959.537] (-966.658) (-962.964) * (-962.321) (-963.637) [-959.119] (-960.943) -- 0:00:51
      189000 -- (-960.611) (-964.039) (-961.290) [-961.247] * [-959.976] (-962.863) (-959.646) (-959.516) -- 0:00:51
      189500 -- (-960.403) [-964.215] (-960.771) (-958.996) * [-959.522] (-967.071) (-960.798) (-961.491) -- 0:00:51
      190000 -- (-960.704) (-962.847) [-960.801] (-959.434) * (-959.187) [-964.294] (-963.557) (-961.502) -- 0:00:51

      Average standard deviation of split frequencies: 0.015707

      190500 -- [-961.221] (-961.381) (-960.852) (-958.548) * (-959.849) (-960.172) (-959.345) [-960.885] -- 0:00:50
      191000 -- (-961.287) (-959.668) (-959.633) [-960.058] * (-960.251) (-959.672) (-960.281) [-960.790] -- 0:00:50
      191500 -- (-962.220) [-959.708] (-960.212) (-959.793) * [-960.571] (-960.830) (-959.917) (-960.196) -- 0:00:50
      192000 -- [-961.451] (-958.761) (-960.985) (-962.342) * (-962.138) (-963.757) [-962.475] (-960.254) -- 0:00:50
      192500 -- (-959.503) (-960.578) [-959.554] (-960.356) * [-962.945] (-960.411) (-960.250) (-961.434) -- 0:00:50
      193000 -- (-959.838) (-959.830) [-960.443] (-961.802) * (-959.988) [-961.382] (-960.470) (-961.565) -- 0:00:50
      193500 -- [-959.037] (-961.996) (-961.988) (-960.358) * (-964.169) [-962.293] (-960.028) (-966.418) -- 0:00:50
      194000 -- (-960.928) [-960.602] (-961.123) (-960.755) * (-960.165) (-962.730) (-960.288) [-961.985] -- 0:00:54
      194500 -- (-960.173) (-961.625) [-959.640] (-961.782) * (-963.797) (-960.996) [-958.416] (-962.026) -- 0:00:53
      195000 -- (-960.222) (-959.308) (-959.611) [-960.576] * [-961.608] (-960.786) (-961.922) (-960.669) -- 0:00:53

      Average standard deviation of split frequencies: 0.015064

      195500 -- (-963.838) [-960.996] (-959.173) (-961.996) * (-963.522) [-960.042] (-959.997) (-961.535) -- 0:00:53
      196000 -- [-960.565] (-959.934) (-962.573) (-958.439) * (-960.542) [-961.063] (-959.980) (-958.501) -- 0:00:53
      196500 -- (-959.427) (-964.346) [-961.042] (-959.441) * (-960.417) (-960.388) [-959.223] (-959.054) -- 0:00:53
      197000 -- [-959.747] (-961.836) (-959.993) (-962.286) * (-959.077) (-961.127) (-960.282) [-958.559] -- 0:00:52
      197500 -- (-964.038) [-960.246] (-958.995) (-961.371) * [-958.692] (-958.729) (-959.024) (-960.980) -- 0:00:52
      198000 -- (-958.779) [-961.451] (-959.656) (-959.543) * (-959.711) [-960.875] (-959.626) (-961.454) -- 0:00:52
      198500 -- [-959.231] (-962.383) (-961.497) (-959.803) * (-963.679) (-959.171) [-959.415] (-962.842) -- 0:00:52
      199000 -- (-958.738) (-962.845) (-962.874) [-960.794] * (-959.756) [-959.774] (-959.684) (-959.029) -- 0:00:52
      199500 -- (-959.381) [-958.726] (-959.590) (-962.106) * (-960.895) (-961.090) (-958.588) [-958.385] -- 0:00:52
      200000 -- (-959.342) [-960.503] (-958.777) (-960.436) * (-963.211) [-961.602] (-961.274) (-959.002) -- 0:00:51

      Average standard deviation of split frequencies: 0.015400

      200500 -- [-958.507] (-963.742) (-958.385) (-960.129) * (-960.007) (-961.612) [-962.630] (-959.768) -- 0:00:51
      201000 -- (-960.645) (-959.751) [-960.634] (-960.075) * [-960.415] (-962.229) (-960.751) (-959.039) -- 0:00:51
      201500 -- (-959.332) (-966.695) [-959.723] (-960.199) * [-960.019] (-961.708) (-962.845) (-959.698) -- 0:00:51
      202000 -- (-962.136) [-963.848] (-960.601) (-961.120) * (-961.963) (-962.562) [-961.198] (-959.629) -- 0:00:51
      202500 -- (-959.485) (-960.250) (-961.580) [-958.607] * (-962.396) (-960.515) (-960.313) [-959.055] -- 0:00:51
      203000 -- (-960.000) (-961.213) (-963.295) [-958.497] * (-961.248) [-960.145] (-958.897) (-959.818) -- 0:00:51
      203500 -- (-960.985) [-962.189] (-959.878) (-958.757) * (-959.530) [-958.659] (-958.298) (-959.083) -- 0:00:50
      204000 -- (-961.424) (-962.017) [-959.090] (-959.399) * (-959.839) (-959.154) [-959.918] (-963.191) -- 0:00:50
      204500 -- (-960.673) [-962.070] (-961.759) (-959.653) * (-959.991) [-959.348] (-961.571) (-961.423) -- 0:00:50
      205000 -- [-962.934] (-960.661) (-959.504) (-961.709) * (-961.640) [-960.745] (-961.456) (-961.816) -- 0:00:50

      Average standard deviation of split frequencies: 0.016146

      205500 -- [-959.259] (-961.451) (-959.363) (-960.953) * (-963.204) (-960.520) (-965.307) [-961.303] -- 0:00:50
      206000 -- (-959.354) [-960.783] (-959.889) (-961.580) * (-961.195) [-959.884] (-958.697) (-963.193) -- 0:00:50
      206500 -- (-958.812) [-959.948] (-961.218) (-959.763) * (-959.325) (-960.813) (-960.039) [-961.891] -- 0:00:49
      207000 -- (-958.300) [-961.229] (-966.144) (-962.042) * [-960.023] (-963.316) (-960.610) (-966.353) -- 0:00:49
      207500 -- (-960.907) (-961.412) [-960.447] (-959.169) * (-959.503) (-962.313) (-961.764) [-960.513] -- 0:00:49
      208000 -- (-962.164) (-960.280) [-961.606] (-960.935) * [-959.846] (-959.837) (-958.616) (-962.034) -- 0:00:49
      208500 -- (-959.625) [-960.863] (-959.746) (-962.506) * (-960.678) (-959.468) (-959.047) [-959.340] -- 0:00:49
      209000 -- (-958.595) [-960.232] (-959.099) (-960.465) * (-962.710) [-958.542] (-959.491) (-958.405) -- 0:00:49
      209500 -- (-960.747) (-964.658) [-960.127] (-959.539) * [-961.657] (-959.616) (-959.408) (-958.929) -- 0:00:49
      210000 -- (-959.893) (-963.640) (-960.179) [-967.062] * [-963.347] (-959.352) (-960.825) (-961.010) -- 0:00:52

      Average standard deviation of split frequencies: 0.015539

      210500 -- [-959.113] (-968.423) (-960.419) (-960.809) * (-965.113) (-960.249) (-961.346) [-960.010] -- 0:00:52
      211000 -- (-960.485) (-960.781) (-960.447) [-958.714] * (-962.136) (-964.209) (-961.080) [-959.018] -- 0:00:52
      211500 -- [-959.612] (-959.362) (-960.467) (-959.316) * (-960.003) (-965.127) [-959.136] (-960.652) -- 0:00:52
      212000 -- [-959.332] (-960.567) (-961.843) (-958.508) * [-958.789] (-965.056) (-960.468) (-959.131) -- 0:00:52
      212500 -- (-960.485) (-960.635) (-961.292) [-958.603] * (-961.352) (-968.334) (-962.524) [-962.283] -- 0:00:51
      213000 -- (-958.584) (-961.295) [-960.099] (-959.066) * (-959.270) (-963.022) (-962.313) [-961.279] -- 0:00:51
      213500 -- (-959.380) [-960.521] (-960.186) (-960.346) * (-959.368) (-964.626) (-960.067) [-958.946] -- 0:00:51
      214000 -- [-959.957] (-961.432) (-960.964) (-963.998) * (-962.092) [-964.932] (-960.890) (-960.931) -- 0:00:51
      214500 -- (-958.207) [-961.753] (-962.082) (-960.809) * [-961.292] (-966.314) (-960.566) (-961.540) -- 0:00:51
      215000 -- (-963.970) (-959.884) (-958.311) [-958.993] * [-959.516] (-963.637) (-961.950) (-959.577) -- 0:00:51

      Average standard deviation of split frequencies: 0.015622

      215500 -- [-960.240] (-958.549) (-959.598) (-963.547) * (-959.153) [-960.358] (-960.073) (-960.889) -- 0:00:50
      216000 -- (-958.520) (-964.314) [-962.053] (-965.561) * (-959.535) (-960.166) [-960.939] (-960.595) -- 0:00:50
      216500 -- (-960.083) (-959.180) [-961.762] (-963.805) * (-959.702) [-959.184] (-961.018) (-960.124) -- 0:00:50
      217000 -- (-962.953) [-959.396] (-959.437) (-961.800) * (-959.058) (-959.978) [-960.024] (-959.793) -- 0:00:50
      217500 -- [-962.896] (-959.604) (-960.126) (-959.890) * [-959.982] (-959.729) (-964.040) (-963.095) -- 0:00:50
      218000 -- (-960.719) [-958.661] (-958.348) (-965.239) * (-960.819) [-960.288] (-959.307) (-963.341) -- 0:00:50
      218500 -- (-962.226) [-960.840] (-961.520) (-960.668) * (-962.003) [-959.439] (-960.513) (-967.637) -- 0:00:50
      219000 -- (-959.757) (-961.668) (-960.881) [-960.429] * [-962.323] (-959.395) (-960.983) (-964.119) -- 0:00:49
      219500 -- (-960.872) (-958.504) (-959.644) [-959.655] * (-961.337) [-958.779] (-961.625) (-963.423) -- 0:00:49
      220000 -- (-960.717) (-959.232) (-964.299) [-959.100] * (-962.005) (-960.006) [-961.703] (-960.247) -- 0:00:49

      Average standard deviation of split frequencies: 0.016259

      220500 -- (-961.263) (-960.369) (-963.872) [-960.908] * (-965.309) (-960.854) (-961.125) [-960.801] -- 0:00:49
      221000 -- (-961.962) (-962.263) (-962.433) [-959.894] * (-964.536) (-961.038) (-959.643) [-960.684] -- 0:00:49
      221500 -- (-961.961) (-961.111) [-959.551] (-959.733) * (-965.440) (-961.084) [-958.882] (-959.178) -- 0:00:49
      222000 -- (-958.345) [-958.364] (-963.093) (-963.513) * (-962.085) (-958.965) (-958.614) [-959.406] -- 0:00:49
      222500 -- (-959.101) (-959.327) [-961.851] (-962.444) * (-959.213) [-963.147] (-962.006) (-959.154) -- 0:00:48
      223000 -- (-959.413) (-959.912) [-963.551] (-962.048) * [-959.203] (-959.182) (-961.347) (-959.802) -- 0:00:48
      223500 -- [-959.371] (-964.068) (-960.800) (-958.290) * [-958.508] (-959.371) (-962.695) (-959.019) -- 0:00:48
      224000 -- (-958.896) (-963.993) (-959.669) [-958.354] * (-961.226) (-959.517) (-961.523) [-959.614] -- 0:00:48
      224500 -- (-959.701) [-960.206] (-958.949) (-958.353) * (-961.319) (-961.949) (-961.160) [-960.330] -- 0:00:48
      225000 -- (-962.448) (-960.410) [-959.668] (-959.039) * [-959.701] (-959.565) (-959.829) (-958.706) -- 0:00:48

      Average standard deviation of split frequencies: 0.014833

      225500 -- (-964.332) (-958.762) (-960.233) [-962.125] * [-964.159] (-961.382) (-961.592) (-958.979) -- 0:00:48
      226000 -- (-960.046) [-961.479] (-959.922) (-963.991) * (-960.867) [-958.822] (-959.639) (-959.322) -- 0:00:47
      226500 -- (-959.817) (-960.352) (-960.073) [-962.955] * (-959.524) (-959.663) [-958.757] (-960.762) -- 0:00:51
      227000 -- (-964.742) (-959.625) [-959.753] (-966.184) * (-961.844) (-959.101) [-959.921] (-960.742) -- 0:00:51
      227500 -- (-964.518) (-958.735) (-963.923) [-961.603] * (-959.853) (-959.503) (-959.696) [-959.663] -- 0:00:50
      228000 -- (-959.990) (-958.808) (-960.326) [-960.635] * (-960.287) [-960.834] (-959.211) (-959.823) -- 0:00:50
      228500 -- (-960.054) [-958.917] (-959.613) (-960.434) * (-960.915) (-961.233) [-960.448] (-965.332) -- 0:00:50
      229000 -- (-962.455) [-960.337] (-960.589) (-961.655) * [-959.548] (-961.790) (-962.951) (-963.469) -- 0:00:50
      229500 -- (-963.545) [-960.856] (-958.642) (-962.227) * (-959.413) [-964.415] (-966.203) (-960.363) -- 0:00:50
      230000 -- [-959.123] (-965.803) (-959.711) (-962.943) * [-959.722] (-963.040) (-960.121) (-958.381) -- 0:00:50

      Average standard deviation of split frequencies: 0.015100

      230500 -- [-958.774] (-961.085) (-960.279) (-964.523) * [-959.277] (-960.420) (-959.103) (-959.569) -- 0:00:50
      231000 -- (-959.873) [-959.568] (-964.576) (-964.212) * (-960.278) (-962.357) (-961.422) [-958.959] -- 0:00:49
      231500 -- (-959.255) (-961.195) (-961.079) [-960.735] * (-959.479) [-961.004] (-962.227) (-959.785) -- 0:00:49
      232000 -- (-960.548) (-959.949) [-961.167] (-958.859) * [-959.563] (-959.974) (-958.872) (-961.058) -- 0:00:49
      232500 -- (-960.360) [-958.969] (-959.702) (-959.123) * [-959.123] (-963.228) (-959.858) (-961.783) -- 0:00:49
      233000 -- (-959.264) (-960.784) [-960.541] (-959.145) * [-961.757] (-961.324) (-959.117) (-960.056) -- 0:00:49
      233500 -- (-960.160) (-958.739) [-958.349] (-962.508) * (-959.960) (-961.883) (-962.261) [-959.735] -- 0:00:49
      234000 -- (-960.842) [-960.643] (-958.380) (-962.724) * (-959.887) [-959.732] (-961.743) (-960.207) -- 0:00:49
      234500 -- (-958.850) (-962.005) [-958.666] (-961.513) * [-962.198] (-960.837) (-960.658) (-958.592) -- 0:00:48
      235000 -- (-958.558) (-961.100) [-958.653] (-961.745) * (-961.137) (-961.783) [-961.618] (-959.870) -- 0:00:48

      Average standard deviation of split frequencies: 0.014981

      235500 -- [-960.501] (-963.099) (-958.674) (-961.820) * (-959.975) (-961.528) (-961.283) [-958.982] -- 0:00:48
      236000 -- (-961.616) (-962.609) [-959.124] (-961.924) * [-965.585] (-971.119) (-963.955) (-959.855) -- 0:00:48
      236500 -- [-960.938] (-963.196) (-960.172) (-960.859) * (-959.579) [-961.470] (-962.818) (-961.661) -- 0:00:48
      237000 -- (-963.918) (-963.016) [-959.002] (-960.756) * (-960.123) (-963.345) (-961.535) [-959.846] -- 0:00:48
      237500 -- (-963.249) (-962.177) (-959.388) [-961.122] * (-961.770) [-959.603] (-963.144) (-961.113) -- 0:00:48
      238000 -- (-961.830) (-960.714) [-960.247] (-962.518) * [-959.231] (-963.340) (-962.768) (-959.734) -- 0:00:48
      238500 -- [-959.338] (-959.670) (-958.402) (-958.944) * (-960.695) (-964.569) (-963.917) [-958.612] -- 0:00:47
      239000 -- [-960.089] (-959.315) (-958.838) (-960.595) * (-962.281) (-960.537) (-961.864) [-959.473] -- 0:00:47
      239500 -- (-959.459) (-959.684) [-958.841] (-960.372) * (-962.811) (-959.471) [-960.487] (-962.136) -- 0:00:47
      240000 -- (-960.252) (-960.794) [-959.056] (-959.598) * (-963.231) (-958.726) [-962.015] (-961.315) -- 0:00:47

      Average standard deviation of split frequencies: 0.014633

      240500 -- (-960.571) (-959.533) [-959.133] (-962.380) * (-960.523) (-962.966) (-963.901) [-960.646] -- 0:00:47
      241000 -- [-960.239] (-960.330) (-958.980) (-961.549) * (-964.908) (-960.379) [-960.180] (-960.537) -- 0:00:47
      241500 -- (-960.588) (-960.331) [-959.355] (-961.848) * (-964.682) [-959.625] (-961.737) (-958.986) -- 0:00:47
      242000 -- (-961.170) (-959.818) [-958.877] (-959.769) * (-958.708) (-960.825) [-963.891] (-959.614) -- 0:00:46
      242500 -- (-958.734) (-960.061) [-962.007] (-961.591) * (-961.822) (-959.198) (-960.495) [-961.858] -- 0:00:46
      243000 -- (-959.954) (-960.772) [-959.651] (-961.649) * [-960.282] (-959.286) (-963.481) (-965.016) -- 0:00:46
      243500 -- (-963.667) (-962.706) [-960.420] (-958.624) * [-960.130] (-961.280) (-962.304) (-960.680) -- 0:00:49
      244000 -- [-959.366] (-964.806) (-958.984) (-959.557) * [-961.249] (-962.152) (-959.700) (-960.165) -- 0:00:49
      244500 -- (-962.656) (-964.728) [-961.733] (-962.724) * [-960.255] (-962.801) (-962.252) (-958.312) -- 0:00:49
      245000 -- [-963.802] (-966.361) (-961.703) (-960.022) * (-961.906) [-963.653] (-960.291) (-959.322) -- 0:00:49

      Average standard deviation of split frequencies: 0.013918

      245500 -- (-961.296) (-964.072) (-962.097) [-962.311] * (-960.579) (-960.006) [-960.992] (-960.968) -- 0:00:49
      246000 -- (-960.249) [-959.366] (-959.043) (-960.274) * [-960.325] (-959.781) (-959.125) (-959.826) -- 0:00:49
      246500 -- (-963.056) (-959.759) [-961.487] (-962.053) * (-959.747) [-958.307] (-959.888) (-960.924) -- 0:00:48
      247000 -- [-959.666] (-959.055) (-961.896) (-963.330) * [-960.488] (-959.648) (-958.855) (-959.777) -- 0:00:48
      247500 -- (-960.009) [-958.280] (-959.230) (-960.727) * (-958.661) [-963.716] (-958.374) (-959.091) -- 0:00:48
      248000 -- (-960.074) (-959.169) [-960.838] (-963.743) * (-958.238) [-959.246] (-958.587) (-958.979) -- 0:00:48
      248500 -- (-960.042) (-959.343) [-959.001] (-963.018) * (-958.198) [-961.132] (-958.586) (-960.033) -- 0:00:48
      249000 -- (-961.236) (-958.910) (-959.822) [-959.009] * (-958.877) [-959.838] (-959.398) (-960.443) -- 0:00:48
      249500 -- [-959.168] (-958.946) (-958.609) (-962.464) * [-959.622] (-965.871) (-960.255) (-959.385) -- 0:00:48
      250000 -- (-967.526) [-960.122] (-960.176) (-965.715) * (-958.853) (-960.601) [-960.695] (-961.324) -- 0:00:48

      Average standard deviation of split frequencies: 0.015441

      250500 -- (-960.620) (-960.356) [-960.456] (-960.061) * [-960.330] (-959.747) (-960.522) (-958.776) -- 0:00:47
      251000 -- (-963.362) [-961.280] (-960.524) (-962.143) * (-959.220) (-960.808) (-960.468) [-959.813] -- 0:00:47
      251500 -- (-960.953) [-960.343] (-965.044) (-963.768) * (-958.225) (-961.293) (-960.339) [-960.694] -- 0:00:47
      252000 -- (-959.047) (-959.841) (-963.816) [-959.670] * (-958.953) (-959.137) [-961.176] (-962.158) -- 0:00:47
      252500 -- (-959.990) (-959.196) [-961.978] (-960.661) * (-958.757) (-961.080) [-960.488] (-960.436) -- 0:00:47
      253000 -- [-958.692] (-958.392) (-967.531) (-960.771) * (-960.193) (-964.054) (-963.255) [-961.214] -- 0:00:47
      253500 -- (-958.658) [-960.980] (-966.096) (-958.484) * [-959.560] (-963.871) (-962.225) (-961.019) -- 0:00:47
      254000 -- [-958.726] (-959.450) (-964.877) (-958.262) * (-965.846) (-961.790) [-960.495] (-963.074) -- 0:00:46
      254500 -- (-958.648) (-959.205) [-961.056] (-959.245) * (-960.729) (-960.285) (-959.897) [-961.622] -- 0:00:46
      255000 -- (-959.504) (-963.547) (-961.495) [-959.355] * (-958.828) (-964.167) [-958.745] (-959.085) -- 0:00:46

      Average standard deviation of split frequencies: 0.014247

      255500 -- (-960.234) (-961.710) [-958.460] (-959.786) * (-962.608) (-966.984) [-961.510] (-958.579) -- 0:00:46
      256000 -- (-961.098) [-964.326] (-960.131) (-959.825) * (-960.337) (-961.684) (-961.360) [-960.511] -- 0:00:46
      256500 -- (-961.703) (-960.011) (-961.079) [-959.778] * [-959.584] (-959.555) (-960.494) (-960.941) -- 0:00:46
      257000 -- (-962.284) [-961.364] (-960.580) (-960.842) * (-958.976) [-961.930] (-962.424) (-960.751) -- 0:00:46
      257500 -- (-960.147) (-961.801) (-960.689) [-958.852] * (-959.577) [-960.321] (-963.841) (-959.032) -- 0:00:46
      258000 -- (-963.897) (-962.704) (-964.543) [-962.447] * (-961.594) [-960.179] (-960.546) (-960.602) -- 0:00:46
      258500 -- (-962.055) (-963.024) (-964.849) [-960.084] * [-961.352] (-959.245) (-960.758) (-959.934) -- 0:00:45
      259000 -- [-959.827] (-964.810) (-968.688) (-958.977) * (-961.392) (-960.831) (-959.460) [-959.858] -- 0:00:45
      259500 -- (-959.825) [-960.792] (-960.553) (-962.708) * (-962.459) (-964.861) [-959.208] (-958.731) -- 0:00:45
      260000 -- (-960.962) (-961.329) [-962.511] (-959.616) * (-960.482) [-962.449] (-959.271) (-958.582) -- 0:00:48

      Average standard deviation of split frequencies: 0.014087

      260500 -- [-960.877] (-963.795) (-962.975) (-959.764) * [-959.500] (-964.172) (-961.470) (-959.765) -- 0:00:48
      261000 -- (-961.180) (-964.141) (-960.032) [-958.611] * (-962.420) [-960.603] (-960.644) (-962.194) -- 0:00:48
      261500 -- [-961.286] (-961.021) (-959.935) (-964.630) * [-959.507] (-960.448) (-961.198) (-961.277) -- 0:00:48
      262000 -- (-959.791) [-958.941] (-960.192) (-959.125) * (-959.778) (-958.601) [-959.255] (-959.256) -- 0:00:47
      262500 -- (-959.577) [-960.504] (-962.253) (-959.347) * (-961.932) (-959.485) [-958.399] (-961.585) -- 0:00:47
      263000 -- [-963.298] (-962.328) (-961.152) (-962.242) * (-960.045) (-961.696) (-959.631) [-963.914] -- 0:00:47
      263500 -- (-963.043) [-960.211] (-959.141) (-959.057) * (-958.367) [-960.322] (-960.020) (-963.636) -- 0:00:47
      264000 -- (-961.721) (-960.863) (-960.454) [-958.845] * (-959.589) [-960.235] (-960.021) (-963.192) -- 0:00:47
      264500 -- (-960.322) (-959.536) [-961.527] (-960.754) * [-959.613] (-959.738) (-958.737) (-961.762) -- 0:00:47
      265000 -- (-960.060) (-959.381) [-963.832] (-960.220) * [-959.506] (-959.828) (-958.952) (-959.193) -- 0:00:47

      Average standard deviation of split frequencies: 0.013646

      265500 -- (-964.991) (-959.560) (-959.807) [-962.751] * (-960.244) [-961.223] (-958.593) (-961.124) -- 0:00:47
      266000 -- [-959.410] (-960.429) (-960.870) (-962.661) * [-963.454] (-959.441) (-959.080) (-959.078) -- 0:00:46
      266500 -- [-961.802] (-961.399) (-960.297) (-961.864) * [-961.310] (-960.538) (-959.470) (-959.224) -- 0:00:46
      267000 -- (-960.635) (-960.280) [-960.388] (-962.986) * (-962.371) (-963.927) (-959.259) [-958.850] -- 0:00:46
      267500 -- (-960.414) [-959.354] (-966.331) (-959.175) * (-963.398) (-964.966) (-964.959) [-958.420] -- 0:00:46
      268000 -- (-959.744) (-960.785) [-961.481] (-961.077) * [-959.956] (-964.035) (-962.574) (-960.243) -- 0:00:46
      268500 -- (-960.459) [-959.378] (-960.866) (-961.874) * (-959.509) (-960.958) [-961.184] (-961.493) -- 0:00:46
      269000 -- [-959.418] (-959.597) (-960.714) (-960.582) * [-959.369] (-960.882) (-960.958) (-960.614) -- 0:00:46
      269500 -- (-963.519) (-959.354) (-961.850) [-960.539] * (-962.113) (-959.461) [-960.955] (-963.501) -- 0:00:46
      270000 -- (-959.523) (-959.449) (-961.826) [-960.589] * (-960.171) [-961.420] (-960.873) (-961.812) -- 0:00:45

      Average standard deviation of split frequencies: 0.013062

      270500 -- (-959.941) (-959.179) (-963.719) [-962.729] * [-959.637] (-961.561) (-964.978) (-960.650) -- 0:00:45
      271000 -- [-961.840] (-959.691) (-959.924) (-964.486) * (-959.798) (-961.110) [-960.530] (-959.175) -- 0:00:45
      271500 -- (-962.532) (-961.180) [-962.235] (-965.336) * (-960.133) (-962.138) [-959.399] (-959.322) -- 0:00:45
      272000 -- (-961.313) (-960.199) (-962.518) [-961.082] * (-960.257) (-962.342) [-958.570] (-960.283) -- 0:00:45
      272500 -- (-961.375) (-958.613) [-961.893] (-961.600) * (-960.334) (-958.300) (-958.606) [-958.959] -- 0:00:45
      273000 -- (-960.174) (-959.197) (-959.378) [-959.900] * (-960.876) [-958.306] (-960.224) (-959.337) -- 0:00:45
      273500 -- (-961.119) (-959.152) [-961.157] (-960.996) * (-962.072) (-959.616) [-959.280] (-959.762) -- 0:00:45
      274000 -- (-963.123) (-960.037) [-962.281] (-963.382) * (-960.348) (-961.565) (-960.968) [-958.674] -- 0:00:45
      274500 -- [-959.219] (-965.484) (-961.379) (-961.434) * (-962.119) (-963.528) [-959.397] (-960.252) -- 0:00:44
      275000 -- (-963.040) [-962.570] (-959.342) (-963.997) * [-961.379] (-963.591) (-960.388) (-961.873) -- 0:00:44

      Average standard deviation of split frequencies: 0.012315

      275500 -- (-959.252) (-963.549) [-959.177] (-963.885) * (-960.794) [-960.539] (-959.519) (-960.322) -- 0:00:44
      276000 -- [-959.451] (-963.936) (-960.369) (-959.876) * (-961.768) (-959.283) (-959.369) [-959.736] -- 0:00:47
      276500 -- [-960.141] (-958.748) (-959.639) (-958.823) * (-960.847) (-959.298) [-959.099] (-960.790) -- 0:00:47
      277000 -- [-960.139] (-961.457) (-962.402) (-958.824) * (-961.993) [-960.397] (-959.147) (-960.810) -- 0:00:46
      277500 -- (-962.967) (-962.522) (-960.451) [-960.052] * (-961.733) (-959.082) (-960.290) [-960.833] -- 0:00:46
      278000 -- (-963.048) (-959.300) [-958.750] (-959.751) * (-959.330) (-960.674) [-958.822] (-961.464) -- 0:00:46
      278500 -- [-960.717] (-967.926) (-958.750) (-959.807) * (-961.657) (-963.744) [-958.822] (-962.634) -- 0:00:46
      279000 -- [-959.867] (-964.463) (-961.409) (-959.806) * (-959.340) (-958.945) (-961.228) [-961.817] -- 0:00:46
      279500 -- [-959.470] (-960.110) (-960.988) (-962.046) * (-959.282) [-962.212] (-962.476) (-959.321) -- 0:00:46
      280000 -- (-959.553) (-960.994) [-960.124] (-960.998) * [-958.954] (-961.075) (-961.305) (-958.879) -- 0:00:46

      Average standard deviation of split frequencies: 0.012765

      280500 -- [-959.577] (-961.166) (-960.370) (-960.043) * (-959.650) [-959.147] (-958.640) (-961.586) -- 0:00:46
      281000 -- (-959.279) [-960.557] (-961.021) (-961.374) * (-958.985) (-959.820) [-959.484] (-960.205) -- 0:00:46
      281500 -- (-959.636) [-960.282] (-960.902) (-961.286) * (-959.411) [-962.493] (-962.038) (-964.425) -- 0:00:45
      282000 -- (-958.583) [-958.991] (-961.080) (-961.748) * (-963.694) (-958.587) (-960.097) [-962.731] -- 0:00:45
      282500 -- (-959.835) [-959.815] (-958.838) (-959.798) * (-959.841) (-961.030) [-965.666] (-962.306) -- 0:00:45
      283000 -- (-960.770) (-963.766) (-961.399) [-959.223] * (-958.689) (-965.150) (-959.510) [-960.317] -- 0:00:45
      283500 -- (-960.455) [-967.989] (-960.476) (-960.769) * (-962.021) (-958.971) (-960.982) [-958.640] -- 0:00:45
      284000 -- [-958.943] (-962.655) (-961.292) (-959.061) * (-959.427) (-960.549) (-960.105) [-959.133] -- 0:00:45
      284500 -- (-961.413) [-960.586] (-960.057) (-960.441) * (-959.670) [-959.802] (-959.933) (-959.576) -- 0:00:45
      285000 -- [-959.260] (-958.470) (-958.915) (-967.674) * (-959.766) [-959.521] (-959.343) (-961.430) -- 0:00:45

      Average standard deviation of split frequencies: 0.010961

      285500 -- (-959.811) [-961.356] (-958.814) (-961.149) * (-959.569) (-961.829) (-959.671) [-959.434] -- 0:00:45
      286000 -- [-959.529] (-962.488) (-959.985) (-963.056) * (-962.195) (-959.579) (-960.217) [-959.272] -- 0:00:44
      286500 -- (-960.388) (-959.107) (-963.565) [-962.177] * [-960.886] (-959.764) (-958.424) (-958.516) -- 0:00:44
      287000 -- (-961.282) [-958.409] (-962.241) (-963.794) * (-959.682) (-959.603) (-958.995) [-959.137] -- 0:00:44
      287500 -- [-961.248] (-962.593) (-963.593) (-960.728) * (-959.236) (-958.923) (-960.239) [-959.103] -- 0:00:44
      288000 -- (-961.442) (-961.634) [-960.342] (-964.343) * (-960.648) (-960.047) (-960.247) [-960.835] -- 0:00:44
      288500 -- (-962.830) (-960.949) (-958.727) [-961.364] * (-962.857) (-958.524) (-961.932) [-958.943] -- 0:00:44
      289000 -- (-958.970) [-962.375] (-958.699) (-962.094) * (-958.992) [-959.415] (-962.822) (-958.218) -- 0:00:44
      289500 -- (-959.367) [-960.063] (-960.448) (-959.417) * [-958.799] (-963.054) (-963.894) (-958.517) -- 0:00:44
      290000 -- (-961.850) [-961.650] (-960.446) (-960.511) * [-960.065] (-966.606) (-961.949) (-959.606) -- 0:00:44

      Average standard deviation of split frequencies: 0.010840

      290500 -- [-960.973] (-959.768) (-960.743) (-958.632) * (-959.859) [-960.835] (-964.912) (-960.109) -- 0:00:43
      291000 -- [-962.734] (-960.457) (-960.497) (-961.237) * (-961.009) [-960.851] (-963.078) (-958.721) -- 0:00:43
      291500 -- (-959.699) (-960.508) (-959.440) [-961.856] * (-960.925) (-963.885) [-959.396] (-961.800) -- 0:00:43
      292000 -- [-961.544] (-962.925) (-959.498) (-960.073) * [-960.979] (-962.035) (-960.167) (-962.947) -- 0:00:43
      292500 -- (-960.298) (-958.760) (-960.425) [-959.066] * (-960.650) (-958.256) (-960.089) [-964.380] -- 0:00:43
      293000 -- [-958.602] (-964.220) (-959.657) (-960.502) * (-959.971) (-962.198) [-960.091] (-958.721) -- 0:00:45
      293500 -- (-959.129) (-962.487) [-958.862] (-962.479) * (-960.267) (-958.344) (-961.320) [-964.203] -- 0:00:45
      294000 -- [-959.068] (-961.881) (-961.317) (-959.190) * (-959.084) (-960.205) (-963.702) [-960.658] -- 0:00:45
      294500 -- (-961.557) (-961.697) [-961.366] (-959.294) * (-960.547) (-958.323) [-960.591] (-959.843) -- 0:00:45
      295000 -- (-965.823) [-960.480] (-961.757) (-960.838) * (-960.046) [-960.040] (-960.449) (-960.732) -- 0:00:45

      Average standard deviation of split frequencies: 0.011064

      295500 -- [-962.668] (-962.396) (-962.442) (-958.570) * (-960.718) [-960.565] (-961.896) (-961.053) -- 0:00:45
      296000 -- (-963.207) [-959.207] (-958.733) (-960.371) * (-960.911) (-960.123) (-959.033) [-961.464] -- 0:00:45
      296500 -- (-960.681) (-959.219) (-961.677) [-960.657] * (-959.114) [-959.679] (-959.020) (-960.114) -- 0:00:45
      297000 -- (-959.989) [-960.032] (-960.733) (-964.977) * [-958.820] (-959.865) (-961.022) (-963.111) -- 0:00:44
      297500 -- (-958.036) [-960.310] (-959.440) (-959.885) * (-960.362) [-958.891] (-960.913) (-961.614) -- 0:00:44
      298000 -- (-959.074) (-960.552) [-959.413] (-962.309) * (-962.394) (-959.846) [-959.619] (-959.338) -- 0:00:44
      298500 -- [-960.498] (-961.251) (-959.432) (-962.653) * (-960.411) (-961.882) (-959.782) [-961.248] -- 0:00:44
      299000 -- [-962.060] (-962.841) (-960.528) (-964.277) * (-961.252) (-959.757) (-959.422) [-960.124] -- 0:00:44
      299500 -- (-958.462) (-960.970) [-958.936] (-960.283) * (-961.368) (-962.192) [-959.486] (-960.953) -- 0:00:44
      300000 -- (-958.579) [-964.663] (-959.273) (-965.229) * (-964.586) (-960.602) [-959.075] (-959.426) -- 0:00:44

      Average standard deviation of split frequencies: 0.011965

      300500 -- (-961.063) [-960.060] (-962.357) (-961.628) * [-959.004] (-960.391) (-959.710) (-962.397) -- 0:00:44
      301000 -- [-960.766] (-962.562) (-961.227) (-960.791) * (-960.452) (-960.609) [-961.437] (-961.161) -- 0:00:44
      301500 -- (-960.809) (-959.830) (-961.436) [-958.997] * (-959.764) [-958.353] (-960.734) (-961.412) -- 0:00:44
      302000 -- [-959.523] (-961.363) (-961.781) (-965.543) * (-960.661) [-959.134] (-961.540) (-959.942) -- 0:00:43
      302500 -- [-964.951] (-961.457) (-961.231) (-963.332) * [-959.925] (-960.327) (-961.741) (-959.494) -- 0:00:43
      303000 -- (-962.750) [-959.610] (-960.798) (-960.022) * [-962.942] (-964.425) (-959.331) (-958.641) -- 0:00:43
      303500 -- [-960.164] (-961.041) (-961.266) (-960.912) * (-961.617) (-964.781) [-958.591] (-958.692) -- 0:00:43
      304000 -- [-958.751] (-962.336) (-963.690) (-961.051) * (-965.387) (-960.062) (-958.588) [-959.201] -- 0:00:43
      304500 -- (-958.763) (-958.778) (-962.964) [-958.392] * (-964.794) (-962.282) (-959.164) [-959.410] -- 0:00:43
      305000 -- (-958.172) (-959.169) (-964.361) [-959.715] * (-959.289) (-959.233) [-960.685] (-963.546) -- 0:00:43

      Average standard deviation of split frequencies: 0.012892

      305500 -- (-958.628) [-960.965] (-962.907) (-959.113) * [-960.222] (-961.452) (-963.202) (-958.361) -- 0:00:43
      306000 -- (-959.674) (-961.217) (-963.591) [-958.719] * (-958.225) (-958.761) (-960.040) [-963.127] -- 0:00:43
      306500 -- (-962.029) (-958.312) [-959.550] (-959.562) * (-958.900) [-958.602] (-959.684) (-963.293) -- 0:00:42
      307000 -- (-958.750) [-958.782] (-959.827) (-962.082) * (-959.082) [-960.047] (-960.706) (-965.428) -- 0:00:42
      307500 -- (-958.195) (-961.317) (-961.398) [-960.412] * (-961.030) [-963.382] (-961.576) (-961.421) -- 0:00:42
      308000 -- (-960.422) (-962.663) (-960.891) [-962.527] * (-962.744) [-959.646] (-960.463) (-962.059) -- 0:00:42
      308500 -- (-959.045) (-966.021) [-959.775] (-962.331) * (-960.640) (-963.811) (-960.463) [-960.213] -- 0:00:42
      309000 -- (-959.932) (-962.170) [-960.640] (-964.485) * (-962.826) [-961.047] (-961.242) (-964.652) -- 0:00:42
      309500 -- [-962.451] (-960.009) (-961.586) (-960.370) * (-961.982) (-961.607) [-960.172] (-962.680) -- 0:00:44
      310000 -- (-961.805) (-959.952) (-960.323) [-961.500] * (-962.152) (-962.868) [-960.183] (-962.626) -- 0:00:44

      Average standard deviation of split frequencies: 0.011820

      310500 -- [-963.218] (-961.572) (-960.494) (-959.865) * (-961.420) (-960.666) [-960.011] (-961.135) -- 0:00:44
      311000 -- (-958.353) [-961.624] (-960.168) (-966.768) * [-964.514] (-958.862) (-962.750) (-959.447) -- 0:00:44
      311500 -- (-960.868) (-962.404) [-962.329] (-962.212) * (-960.671) (-960.533) (-966.071) [-960.758] -- 0:00:44
      312000 -- (-963.044) [-963.682] (-961.103) (-961.852) * (-961.682) (-964.727) (-958.906) [-962.237] -- 0:00:44
      312500 -- (-959.300) (-963.331) [-959.851] (-959.289) * [-960.387] (-961.283) (-960.341) (-960.147) -- 0:00:44
      313000 -- (-961.642) (-962.301) [-958.262] (-960.110) * [-961.611] (-962.529) (-960.059) (-960.681) -- 0:00:43
      313500 -- (-959.482) [-961.289] (-959.111) (-963.223) * (-962.320) (-959.404) (-962.754) [-961.451] -- 0:00:43
      314000 -- (-959.982) (-960.939) (-963.657) [-960.982] * [-959.147] (-959.482) (-958.398) (-965.464) -- 0:00:43
      314500 -- (-958.483) (-963.223) [-961.005] (-961.114) * (-961.718) (-961.593) (-960.276) [-960.871] -- 0:00:43
      315000 -- [-958.208] (-958.804) (-962.692) (-962.318) * (-959.622) [-959.997] (-960.431) (-960.328) -- 0:00:43

      Average standard deviation of split frequencies: 0.011777

      315500 -- [-961.655] (-958.612) (-961.656) (-962.808) * [-959.995] (-959.400) (-958.159) (-959.162) -- 0:00:43
      316000 -- (-959.163) [-959.112] (-965.279) (-962.759) * (-960.329) [-958.981] (-959.132) (-960.990) -- 0:00:43
      316500 -- (-961.794) [-960.927] (-961.628) (-959.610) * [-959.361] (-959.753) (-959.286) (-960.926) -- 0:00:43
      317000 -- (-959.415) (-960.493) (-961.833) [-960.484] * (-960.372) [-960.118] (-961.290) (-959.470) -- 0:00:43
      317500 -- (-959.709) [-959.293] (-962.063) (-965.793) * (-960.622) (-960.112) (-961.995) [-960.262] -- 0:00:42
      318000 -- [-963.123] (-959.797) (-959.389) (-963.103) * (-960.625) [-959.797] (-962.440) (-959.130) -- 0:00:42
      318500 -- (-962.726) (-964.339) (-959.863) [-960.542] * (-962.987) (-958.955) (-960.541) [-961.881] -- 0:00:42
      319000 -- [-961.931] (-959.971) (-966.737) (-958.963) * (-967.974) (-958.982) (-960.815) [-959.382] -- 0:00:42
      319500 -- (-961.624) [-960.344] (-959.531) (-959.236) * (-959.726) [-960.593] (-964.024) (-960.709) -- 0:00:42
      320000 -- (-965.483) (-959.877) (-959.596) [-959.030] * (-961.547) (-963.296) [-959.580] (-969.936) -- 0:00:42

      Average standard deviation of split frequencies: 0.010600

      320500 -- (-968.227) [-958.569] (-958.977) (-958.737) * (-961.327) [-961.430] (-960.400) (-959.821) -- 0:00:42
      321000 -- (-961.147) (-959.821) [-958.433] (-959.588) * (-960.631) (-959.988) (-961.166) [-959.494] -- 0:00:42
      321500 -- (-959.764) [-959.889] (-960.925) (-959.086) * (-962.058) [-958.854] (-962.864) (-964.567) -- 0:00:42
      322000 -- (-960.938) [-959.487] (-965.190) (-963.730) * (-959.947) [-960.238] (-963.719) (-959.309) -- 0:00:42
      322500 -- (-960.103) (-958.628) (-961.788) [-959.186] * (-960.163) (-963.820) (-961.283) [-959.944] -- 0:00:42
      323000 -- (-958.461) (-959.074) [-959.850] (-959.271) * (-960.536) [-958.360] (-960.990) (-960.118) -- 0:00:41
      323500 -- [-958.777] (-960.042) (-959.423) (-961.551) * (-960.856) [-958.265] (-962.477) (-958.316) -- 0:00:41
      324000 -- (-960.483) (-960.726) (-959.524) [-962.313] * (-959.474) (-960.165) [-959.183] (-960.306) -- 0:00:41
      324500 -- (-962.039) (-960.287) (-962.583) [-959.036] * (-966.142) [-959.976] (-962.185) (-966.307) -- 0:00:41
      325000 -- (-962.660) (-959.082) [-964.225] (-961.681) * (-962.023) (-963.454) [-960.630] (-965.920) -- 0:00:41

      Average standard deviation of split frequencies: 0.011188

      325500 -- (-959.270) [-959.379] (-963.285) (-967.841) * (-963.046) (-964.151) (-959.493) [-963.600] -- 0:00:41
      326000 -- [-964.363] (-959.295) (-958.699) (-966.501) * [-963.502] (-964.372) (-962.605) (-965.453) -- 0:00:43
      326500 -- (-958.600) (-958.928) [-958.490] (-963.284) * [-960.518] (-959.465) (-961.393) (-961.564) -- 0:00:43
      327000 -- (-959.123) [-962.281] (-958.471) (-960.450) * (-960.519) [-959.151] (-960.248) (-960.579) -- 0:00:43
      327500 -- [-958.869] (-963.360) (-960.219) (-960.185) * (-959.453) (-960.942) (-962.239) [-959.206] -- 0:00:43
      328000 -- (-959.750) (-962.885) (-959.632) [-959.360] * (-968.030) [-961.218] (-959.638) (-962.606) -- 0:00:43
      328500 -- (-960.686) (-960.449) [-959.534] (-958.737) * [-962.194] (-961.723) (-962.754) (-961.289) -- 0:00:42
      329000 -- (-960.705) (-961.753) (-961.120) [-962.189] * [-958.989] (-959.812) (-964.206) (-960.923) -- 0:00:42
      329500 -- [-959.801] (-960.321) (-958.697) (-960.563) * [-959.799] (-961.222) (-958.883) (-960.903) -- 0:00:42
      330000 -- (-962.625) (-959.899) [-961.019] (-958.359) * (-960.183) (-963.664) [-959.724] (-960.349) -- 0:00:42

      Average standard deviation of split frequencies: 0.010851

      330500 -- (-959.537) (-962.286) (-959.418) [-960.218] * [-958.848] (-964.586) (-959.046) (-964.587) -- 0:00:42
      331000 -- [-961.596] (-962.186) (-965.822) (-961.180) * [-961.908] (-960.956) (-958.890) (-962.292) -- 0:00:42
      331500 -- (-962.759) [-962.985] (-964.368) (-959.441) * [-960.596] (-960.193) (-960.039) (-961.302) -- 0:00:42
      332000 -- (-960.137) (-958.658) (-959.776) [-958.936] * (-962.543) (-960.075) [-959.033] (-959.601) -- 0:00:42
      332500 -- (-963.251) (-958.713) (-963.447) [-958.493] * (-962.051) (-959.917) [-961.306] (-960.006) -- 0:00:42
      333000 -- (-960.224) [-958.874] (-959.884) (-961.010) * (-959.166) (-960.901) [-958.946] (-958.068) -- 0:00:42
      333500 -- (-958.752) (-958.908) [-960.733] (-959.387) * (-961.073) [-960.244] (-963.130) (-959.228) -- 0:00:41
      334000 -- (-962.729) (-961.270) [-959.236] (-962.126) * (-964.977) (-959.464) (-959.427) [-961.213] -- 0:00:41
      334500 -- (-964.659) (-964.899) (-959.080) [-961.762] * (-959.860) [-959.245] (-961.092) (-968.703) -- 0:00:41
      335000 -- (-965.895) (-961.735) (-961.289) [-959.974] * (-961.749) [-962.582] (-960.478) (-964.043) -- 0:00:41

      Average standard deviation of split frequencies: 0.011925

      335500 -- (-961.953) [-965.982] (-961.958) (-960.527) * (-961.691) (-962.253) [-960.977] (-967.983) -- 0:00:41
      336000 -- (-959.560) (-960.146) (-960.827) [-958.579] * [-961.857] (-960.340) (-961.130) (-962.228) -- 0:00:41
      336500 -- (-961.884) (-963.136) [-959.803] (-960.070) * [-961.685] (-958.802) (-959.236) (-966.009) -- 0:00:41
      337000 -- (-962.407) (-960.101) [-959.284] (-958.749) * (-960.971) (-958.723) [-961.378] (-964.264) -- 0:00:41
      337500 -- (-959.584) (-961.449) (-959.930) [-958.083] * (-964.569) (-958.149) (-967.224) [-959.204] -- 0:00:41
      338000 -- (-960.895) (-965.918) [-962.852] (-962.771) * (-964.709) (-959.213) (-959.081) [-962.437] -- 0:00:41
      338500 -- (-962.804) [-963.053] (-962.751) (-960.249) * (-960.933) (-958.442) (-958.953) [-960.731] -- 0:00:41
      339000 -- (-960.130) [-959.572] (-963.122) (-960.183) * [-962.174] (-962.863) (-965.175) (-962.097) -- 0:00:40
      339500 -- (-960.677) [-958.516] (-961.115) (-960.024) * [-960.576] (-959.639) (-959.794) (-958.874) -- 0:00:40
      340000 -- (-963.725) (-960.559) (-962.456) [-959.106] * (-960.365) (-961.240) (-958.899) [-959.088] -- 0:00:40

      Average standard deviation of split frequencies: 0.012070

      340500 -- (-963.575) [-961.702] (-963.525) (-961.143) * [-959.748] (-961.113) (-958.555) (-965.056) -- 0:00:40
      341000 -- [-962.219] (-963.287) (-960.751) (-958.938) * [-959.813] (-959.278) (-963.332) (-961.737) -- 0:00:40
      341500 -- [-960.605] (-960.016) (-960.394) (-959.536) * (-961.181) [-959.204] (-962.427) (-963.047) -- 0:00:40
      342000 -- (-961.815) (-961.429) [-959.041] (-959.216) * (-960.842) [-959.627] (-962.229) (-963.029) -- 0:00:40
      342500 -- (-962.191) (-960.335) [-958.920] (-958.405) * (-961.582) (-959.124) (-959.416) [-960.330] -- 0:00:42
      343000 -- (-961.756) [-960.229] (-959.325) (-962.262) * (-960.949) (-960.429) [-960.877] (-958.438) -- 0:00:42
      343500 -- (-962.138) [-961.452] (-963.443) (-961.672) * [-962.203] (-958.978) (-960.789) (-958.328) -- 0:00:42
      344000 -- (-962.126) (-961.681) (-963.442) [-960.345] * (-959.078) (-961.523) (-961.082) [-961.557] -- 0:00:41
      344500 -- [-962.524] (-960.005) (-959.454) (-960.117) * [-959.829] (-960.533) (-961.666) (-959.689) -- 0:00:41
      345000 -- (-964.758) (-959.801) [-960.967] (-960.091) * (-959.454) [-958.969] (-963.743) (-960.683) -- 0:00:41

      Average standard deviation of split frequencies: 0.012692

      345500 -- (-960.271) (-960.681) [-960.904] (-958.904) * [-959.527] (-959.967) (-962.783) (-960.731) -- 0:00:41
      346000 -- [-961.950] (-966.590) (-961.311) (-958.965) * (-959.910) [-960.878] (-963.342) (-964.043) -- 0:00:41
      346500 -- (-959.469) (-960.451) (-960.924) [-959.247] * [-959.830] (-960.584) (-958.343) (-959.168) -- 0:00:41
      347000 -- (-959.511) (-961.776) [-959.795] (-959.684) * [-959.296] (-960.722) (-960.423) (-962.271) -- 0:00:41
      347500 -- (-961.285) (-960.373) [-959.397] (-962.286) * (-959.131) (-960.049) (-959.642) [-960.722] -- 0:00:41
      348000 -- (-963.391) (-959.550) [-959.934] (-959.128) * (-959.012) (-962.037) (-961.272) [-960.162] -- 0:00:41
      348500 -- (-959.099) [-959.771] (-958.798) (-959.422) * (-962.904) [-959.136] (-959.290) (-960.275) -- 0:00:41
      349000 -- (-959.142) (-960.435) (-960.573) [-960.782] * (-961.855) [-959.283] (-959.524) (-958.760) -- 0:00:41
      349500 -- (-959.524) (-961.655) [-960.073] (-960.335) * (-960.568) [-959.130] (-962.312) (-959.047) -- 0:00:40
      350000 -- (-959.968) (-960.706) (-959.888) [-960.523] * [-960.119] (-959.468) (-962.274) (-959.037) -- 0:00:40

      Average standard deviation of split frequencies: 0.012248

      350500 -- (-960.591) (-962.728) (-959.418) [-959.312] * (-959.713) (-960.426) [-961.239] (-964.255) -- 0:00:40
      351000 -- (-959.040) (-959.804) [-959.584] (-961.601) * (-960.215) [-959.765] (-959.908) (-959.674) -- 0:00:40
      351500 -- (-961.151) (-959.800) [-961.894] (-958.846) * (-960.156) [-958.478] (-960.320) (-959.061) -- 0:00:40
      352000 -- (-963.336) (-960.268) [-959.737] (-961.490) * (-961.392) (-959.199) (-959.145) [-958.791] -- 0:00:40
      352500 -- [-960.502] (-962.247) (-960.238) (-959.432) * (-962.054) [-959.462] (-959.676) (-961.810) -- 0:00:40
      353000 -- (-962.001) [-959.879] (-965.072) (-958.800) * (-961.542) [-961.867] (-960.764) (-961.384) -- 0:00:40
      353500 -- (-962.462) (-960.404) (-960.606) [-959.822] * (-960.179) (-964.220) (-961.485) [-959.985] -- 0:00:40
      354000 -- (-960.919) (-960.865) (-961.869) [-962.669] * (-962.770) [-962.462] (-960.064) (-959.947) -- 0:00:40
      354500 -- (-962.466) (-960.724) [-960.875] (-962.161) * [-960.135] (-960.366) (-960.092) (-959.346) -- 0:00:40
      355000 -- [-960.190] (-958.603) (-961.561) (-962.111) * (-961.507) (-962.645) (-961.736) [-962.554] -- 0:00:39

      Average standard deviation of split frequencies: 0.012151

      355500 -- (-961.689) [-959.093] (-959.975) (-959.552) * (-961.215) (-966.140) (-964.093) [-961.042] -- 0:00:39
      356000 -- (-959.887) (-961.925) (-959.682) [-959.982] * (-959.652) (-964.507) (-968.385) [-959.107] -- 0:00:39
      356500 -- (-960.331) (-960.718) (-959.010) [-959.212] * (-960.886) (-963.103) (-961.189) [-958.695] -- 0:00:39
      357000 -- (-960.216) (-963.566) (-958.439) [-961.244] * [-961.498] (-964.308) (-959.624) (-959.951) -- 0:00:39
      357500 -- (-961.040) [-961.630] (-964.347) (-961.713) * (-959.571) [-959.379] (-961.893) (-959.515) -- 0:00:39
      358000 -- (-962.535) (-961.497) [-960.979] (-963.789) * (-960.124) (-960.808) (-964.580) [-959.600] -- 0:00:39
      358500 -- [-962.467] (-958.669) (-960.870) (-962.990) * (-961.751) (-958.437) (-962.607) [-959.669] -- 0:00:39
      359000 -- [-962.285] (-961.637) (-960.816) (-960.432) * (-960.815) [-958.815] (-959.880) (-961.858) -- 0:00:41
      359500 -- (-962.530) (-963.147) (-962.149) [-962.040] * (-961.107) (-963.275) [-958.710] (-959.573) -- 0:00:40
      360000 -- (-959.186) (-959.827) [-960.082] (-961.734) * (-958.680) (-961.942) (-959.950) [-959.144] -- 0:00:40

      Average standard deviation of split frequencies: 0.012302

      360500 -- [-958.440] (-962.082) (-961.220) (-962.601) * [-958.664] (-959.635) (-959.769) (-958.430) -- 0:00:40
      361000 -- (-958.921) (-965.138) [-959.617] (-960.802) * (-958.582) [-958.672] (-959.335) (-958.431) -- 0:00:40
      361500 -- (-959.034) (-965.576) (-958.694) [-961.362] * (-967.350) (-961.422) (-960.143) [-958.384] -- 0:00:40
      362000 -- (-961.007) (-959.549) [-959.937] (-962.707) * (-962.281) [-960.051] (-967.822) (-959.155) -- 0:00:40
      362500 -- (-960.830) (-959.361) (-960.385) [-964.783] * (-959.046) [-958.471] (-961.499) (-959.277) -- 0:00:40
      363000 -- [-963.501] (-959.820) (-963.868) (-964.731) * (-960.050) (-959.465) (-961.725) [-959.145] -- 0:00:40
      363500 -- (-962.358) (-960.228) [-959.832] (-965.160) * [-959.716] (-958.455) (-961.544) (-959.300) -- 0:00:40
      364000 -- (-960.721) (-960.601) (-959.718) [-962.369] * (-958.522) [-959.174] (-958.765) (-958.686) -- 0:00:40
      364500 -- [-959.111] (-958.471) (-959.346) (-960.952) * (-960.685) (-960.091) [-959.498] (-958.694) -- 0:00:40
      365000 -- (-965.234) [-960.893] (-959.985) (-960.940) * [-960.713] (-958.549) (-959.334) (-958.726) -- 0:00:40

      Average standard deviation of split frequencies: 0.010759

      365500 -- [-960.132] (-959.695) (-964.385) (-963.163) * [-960.145] (-959.436) (-959.598) (-959.770) -- 0:00:39
      366000 -- (-960.150) [-960.879] (-963.425) (-959.325) * (-958.600) [-959.132] (-959.147) (-958.998) -- 0:00:39
      366500 -- [-962.027] (-961.327) (-963.490) (-958.266) * (-959.161) (-961.112) (-960.545) [-958.922] -- 0:00:39
      367000 -- (-959.093) (-961.301) [-960.610] (-961.611) * [-959.118] (-963.612) (-963.400) (-959.356) -- 0:00:39
      367500 -- (-959.080) (-959.174) [-959.987] (-958.738) * [-959.557] (-960.073) (-959.652) (-960.845) -- 0:00:39
      368000 -- [-959.044] (-959.444) (-961.113) (-962.472) * (-962.828) [-961.948] (-961.905) (-961.131) -- 0:00:39
      368500 -- [-962.359] (-958.695) (-960.653) (-959.196) * (-962.808) (-959.759) [-960.749] (-962.061) -- 0:00:39
      369000 -- (-965.198) (-959.904) [-961.430] (-961.067) * [-960.576] (-961.932) (-961.706) (-962.199) -- 0:00:39
      369500 -- (-967.997) (-959.744) (-963.567) [-963.832] * (-959.363) (-961.418) (-960.292) [-961.563] -- 0:00:39
      370000 -- (-968.041) [-961.684] (-959.285) (-961.268) * [-959.278] (-960.709) (-960.342) (-964.774) -- 0:00:39

      Average standard deviation of split frequencies: 0.011446

      370500 -- (-963.532) (-962.027) (-959.752) [-960.282] * (-959.287) [-960.188] (-960.309) (-960.476) -- 0:00:39
      371000 -- (-959.793) (-961.531) (-959.765) [-960.643] * (-958.933) [-959.003] (-958.161) (-962.116) -- 0:00:38
      371500 -- [-961.492] (-961.069) (-963.050) (-959.540) * (-960.244) (-958.511) [-958.649] (-962.012) -- 0:00:38
      372000 -- (-961.119) (-959.275) (-959.552) [-962.260] * (-959.588) (-960.787) [-959.581] (-963.901) -- 0:00:38
      372500 -- [-961.294] (-961.030) (-960.152) (-961.700) * (-961.636) (-960.570) [-960.442] (-962.952) -- 0:00:38
      373000 -- (-959.517) (-960.619) (-958.985) [-958.409] * (-961.762) (-961.900) (-960.247) [-962.026] -- 0:00:38
      373500 -- [-960.250] (-960.231) (-958.946) (-963.005) * (-960.443) (-964.404) (-959.333) [-958.612] -- 0:00:38
      374000 -- [-959.840] (-961.865) (-958.992) (-961.349) * (-958.795) (-961.986) (-960.348) [-959.796] -- 0:00:38
      374500 -- (-958.827) [-960.284] (-960.732) (-960.016) * [-962.082] (-961.529) (-959.936) (-959.312) -- 0:00:38
      375000 -- (-959.723) (-962.079) (-964.801) [-960.495] * [-959.918] (-961.308) (-958.720) (-961.264) -- 0:00:38

      Average standard deviation of split frequencies: 0.012694

      375500 -- (-959.552) (-963.051) [-959.476] (-959.819) * (-959.601) (-959.683) [-959.990] (-960.505) -- 0:00:39
      376000 -- (-960.032) (-959.360) (-961.938) [-959.011] * [-959.410] (-960.845) (-961.298) (-959.818) -- 0:00:39
      376500 -- (-958.707) (-958.719) [-958.289] (-960.163) * (-959.485) [-961.988] (-959.841) (-958.854) -- 0:00:39
      377000 -- [-961.244] (-960.242) (-959.466) (-960.574) * (-961.812) (-958.487) (-961.075) [-959.188] -- 0:00:39
      377500 -- (-958.393) (-964.892) (-963.329) [-960.431] * (-961.760) [-961.922] (-961.013) (-959.980) -- 0:00:39
      378000 -- [-961.474] (-959.145) (-962.382) (-960.394) * (-961.238) (-960.938) [-959.936] (-963.057) -- 0:00:39
      378500 -- (-961.471) (-960.388) (-959.933) [-964.403] * (-961.639) (-960.490) [-966.224] (-965.852) -- 0:00:39
      379000 -- (-962.296) (-962.038) (-958.606) [-962.075] * [-961.300] (-960.627) (-965.549) (-960.302) -- 0:00:39
      379500 -- (-960.121) (-959.629) (-961.537) [-958.429] * [-961.790] (-959.346) (-966.847) (-959.769) -- 0:00:39
      380000 -- (-960.372) [-961.176] (-960.996) (-958.478) * [-963.021] (-960.446) (-961.287) (-959.213) -- 0:00:39

      Average standard deviation of split frequencies: 0.011455

      380500 -- (-963.132) (-960.245) [-960.529] (-959.606) * (-959.122) (-961.668) (-962.148) [-961.030] -- 0:00:39
      381000 -- (-959.564) (-962.413) [-961.667] (-960.128) * [-959.912] (-961.269) (-962.095) (-961.629) -- 0:00:38
      381500 -- (-961.326) (-958.391) (-961.299) [-959.278] * (-959.818) (-958.533) (-959.114) [-960.140] -- 0:00:38
      382000 -- [-960.336] (-961.366) (-962.406) (-960.563) * (-960.507) (-958.293) [-961.941] (-960.292) -- 0:00:38
      382500 -- (-962.540) [-960.171] (-964.494) (-964.639) * [-959.548] (-958.181) (-959.266) (-960.567) -- 0:00:38
      383000 -- (-958.798) [-959.302] (-960.455) (-959.667) * (-960.947) (-959.917) (-959.927) [-960.074] -- 0:00:38
      383500 -- (-962.629) [-958.899] (-961.714) (-961.146) * (-960.725) (-962.500) [-959.260] (-960.524) -- 0:00:38
      384000 -- (-961.907) [-960.501] (-959.979) (-958.601) * (-962.106) (-960.687) (-965.747) [-959.648] -- 0:00:38
      384500 -- (-962.242) (-959.659) [-961.385] (-958.171) * [-959.388] (-959.130) (-966.676) (-964.111) -- 0:00:38
      385000 -- (-960.587) [-961.175] (-959.796) (-959.196) * [-959.217] (-962.971) (-963.754) (-960.968) -- 0:00:38

      Average standard deviation of split frequencies: 0.011063

      385500 -- (-964.639) (-959.111) (-958.602) [-958.887] * [-961.381] (-963.414) (-962.131) (-964.181) -- 0:00:38
      386000 -- (-959.256) (-959.789) [-961.103] (-963.329) * (-964.177) (-963.893) (-962.146) [-961.932] -- 0:00:38
      386500 -- (-959.368) (-962.665) (-959.874) [-958.330] * (-960.761) [-961.508] (-963.563) (-961.957) -- 0:00:38
      387000 -- (-961.387) (-959.553) [-962.218] (-960.761) * [-959.379] (-960.834) (-961.340) (-961.982) -- 0:00:38
      387500 -- (-962.070) [-961.450] (-960.956) (-962.285) * (-960.251) [-960.785] (-959.783) (-960.906) -- 0:00:37
      388000 -- (-965.609) (-958.883) (-959.733) [-961.664] * (-961.513) [-958.875] (-959.783) (-964.286) -- 0:00:37
      388500 -- [-963.285] (-961.466) (-960.851) (-959.104) * [-959.846] (-959.246) (-959.026) (-962.040) -- 0:00:37
      389000 -- (-964.093) (-960.407) [-959.577] (-962.239) * [-958.620] (-960.632) (-964.445) (-963.525) -- 0:00:37
      389500 -- (-959.922) (-966.835) [-959.514] (-962.314) * [-958.533] (-961.973) (-961.431) (-961.015) -- 0:00:37
      390000 -- [-958.574] (-960.645) (-959.078) (-959.768) * [-959.136] (-959.627) (-958.802) (-959.250) -- 0:00:37

      Average standard deviation of split frequencies: 0.011162

      390500 -- (-960.031) (-960.067) [-959.214] (-958.851) * [-960.697] (-960.642) (-958.820) (-958.413) -- 0:00:37
      391000 -- (-961.195) [-961.509] (-963.071) (-959.851) * (-959.263) (-960.025) (-964.175) [-958.799] -- 0:00:37
      391500 -- [-960.909] (-962.750) (-958.668) (-960.972) * (-961.343) (-959.788) (-958.584) [-961.677] -- 0:00:37
      392000 -- (-960.012) [-965.468] (-958.684) (-960.601) * (-959.016) (-959.979) (-959.837) [-961.286] -- 0:00:38
      392500 -- [-962.957] (-959.485) (-960.409) (-958.951) * (-963.015) [-959.984] (-960.437) (-964.373) -- 0:00:38
      393000 -- (-962.093) (-964.372) (-958.639) [-958.732] * (-963.415) [-959.991] (-960.767) (-967.369) -- 0:00:38
      393500 -- (-965.262) (-961.473) [-960.379] (-961.983) * [-959.170] (-959.620) (-959.907) (-960.259) -- 0:00:38
      394000 -- (-960.784) [-959.102] (-965.855) (-964.510) * (-959.863) (-963.408) (-961.202) [-959.423] -- 0:00:38
      394500 -- [-961.949] (-958.781) (-963.199) (-964.327) * [-962.400] (-959.150) (-961.757) (-961.066) -- 0:00:38
      395000 -- [-961.080] (-958.954) (-966.804) (-960.229) * (-964.408) (-959.912) [-960.524] (-961.383) -- 0:00:38

      Average standard deviation of split frequencies: 0.010639

      395500 -- [-958.441] (-961.057) (-960.336) (-963.213) * (-961.926) (-960.259) (-966.022) [-959.487] -- 0:00:38
      396000 -- (-958.461) (-962.571) [-959.098] (-958.335) * (-959.494) (-965.555) [-966.945] (-958.959) -- 0:00:38
      396500 -- [-960.670] (-964.967) (-960.475) (-959.032) * [-963.713] (-961.780) (-960.646) (-959.230) -- 0:00:38
      397000 -- (-961.661) (-968.095) (-963.045) [-959.145] * [-964.619] (-959.202) (-962.276) (-960.124) -- 0:00:37
      397500 -- (-962.871) [-959.852] (-962.161) (-961.264) * (-963.986) (-962.687) (-959.877) [-960.125] -- 0:00:37
      398000 -- (-960.788) (-961.712) (-962.891) [-961.685] * (-962.542) [-960.749] (-962.491) (-961.122) -- 0:00:37
      398500 -- (-960.318) (-960.269) [-962.717] (-960.814) * (-961.557) (-959.881) (-960.797) [-960.799] -- 0:00:37
      399000 -- [-961.189] (-959.893) (-959.789) (-962.360) * (-966.028) (-959.799) (-959.943) [-960.150] -- 0:00:37
      399500 -- (-963.709) [-959.936] (-963.637) (-962.918) * (-967.038) (-960.915) [-961.290] (-961.739) -- 0:00:37
      400000 -- (-959.930) (-962.653) [-963.241] (-961.137) * [-959.334] (-960.151) (-960.047) (-958.814) -- 0:00:37

      Average standard deviation of split frequencies: 0.011324

      400500 -- [-960.233] (-961.445) (-966.323) (-960.287) * (-960.575) (-960.588) (-964.331) [-960.701] -- 0:00:37
      401000 -- (-959.491) [-959.947] (-959.697) (-959.483) * (-961.523) (-958.829) [-960.319] (-960.507) -- 0:00:37
      401500 -- [-960.202] (-959.241) (-958.912) (-959.750) * [-961.900] (-958.495) (-960.084) (-959.136) -- 0:00:37
      402000 -- (-961.671) (-959.564) (-958.547) [-958.813] * (-959.544) (-962.276) (-960.007) [-960.696] -- 0:00:37
      402500 -- [-961.172] (-961.934) (-958.851) (-959.538) * [-959.933] (-960.119) (-963.309) (-961.717) -- 0:00:37
      403000 -- [-963.460] (-968.026) (-959.481) (-961.061) * [-961.465] (-959.805) (-962.351) (-961.904) -- 0:00:37
      403500 -- (-962.674) [-960.232] (-960.004) (-969.382) * (-963.136) [-958.447] (-960.671) (-961.784) -- 0:00:36
      404000 -- [-960.073] (-960.503) (-963.479) (-966.961) * (-960.540) (-959.073) (-965.553) [-965.284] -- 0:00:36
      404500 -- [-959.187] (-961.213) (-959.878) (-959.344) * (-960.953) (-959.463) (-959.226) [-961.330] -- 0:00:36
      405000 -- [-959.543] (-960.691) (-962.166) (-960.458) * (-963.112) (-960.102) [-961.310] (-959.368) -- 0:00:36

      Average standard deviation of split frequencies: 0.010668

      405500 -- (-959.299) (-963.916) [-963.092] (-960.268) * [-959.256] (-960.512) (-959.443) (-960.068) -- 0:00:36
      406000 -- (-961.644) (-960.829) [-960.404] (-959.366) * (-961.934) [-959.714] (-959.188) (-959.779) -- 0:00:36
      406500 -- [-961.178] (-959.089) (-961.356) (-960.869) * (-965.778) (-959.282) (-959.078) [-959.452] -- 0:00:36
      407000 -- (-959.768) [-962.273] (-960.271) (-959.257) * (-962.250) [-960.275] (-961.579) (-958.635) -- 0:00:36
      407500 -- [-959.742] (-959.331) (-961.636) (-961.761) * [-960.445] (-961.286) (-961.777) (-960.485) -- 0:00:36
      408000 -- (-961.543) (-959.577) (-961.649) [-960.266] * [-960.204] (-961.424) (-961.662) (-960.087) -- 0:00:36
      408500 -- (-963.388) (-960.199) (-958.674) [-961.439] * (-960.845) (-962.343) [-959.869] (-960.513) -- 0:00:37
      409000 -- (-959.451) (-961.028) [-959.094] (-960.582) * [-959.496] (-960.202) (-959.900) (-960.357) -- 0:00:37
      409500 -- (-959.484) [-960.680] (-959.791) (-958.594) * [-959.261] (-960.677) (-962.109) (-964.305) -- 0:00:37
      410000 -- [-962.296] (-961.831) (-960.327) (-965.290) * (-959.517) (-959.353) [-958.953] (-962.485) -- 0:00:37

      Average standard deviation of split frequencies: 0.010833

      410500 -- (-959.568) (-962.872) [-960.005] (-962.737) * (-963.011) [-964.761] (-960.415) (-962.506) -- 0:00:37
      411000 -- [-960.034] (-962.865) (-961.656) (-960.287) * (-960.340) (-972.628) (-960.786) [-961.591] -- 0:00:37
      411500 -- [-962.191] (-960.618) (-960.249) (-961.912) * (-961.901) [-964.099] (-958.648) (-962.233) -- 0:00:37
      412000 -- (-961.494) (-960.614) (-961.436) [-960.231] * (-961.136) (-958.885) (-959.978) [-965.242] -- 0:00:37
      412500 -- (-961.705) (-961.450) (-958.211) [-960.231] * (-959.636) (-959.065) (-963.730) [-960.153] -- 0:00:37
      413000 -- (-963.526) (-961.946) [-958.211] (-959.178) * [-960.562] (-963.096) (-962.768) (-960.162) -- 0:00:36
      413500 -- (-958.961) (-964.407) (-958.298) [-958.141] * (-961.612) [-960.521] (-959.768) (-962.711) -- 0:00:36
      414000 -- (-962.365) (-962.950) [-959.046] (-958.669) * (-962.106) [-961.214] (-958.613) (-961.660) -- 0:00:36
      414500 -- (-958.949) [-960.748] (-959.490) (-959.314) * (-961.325) [-958.414] (-962.617) (-959.876) -- 0:00:36
      415000 -- (-958.534) (-959.034) [-960.698] (-962.765) * [-960.215] (-960.926) (-963.153) (-960.406) -- 0:00:36

      Average standard deviation of split frequencies: 0.011261

      415500 -- (-959.924) (-959.519) [-961.980] (-965.738) * (-962.255) (-967.375) [-959.069] (-960.727) -- 0:00:36
      416000 -- [-958.765] (-960.171) (-959.640) (-961.618) * (-959.826) (-969.044) [-959.412] (-961.353) -- 0:00:36
      416500 -- (-961.955) (-959.379) [-958.569] (-960.055) * [-959.125] (-962.046) (-959.206) (-962.077) -- 0:00:36
      417000 -- [-962.236] (-960.890) (-959.601) (-959.035) * (-958.789) [-962.404] (-961.350) (-961.740) -- 0:00:36
      417500 -- (-960.490) [-959.748] (-961.349) (-962.897) * (-961.426) (-959.815) (-964.214) [-962.788] -- 0:00:36
      418000 -- [-959.962] (-959.232) (-959.600) (-961.131) * [-959.193] (-962.045) (-961.419) (-960.888) -- 0:00:36
      418500 -- [-960.440] (-966.505) (-958.797) (-959.127) * (-961.915) (-961.196) (-959.681) [-963.454] -- 0:00:36
      419000 -- (-962.847) (-961.724) [-959.269] (-961.125) * (-960.028) (-961.524) [-963.120] (-960.905) -- 0:00:36
      419500 -- [-962.419] (-961.251) (-959.199) (-959.663) * (-958.975) (-961.802) [-960.461] (-963.631) -- 0:00:35
      420000 -- (-959.991) (-958.427) (-967.360) [-959.792] * [-959.984] (-959.785) (-958.738) (-965.419) -- 0:00:35

      Average standard deviation of split frequencies: 0.011907

      420500 -- (-959.670) [-960.778] (-962.395) (-959.259) * [-961.604] (-963.860) (-964.828) (-965.893) -- 0:00:35
      421000 -- (-959.710) [-961.697] (-962.437) (-958.894) * (-963.883) [-959.697] (-960.925) (-958.606) -- 0:00:35
      421500 -- (-961.915) (-961.337) [-960.416] (-961.415) * [-961.971] (-964.514) (-959.097) (-961.457) -- 0:00:35
      422000 -- (-965.760) (-960.855) [-962.057] (-964.223) * [-960.130] (-965.153) (-959.713) (-960.610) -- 0:00:35
      422500 -- (-962.169) (-960.037) [-962.224] (-963.823) * (-965.072) (-963.265) (-959.782) [-959.235] -- 0:00:35
      423000 -- (-961.165) (-961.283) [-960.693] (-966.160) * (-963.550) (-960.420) (-961.211) [-959.630] -- 0:00:35
      423500 -- (-958.841) (-960.968) [-960.572] (-964.167) * (-960.667) [-963.282] (-961.713) (-963.563) -- 0:00:35
      424000 -- [-959.681] (-958.391) (-960.228) (-962.301) * (-962.089) [-961.525] (-958.849) (-963.384) -- 0:00:35
      424500 -- [-959.826] (-959.260) (-960.525) (-959.666) * (-961.185) (-961.614) [-959.253] (-960.149) -- 0:00:35
      425000 -- (-961.380) (-960.626) (-961.470) [-960.627] * (-966.007) [-959.083] (-962.055) (-962.423) -- 0:00:36

      Average standard deviation of split frequencies: 0.011688

      425500 -- [-958.581] (-960.787) (-961.059) (-960.676) * (-963.421) (-960.346) (-964.603) [-962.542] -- 0:00:36
      426000 -- (-958.288) (-960.582) (-958.587) [-960.568] * (-961.508) [-961.724] (-959.139) (-960.909) -- 0:00:36
      426500 -- (-960.841) (-960.317) (-964.371) [-958.964] * (-961.409) (-962.532) [-958.925] (-962.682) -- 0:00:36
      427000 -- [-958.580] (-959.261) (-960.674) (-958.414) * (-963.196) (-960.702) [-958.913] (-959.334) -- 0:00:36
      427500 -- (-959.977) (-959.077) [-959.944] (-958.641) * (-961.285) (-960.051) (-962.008) [-959.138] -- 0:00:36
      428000 -- (-959.315) (-959.119) [-959.973] (-963.468) * (-960.598) (-959.549) [-960.974] (-963.424) -- 0:00:36
      428500 -- (-961.490) (-960.678) (-965.075) [-964.167] * [-960.598] (-960.864) (-961.065) (-961.822) -- 0:00:36
      429000 -- (-958.345) (-965.070) (-960.530) [-963.368] * (-960.840) (-960.718) (-959.384) [-959.511] -- 0:00:35
      429500 -- [-958.650] (-961.018) (-959.934) (-965.205) * (-964.501) [-960.438] (-959.356) (-959.512) -- 0:00:35
      430000 -- (-963.154) [-959.349] (-960.734) (-961.270) * (-962.290) (-960.548) [-961.160] (-959.376) -- 0:00:35

      Average standard deviation of split frequencies: 0.011203

      430500 -- (-960.151) (-960.917) [-963.442] (-965.068) * (-962.189) (-961.219) [-962.118] (-960.126) -- 0:00:35
      431000 -- (-963.512) (-964.346) [-960.937] (-962.455) * (-961.029) [-959.940] (-963.226) (-960.535) -- 0:00:35
      431500 -- (-961.240) (-963.726) (-961.107) [-959.450] * [-958.773] (-960.872) (-962.022) (-959.889) -- 0:00:35
      432000 -- (-960.665) (-958.935) [-959.358] (-959.396) * (-958.731) [-960.280] (-960.520) (-960.372) -- 0:00:35
      432500 -- (-958.972) [-962.240] (-961.910) (-961.524) * (-962.640) (-967.657) (-963.688) [-960.993] -- 0:00:35
      433000 -- [-958.824] (-959.471) (-959.767) (-961.832) * [-958.910] (-959.323) (-959.369) (-961.850) -- 0:00:35
      433500 -- [-959.945] (-959.956) (-959.972) (-960.709) * [-959.076] (-965.861) (-960.828) (-962.412) -- 0:00:35
      434000 -- (-963.132) [-958.740] (-963.475) (-958.251) * [-961.159] (-963.399) (-964.548) (-960.306) -- 0:00:35
      434500 -- [-965.982] (-960.747) (-963.675) (-961.480) * [-961.109] (-961.517) (-960.330) (-962.141) -- 0:00:35
      435000 -- (-964.887) (-959.361) (-961.596) [-963.314] * (-962.131) [-958.624] (-959.765) (-960.239) -- 0:00:35

      Average standard deviation of split frequencies: 0.012637

      435500 -- (-958.507) [-959.560] (-961.979) (-958.292) * (-963.404) (-962.876) (-958.656) [-962.765] -- 0:00:34
      436000 -- (-964.627) (-961.836) (-958.726) [-958.938] * (-960.495) [-959.443] (-961.377) (-960.821) -- 0:00:34
      436500 -- (-963.547) (-960.834) (-961.988) [-960.213] * (-964.029) (-959.291) (-958.418) [-960.382] -- 0:00:34
      437000 -- (-965.420) (-959.130) (-962.650) [-960.420] * (-961.849) [-960.874] (-961.720) (-961.220) -- 0:00:34
      437500 -- (-962.553) [-960.046] (-958.374) (-960.762) * (-961.011) [-958.953] (-960.549) (-960.126) -- 0:00:34
      438000 -- [-961.787] (-960.017) (-958.253) (-959.508) * [-961.623] (-965.310) (-962.515) (-959.097) -- 0:00:34
      438500 -- (-959.082) [-961.656] (-958.613) (-960.141) * (-959.091) [-959.286] (-959.809) (-962.075) -- 0:00:34
      439000 -- [-960.254] (-961.692) (-960.791) (-962.963) * [-959.262] (-959.547) (-967.531) (-959.447) -- 0:00:34
      439500 -- (-959.517) (-962.373) (-959.916) [-962.019] * (-959.630) (-961.947) (-958.943) [-959.982] -- 0:00:34
      440000 -- (-960.807) (-961.285) [-959.624] (-962.317) * (-961.974) (-959.408) (-958.312) [-960.640] -- 0:00:34

      Average standard deviation of split frequencies: 0.012636

      440500 -- (-960.008) [-959.223] (-961.067) (-963.696) * [-962.105] (-958.926) (-959.061) (-960.084) -- 0:00:34
      441000 -- (-958.631) (-958.604) [-959.714] (-964.395) * (-958.646) [-961.549] (-958.456) (-965.995) -- 0:00:34
      441500 -- (-962.819) [-960.433] (-961.010) (-962.306) * [-958.525] (-962.904) (-963.515) (-959.711) -- 0:00:35
      442000 -- (-960.596) (-959.441) (-959.984) [-959.187] * [-964.252] (-963.152) (-959.103) (-959.255) -- 0:00:35
      442500 -- [-961.083] (-958.804) (-962.537) (-959.062) * (-961.988) (-964.184) (-961.230) [-959.028] -- 0:00:35
      443000 -- (-962.684) [-962.408] (-959.846) (-959.813) * (-962.031) (-964.978) [-962.111] (-963.693) -- 0:00:35
      443500 -- (-961.210) (-964.520) (-959.861) [-960.343] * (-961.711) (-961.441) (-962.646) [-958.578] -- 0:00:35
      444000 -- (-960.727) (-960.573) (-959.742) [-960.318] * (-963.692) (-960.591) (-960.330) [-961.321] -- 0:00:35
      444500 -- [-961.028] (-960.688) (-958.668) (-963.238) * (-960.308) [-959.258] (-962.038) (-961.863) -- 0:00:34
      445000 -- (-961.595) (-960.063) (-960.873) [-959.858] * (-959.079) (-960.312) (-961.897) [-960.359] -- 0:00:34

      Average standard deviation of split frequencies: 0.012023

      445500 -- (-962.557) (-962.493) [-961.283] (-960.977) * (-963.726) [-962.864] (-961.269) (-960.700) -- 0:00:34
      446000 -- (-963.563) [-963.893] (-959.357) (-959.734) * (-964.362) [-962.529] (-960.050) (-964.641) -- 0:00:34
      446500 -- (-961.954) (-961.216) [-959.308] (-959.434) * (-961.268) [-959.872] (-961.881) (-965.240) -- 0:00:34
      447000 -- (-961.485) (-960.051) [-961.410] (-958.771) * (-963.303) (-958.816) [-960.090] (-959.914) -- 0:00:34
      447500 -- [-963.948] (-961.968) (-958.652) (-959.986) * [-960.479] (-961.140) (-958.901) (-960.363) -- 0:00:34
      448000 -- [-964.381] (-960.520) (-958.793) (-963.215) * [-959.950] (-959.531) (-961.789) (-959.522) -- 0:00:34
      448500 -- (-963.701) (-962.788) (-959.710) [-962.393] * (-960.074) [-960.868] (-960.627) (-960.027) -- 0:00:34
      449000 -- [-960.889] (-960.802) (-960.373) (-961.377) * (-959.001) (-959.159) [-958.918] (-958.255) -- 0:00:34
      449500 -- (-959.528) [-962.830] (-959.018) (-965.541) * (-960.376) (-961.094) [-958.762] (-958.354) -- 0:00:34
      450000 -- (-959.917) (-959.150) (-961.961) [-963.219] * (-963.394) [-959.793] (-961.221) (-958.382) -- 0:00:34

      Average standard deviation of split frequencies: 0.010952

      450500 -- (-960.219) (-958.925) [-958.616] (-963.595) * (-960.463) [-959.564] (-963.326) (-959.498) -- 0:00:34
      451000 -- (-964.035) (-958.925) (-959.906) [-960.790] * (-966.261) (-962.586) [-960.661] (-961.763) -- 0:00:34
      451500 -- [-965.247] (-958.945) (-961.108) (-961.079) * (-970.413) (-959.030) (-960.289) [-960.138] -- 0:00:34
      452000 -- (-962.760) (-961.703) (-961.562) [-960.172] * (-958.322) [-959.034] (-962.091) (-964.349) -- 0:00:33
      452500 -- (-962.316) (-960.791) (-963.626) [-961.496] * [-959.016] (-962.304) (-959.555) (-965.303) -- 0:00:33
      453000 -- (-962.303) [-959.240] (-958.759) (-961.283) * (-960.279) (-961.327) [-963.843] (-960.090) -- 0:00:33
      453500 -- (-960.008) [-960.115] (-959.518) (-959.890) * [-960.731] (-958.513) (-960.950) (-961.168) -- 0:00:33
      454000 -- (-962.204) [-960.994] (-960.265) (-962.061) * (-962.663) [-958.457] (-960.735) (-960.197) -- 0:00:33
      454500 -- (-963.593) [-964.934] (-959.425) (-959.630) * (-961.096) [-959.526] (-960.519) (-960.592) -- 0:00:33
      455000 -- (-960.807) (-960.287) (-961.086) [-959.887] * [-965.171] (-960.118) (-960.146) (-960.295) -- 0:00:33

      Average standard deviation of split frequencies: 0.011113

      455500 -- (-960.734) [-963.222] (-963.276) (-958.789) * (-959.492) (-963.901) [-958.979] (-959.838) -- 0:00:33
      456000 -- (-961.584) (-961.704) (-961.793) [-958.906] * (-966.947) (-962.460) [-961.175] (-962.010) -- 0:00:33
      456500 -- (-958.999) [-960.510] (-960.053) (-961.501) * (-960.197) (-962.954) (-960.692) [-959.328] -- 0:00:33
      457000 -- (-959.685) (-964.726) [-958.400] (-962.688) * (-959.610) [-960.148] (-959.114) (-959.540) -- 0:00:33
      457500 -- (-961.320) (-960.100) [-960.345] (-962.577) * (-960.675) (-961.558) [-959.670] (-960.048) -- 0:00:33
      458000 -- (-960.439) (-960.731) [-961.546] (-959.731) * (-961.599) [-960.516] (-959.070) (-963.340) -- 0:00:34
      458500 -- (-962.479) [-961.495] (-959.921) (-958.884) * (-962.123) (-958.341) [-958.960] (-963.080) -- 0:00:34
      459000 -- (-961.153) (-959.761) (-961.257) [-961.267] * (-962.002) (-959.078) (-958.916) [-961.324] -- 0:00:34
      459500 -- (-962.205) (-959.360) [-964.524] (-961.675) * (-966.531) (-960.350) (-960.037) [-959.910] -- 0:00:34
      460000 -- (-959.873) (-959.387) (-964.069) [-959.574] * (-960.404) (-960.234) [-959.561] (-959.991) -- 0:00:34

      Average standard deviation of split frequencies: 0.012484

      460500 -- [-960.024] (-963.026) (-962.376) (-962.171) * (-959.696) (-963.842) (-965.025) [-959.190] -- 0:00:33
      461000 -- [-958.823] (-962.984) (-959.972) (-959.544) * (-964.324) (-966.578) (-962.295) [-960.958] -- 0:00:33
      461500 -- [-961.016] (-959.677) (-959.882) (-960.415) * (-959.890) (-961.452) (-960.590) [-960.161] -- 0:00:33
      462000 -- [-962.129] (-961.244) (-962.279) (-960.948) * [-961.569] (-960.392) (-962.480) (-958.658) -- 0:00:33
      462500 -- (-959.994) [-959.190] (-960.625) (-961.325) * (-961.465) (-960.440) (-966.355) [-961.182] -- 0:00:33
      463000 -- [-964.063] (-960.228) (-961.017) (-959.687) * (-961.677) (-960.038) (-964.326) [-959.547] -- 0:00:33
      463500 -- (-959.373) (-961.410) (-958.587) [-961.242] * (-959.546) (-963.875) [-962.801] (-958.909) -- 0:00:33
      464000 -- (-960.054) (-960.435) [-958.722] (-960.264) * (-961.841) (-959.508) (-962.092) [-960.837] -- 0:00:33
      464500 -- [-960.728] (-960.447) (-960.077) (-960.345) * (-963.922) (-961.374) [-958.675] (-964.986) -- 0:00:33
      465000 -- [-960.721] (-961.591) (-959.840) (-960.513) * (-966.418) (-972.876) (-958.760) [-960.565] -- 0:00:33

      Average standard deviation of split frequencies: 0.012544

      465500 -- (-960.098) [-963.353] (-964.327) (-958.889) * (-965.134) (-960.039) [-959.015] (-961.019) -- 0:00:33
      466000 -- (-959.138) (-960.229) [-961.010] (-960.132) * [-959.971] (-960.119) (-961.222) (-960.029) -- 0:00:33
      466500 -- (-961.378) (-963.523) (-959.030) [-960.265] * (-960.873) (-963.313) (-960.973) [-960.269] -- 0:00:33
      467000 -- (-962.027) (-961.498) [-960.001] (-959.517) * (-962.611) [-959.804] (-960.293) (-961.543) -- 0:00:33
      467500 -- (-962.278) [-960.805] (-961.880) (-958.469) * (-963.747) (-962.198) [-962.766] (-963.424) -- 0:00:33
      468000 -- (-962.971) (-963.618) [-965.021] (-958.384) * (-960.966) [-960.318] (-963.890) (-959.614) -- 0:00:32
      468500 -- [-959.141] (-961.602) (-961.916) (-960.147) * (-962.064) (-961.610) (-963.448) [-959.863] -- 0:00:32
      469000 -- (-962.174) [-963.384] (-962.609) (-959.563) * (-960.238) [-963.841] (-963.000) (-960.108) -- 0:00:32
      469500 -- [-959.292] (-960.196) (-968.136) (-962.043) * [-959.285] (-959.787) (-962.950) (-961.238) -- 0:00:32
      470000 -- (-959.388) (-961.462) (-962.460) [-960.335] * [-958.721] (-962.499) (-962.534) (-960.587) -- 0:00:32

      Average standard deviation of split frequencies: 0.013287

      470500 -- [-959.353] (-963.244) (-965.327) (-960.390) * (-961.278) (-961.113) (-960.349) [-960.587] -- 0:00:32
      471000 -- [-959.404] (-961.824) (-960.235) (-960.676) * [-959.949] (-967.642) (-961.194) (-965.812) -- 0:00:32
      471500 -- (-966.625) (-960.317) (-958.374) [-964.242] * (-959.942) (-964.765) [-961.100] (-962.234) -- 0:00:32
      472000 -- (-959.743) [-960.547] (-962.651) (-962.528) * (-959.335) (-962.871) [-960.349] (-960.637) -- 0:00:32
      472500 -- [-959.346] (-958.676) (-958.876) (-966.169) * (-960.719) (-960.540) (-961.621) [-960.069] -- 0:00:32
      473000 -- (-961.465) (-958.373) [-958.379] (-964.775) * (-965.307) [-959.577] (-961.876) (-962.643) -- 0:00:32
      473500 -- (-959.613) (-958.783) (-962.509) [-962.912] * (-963.131) (-960.126) (-962.130) [-960.846] -- 0:00:32
      474000 -- (-961.057) (-963.409) (-959.254) [-959.739] * [-962.175] (-959.839) (-960.235) (-964.156) -- 0:00:32
      474500 -- (-964.493) (-963.081) [-959.199] (-961.539) * [-959.047] (-961.187) (-960.076) (-959.247) -- 0:00:33
      475000 -- (-961.923) (-960.416) (-959.175) [-959.529] * (-959.698) (-959.011) (-959.638) [-960.224] -- 0:00:33

      Average standard deviation of split frequencies: 0.014063

      475500 -- (-961.004) (-959.387) (-960.562) [-960.956] * (-959.268) (-959.055) (-964.435) [-960.157] -- 0:00:33
      476000 -- (-959.917) (-959.440) [-960.313] (-960.278) * (-960.270) (-961.803) [-959.599] (-961.002) -- 0:00:33
      476500 -- (-958.690) (-962.696) (-960.271) [-959.734] * (-964.518) (-958.176) (-959.831) [-958.356] -- 0:00:32
      477000 -- (-960.993) (-962.047) [-961.173] (-958.930) * (-960.169) (-959.998) (-959.177) [-961.319] -- 0:00:32
      477500 -- (-960.609) (-962.610) [-960.920] (-961.391) * (-959.868) [-961.297] (-961.749) (-959.434) -- 0:00:32
      478000 -- (-964.327) (-960.520) [-960.166] (-959.405) * [-960.741] (-958.928) (-964.264) (-959.402) -- 0:00:32
      478500 -- (-963.673) [-958.442] (-960.549) (-961.869) * (-965.021) (-960.868) [-964.850] (-958.184) -- 0:00:32
      479000 -- (-960.055) [-960.758] (-958.713) (-960.365) * [-961.875] (-959.255) (-959.802) (-959.155) -- 0:00:32
      479500 -- (-960.486) (-963.079) (-961.990) [-960.201] * (-963.244) (-959.834) (-960.554) [-959.365] -- 0:00:32
      480000 -- (-961.074) (-958.867) [-962.023] (-959.457) * (-963.074) (-959.582) [-961.689] (-960.684) -- 0:00:32

      Average standard deviation of split frequencies: 0.014123

      480500 -- [-960.010] (-958.411) (-962.910) (-960.836) * [-959.636] (-958.738) (-965.473) (-958.906) -- 0:00:32
      481000 -- (-961.298) [-958.375] (-963.389) (-960.408) * (-961.375) [-959.526] (-964.586) (-959.038) -- 0:00:32
      481500 -- (-958.334) (-959.818) [-959.375] (-960.885) * (-961.740) (-961.324) (-958.235) [-960.625] -- 0:00:32
      482000 -- [-961.533] (-959.191) (-959.430) (-963.498) * (-961.367) (-961.767) (-962.243) [-959.553] -- 0:00:32
      482500 -- (-961.439) [-960.048] (-959.800) (-959.549) * (-959.510) [-962.826] (-962.541) (-959.152) -- 0:00:32
      483000 -- (-960.047) (-963.194) [-960.538] (-962.001) * (-958.987) (-962.251) [-958.770] (-960.370) -- 0:00:32
      483500 -- (-962.560) (-959.492) (-960.461) [-960.792] * [-960.256] (-960.289) (-960.733) (-961.540) -- 0:00:32
      484000 -- (-960.557) (-959.549) [-959.258] (-961.092) * (-959.837) [-959.202] (-961.316) (-960.355) -- 0:00:31
      484500 -- (-958.551) (-963.487) [-959.021] (-961.061) * (-959.781) [-960.237] (-959.237) (-963.692) -- 0:00:31
      485000 -- (-959.111) (-965.045) (-961.242) [-962.531] * (-962.030) [-958.930] (-960.623) (-959.953) -- 0:00:31

      Average standard deviation of split frequencies: 0.013701

      485500 -- (-960.765) (-961.298) (-960.120) [-959.775] * (-960.124) (-962.121) [-960.531] (-959.246) -- 0:00:31
      486000 -- (-959.598) (-958.917) [-960.322] (-961.257) * (-962.746) (-961.946) [-960.899] (-958.794) -- 0:00:31
      486500 -- (-960.391) [-958.445] (-962.764) (-958.633) * [-959.345] (-960.329) (-960.923) (-958.774) -- 0:00:31
      487000 -- (-959.629) (-961.207) [-962.050] (-960.464) * [-959.228] (-961.113) (-960.458) (-958.904) -- 0:00:31
      487500 -- (-958.985) (-962.815) [-962.231] (-963.583) * (-958.855) [-959.587] (-961.460) (-958.981) -- 0:00:31
      488000 -- (-962.989) (-964.556) [-965.213] (-966.008) * [-960.224] (-960.468) (-961.460) (-960.755) -- 0:00:31
      488500 -- (-961.597) (-962.267) [-962.482] (-960.100) * (-963.319) (-959.626) [-960.548] (-961.643) -- 0:00:31
      489000 -- (-961.094) (-960.203) [-962.572] (-959.610) * (-963.909) [-962.045] (-961.407) (-961.024) -- 0:00:31
      489500 -- (-959.535) [-958.976] (-960.203) (-959.651) * (-960.685) (-961.312) [-960.066] (-960.084) -- 0:00:31
      490000 -- (-962.261) (-960.988) [-961.095] (-962.845) * [-958.885] (-962.151) (-960.726) (-961.296) -- 0:00:31

      Average standard deviation of split frequencies: 0.013751

      490500 -- [-963.554] (-960.790) (-961.402) (-960.129) * (-961.356) (-965.102) (-959.380) [-961.011] -- 0:00:31
      491000 -- [-962.188] (-964.255) (-960.607) (-959.645) * (-963.420) (-964.660) (-959.051) [-961.544] -- 0:00:32
      491500 -- (-964.984) (-960.697) (-959.459) [-959.428] * (-965.553) [-960.359] (-960.786) (-963.518) -- 0:00:32
      492000 -- (-958.722) [-962.247] (-960.786) (-960.193) * (-960.993) (-961.271) (-960.324) [-959.728] -- 0:00:32
      492500 -- [-959.763] (-962.046) (-962.026) (-958.978) * (-960.993) [-965.137] (-963.745) (-961.099) -- 0:00:31
      493000 -- (-960.313) [-961.834] (-960.056) (-962.369) * (-962.389) [-961.474] (-962.078) (-963.923) -- 0:00:31
      493500 -- (-961.135) (-960.884) (-961.384) [-959.969] * (-960.741) [-964.102] (-961.695) (-960.363) -- 0:00:31
      494000 -- [-962.841] (-960.516) (-962.985) (-959.756) * (-965.816) (-961.719) [-960.187] (-963.980) -- 0:00:31
      494500 -- (-958.696) [-959.635] (-962.895) (-961.088) * (-958.614) [-960.767] (-960.814) (-961.429) -- 0:00:31
      495000 -- [-963.581] (-959.005) (-964.549) (-959.312) * (-959.356) (-965.082) (-962.041) [-964.503] -- 0:00:31

      Average standard deviation of split frequencies: 0.013813

      495500 -- (-960.870) [-962.236] (-961.009) (-964.522) * (-962.411) (-959.790) (-963.497) [-961.373] -- 0:00:31
      496000 -- [-958.401] (-961.350) (-960.332) (-963.136) * (-959.429) (-959.345) (-962.686) [-960.529] -- 0:00:31
      496500 -- (-959.855) (-961.218) (-960.392) [-964.560] * (-959.073) [-959.454] (-961.667) (-960.432) -- 0:00:31
      497000 -- (-962.438) [-959.816] (-961.269) (-959.384) * (-961.346) (-960.941) [-960.541] (-961.335) -- 0:00:31
      497500 -- [-960.250] (-959.786) (-962.785) (-960.416) * (-961.621) (-961.042) (-960.342) [-959.300] -- 0:00:31
      498000 -- [-960.983] (-962.888) (-961.562) (-958.995) * [-960.100] (-958.956) (-962.816) (-959.197) -- 0:00:31
      498500 -- (-960.067) [-959.650] (-963.650) (-959.836) * (-960.083) (-958.898) (-961.467) [-959.625] -- 0:00:31
      499000 -- (-960.978) (-959.710) (-960.487) [-958.534] * [-959.504] (-963.380) (-964.247) (-960.109) -- 0:00:31
      499500 -- (-960.146) (-960.328) [-964.771] (-963.256) * (-960.004) (-959.774) [-964.324] (-959.425) -- 0:00:31
      500000 -- (-962.291) (-959.024) [-961.586] (-962.149) * (-962.396) [-958.631] (-961.645) (-960.138) -- 0:00:31

      Average standard deviation of split frequencies: 0.013182

      500500 -- (-959.065) [-958.847] (-966.165) (-964.798) * (-960.069) [-958.895] (-961.254) (-958.883) -- 0:00:30
      501000 -- (-960.546) (-962.028) (-965.947) [-966.357] * [-963.221] (-958.554) (-961.969) (-958.972) -- 0:00:30
      501500 -- [-958.997] (-960.207) (-959.476) (-966.389) * (-962.536) [-959.526] (-960.619) (-959.560) -- 0:00:30
      502000 -- (-959.622) (-959.406) (-959.985) [-963.563] * [-958.825] (-961.810) (-961.882) (-960.511) -- 0:00:30
      502500 -- (-958.464) [-960.015] (-961.390) (-960.310) * (-958.851) (-961.748) [-959.160] (-960.843) -- 0:00:30
      503000 -- (-960.032) (-959.419) (-959.916) [-961.396] * (-958.284) [-963.645] (-959.625) (-960.044) -- 0:00:30
      503500 -- [-959.523] (-959.159) (-959.068) (-959.983) * (-959.414) (-965.526) (-961.840) [-959.872] -- 0:00:30
      504000 -- (-959.359) [-959.419] (-959.661) (-959.425) * [-962.977] (-959.890) (-966.460) (-960.733) -- 0:00:30
      504500 -- (-964.656) (-960.098) (-960.598) [-960.095] * (-962.177) (-961.135) (-961.185) [-960.036] -- 0:00:30
      505000 -- (-960.074) [-959.667] (-961.443) (-960.759) * (-959.998) (-961.007) (-962.642) [-959.227] -- 0:00:30

      Average standard deviation of split frequencies: 0.012693

      505500 -- (-959.645) (-961.749) (-960.714) [-958.462] * (-962.790) (-960.073) (-962.945) [-958.621] -- 0:00:30
      506000 -- [-958.845] (-962.386) (-964.917) (-959.203) * (-959.856) [-961.541] (-961.869) (-960.840) -- 0:00:30
      506500 -- (-958.287) (-962.501) (-962.464) [-958.686] * (-959.986) (-959.976) [-959.858] (-959.743) -- 0:00:30
      507000 -- [-960.147] (-962.662) (-962.047) (-959.852) * (-963.814) (-960.084) [-960.174] (-959.149) -- 0:00:30
      507500 -- (-962.458) (-962.411) (-960.968) [-960.521] * (-961.400) (-959.348) [-961.148] (-959.848) -- 0:00:31
      508000 -- (-961.169) [-958.941] (-960.972) (-959.305) * (-960.940) (-961.703) [-960.890] (-961.933) -- 0:00:30
      508500 -- [-958.118] (-960.178) (-962.178) (-960.908) * (-959.534) (-962.578) [-959.755] (-961.256) -- 0:00:30
      509000 -- (-959.406) [-960.828] (-962.993) (-959.819) * (-959.611) (-961.266) (-959.567) [-959.427] -- 0:00:30
      509500 -- (-960.123) [-961.699] (-964.654) (-963.670) * (-960.660) (-961.138) [-961.883] (-959.054) -- 0:00:30
      510000 -- (-958.922) (-959.996) (-960.505) [-959.756] * (-962.034) [-964.016] (-961.107) (-958.365) -- 0:00:30

      Average standard deviation of split frequencies: 0.012174

      510500 -- [-960.802] (-963.497) (-960.532) (-962.125) * (-961.621) [-959.713] (-961.060) (-958.384) -- 0:00:30
      511000 -- (-963.510) (-958.881) [-961.882] (-962.052) * (-960.090) [-959.577] (-963.202) (-960.686) -- 0:00:30
      511500 -- (-962.376) [-961.418] (-960.208) (-959.040) * (-962.267) [-960.965] (-961.204) (-960.029) -- 0:00:30
      512000 -- (-960.385) (-958.242) (-961.075) [-963.759] * (-960.072) (-961.061) (-961.649) [-961.859] -- 0:00:30
      512500 -- (-967.610) (-958.730) (-962.534) [-959.873] * (-963.102) [-960.508] (-962.321) (-963.103) -- 0:00:30
      513000 -- (-967.097) (-961.011) [-959.803] (-960.017) * (-958.863) (-958.497) [-962.658] (-963.142) -- 0:00:30
      513500 -- (-961.410) [-960.854] (-959.821) (-960.448) * (-959.072) [-961.012] (-959.749) (-966.262) -- 0:00:30
      514000 -- (-960.526) (-960.735) (-960.107) [-962.867] * (-961.370) (-961.203) (-962.406) [-962.682] -- 0:00:30
      514500 -- [-960.865] (-960.178) (-961.315) (-958.923) * [-964.044] (-962.800) (-966.288) (-959.061) -- 0:00:30
      515000 -- (-959.427) [-959.160] (-965.263) (-959.577) * [-959.642] (-961.608) (-965.154) (-959.573) -- 0:00:30

      Average standard deviation of split frequencies: 0.012105

      515500 -- (-958.380) [-958.686] (-962.206) (-961.183) * (-960.509) (-961.621) (-959.376) [-959.580] -- 0:00:30
      516000 -- (-958.745) [-958.291] (-960.134) (-960.315) * [-961.448] (-963.371) (-958.672) (-962.776) -- 0:00:30
      516500 -- (-960.136) [-960.154] (-958.886) (-962.205) * (-960.612) [-960.407] (-961.940) (-960.538) -- 0:00:29
      517000 -- [-958.655] (-959.031) (-959.358) (-961.060) * (-958.465) (-961.625) [-965.959] (-963.788) -- 0:00:29
      517500 -- (-962.248) (-959.093) [-959.152] (-960.968) * (-960.799) [-962.193] (-961.690) (-959.124) -- 0:00:29
      518000 -- [-959.431] (-958.966) (-958.568) (-960.324) * [-961.765] (-962.456) (-960.910) (-959.646) -- 0:00:29
      518500 -- (-960.928) (-960.825) (-958.592) [-962.514] * (-960.949) [-962.027] (-960.583) (-959.024) -- 0:00:29
      519000 -- (-958.627) (-961.844) [-959.006] (-959.851) * (-960.907) (-961.521) (-959.572) [-959.753] -- 0:00:29
      519500 -- (-959.172) (-964.848) [-959.783] (-960.517) * (-958.845) (-959.918) [-959.860] (-960.912) -- 0:00:29
      520000 -- (-964.233) (-958.573) (-964.396) [-959.140] * (-960.720) [-958.483] (-958.546) (-963.539) -- 0:00:29

      Average standard deviation of split frequencies: 0.011996

      520500 -- [-961.542] (-961.120) (-960.732) (-959.181) * (-960.453) (-959.593) [-958.621] (-962.262) -- 0:00:29
      521000 -- [-960.945] (-960.456) (-961.334) (-958.946) * (-960.480) [-961.615] (-963.608) (-960.717) -- 0:00:29
      521500 -- (-960.412) (-961.569) [-960.186] (-959.513) * [-961.294] (-964.534) (-963.779) (-962.423) -- 0:00:29
      522000 -- (-959.954) (-962.778) (-961.926) [-959.656] * (-961.776) (-962.778) [-962.758] (-962.129) -- 0:00:29
      522500 -- (-959.206) [-958.993] (-962.339) (-958.959) * (-960.565) (-963.261) (-959.131) [-960.842] -- 0:00:29
      523000 -- (-961.651) (-959.072) [-960.157] (-958.450) * [-962.316] (-962.175) (-960.339) (-959.734) -- 0:00:29
      523500 -- [-958.916] (-959.029) (-966.801) (-960.583) * (-960.882) (-960.197) (-960.511) [-960.071] -- 0:00:29
      524000 -- [-960.291] (-960.594) (-960.960) (-962.561) * (-961.541) [-963.108] (-959.391) (-960.026) -- 0:00:29
      524500 -- (-958.290) (-959.777) [-960.121] (-962.091) * [-961.603] (-960.182) (-959.697) (-962.460) -- 0:00:29
      525000 -- (-963.302) (-959.554) [-963.102] (-960.795) * (-960.684) (-960.154) (-961.239) [-963.049] -- 0:00:29

      Average standard deviation of split frequencies: 0.012267

      525500 -- [-960.606] (-961.880) (-960.767) (-961.159) * (-959.939) (-961.516) (-959.353) [-962.336] -- 0:00:29
      526000 -- (-960.618) (-965.308) [-959.027] (-959.150) * (-959.442) [-959.302] (-960.021) (-962.713) -- 0:00:29
      526500 -- (-959.511) (-961.734) (-969.850) [-959.658] * (-959.188) (-959.307) [-960.458] (-960.759) -- 0:00:29
      527000 -- (-959.024) (-958.717) (-963.044) [-959.563] * (-960.693) (-961.808) (-959.575) [-958.344] -- 0:00:29
      527500 -- (-962.053) (-961.294) [-959.536] (-959.409) * (-962.951) (-960.191) (-961.046) [-959.683] -- 0:00:29
      528000 -- (-962.455) (-958.710) [-958.152] (-960.607) * (-961.166) (-962.506) (-960.502) [-961.813] -- 0:00:29
      528500 -- (-967.936) (-961.569) (-964.039) [-959.752] * (-962.103) (-960.993) [-959.568] (-965.838) -- 0:00:29
      529000 -- (-961.676) (-959.153) (-961.136) [-960.608] * [-961.303] (-962.429) (-961.591) (-963.895) -- 0:00:29
      529500 -- (-959.258) (-960.084) (-962.389) [-960.551] * [-960.984] (-960.663) (-960.396) (-960.060) -- 0:00:29
      530000 -- (-959.981) [-959.223] (-961.780) (-958.627) * (-961.618) (-958.664) (-961.934) [-960.475] -- 0:00:29

      Average standard deviation of split frequencies: 0.011493

      530500 -- [-961.164] (-959.257) (-961.506) (-958.703) * [-960.205] (-959.462) (-962.782) (-960.735) -- 0:00:29
      531000 -- (-961.555) [-960.635] (-960.163) (-959.932) * [-959.969] (-959.279) (-967.324) (-958.555) -- 0:00:29
      531500 -- (-961.981) (-959.597) (-965.167) [-962.872] * (-960.349) (-963.456) [-959.078] (-961.996) -- 0:00:29
      532000 -- (-962.233) (-962.005) [-959.950] (-963.967) * [-959.115] (-960.093) (-960.781) (-964.285) -- 0:00:29
      532500 -- (-961.831) [-959.949] (-961.388) (-963.280) * [-959.595] (-960.351) (-959.647) (-961.823) -- 0:00:28
      533000 -- (-961.239) [-959.686] (-962.023) (-963.544) * (-960.438) (-959.402) [-959.245] (-961.944) -- 0:00:28
      533500 -- (-958.683) (-960.111) [-961.730] (-960.558) * [-961.974] (-961.994) (-959.440) (-963.836) -- 0:00:28
      534000 -- [-959.993] (-959.777) (-958.439) (-958.761) * (-960.496) (-964.961) [-959.460] (-961.727) -- 0:00:28
      534500 -- (-960.234) (-962.433) [-962.149] (-959.509) * (-961.695) (-960.329) [-962.398] (-962.329) -- 0:00:28
      535000 -- (-959.738) (-963.978) [-960.589] (-959.203) * [-960.383] (-964.068) (-961.328) (-961.353) -- 0:00:28

      Average standard deviation of split frequencies: 0.011488

      535500 -- (-960.705) [-963.213] (-963.155) (-960.104) * [-963.263] (-962.624) (-959.347) (-960.609) -- 0:00:28
      536000 -- [-960.363] (-962.585) (-961.228) (-959.664) * (-961.537) [-965.188] (-959.330) (-961.647) -- 0:00:28
      536500 -- [-959.069] (-963.378) (-962.536) (-959.539) * [-960.988] (-960.630) (-961.292) (-963.986) -- 0:00:28
      537000 -- (-959.038) (-963.360) (-958.979) [-960.215] * (-959.394) (-959.434) (-961.540) [-959.678] -- 0:00:28
      537500 -- [-961.447] (-962.866) (-958.972) (-959.027) * (-959.433) (-959.280) (-960.648) [-960.438] -- 0:00:28
      538000 -- (-963.210) [-959.503] (-964.312) (-960.600) * (-959.933) (-959.434) (-966.646) [-962.828] -- 0:00:28
      538500 -- (-959.973) (-959.106) [-960.201] (-960.682) * [-960.320] (-959.927) (-967.050) (-959.595) -- 0:00:28
      539000 -- (-958.895) [-959.323] (-959.321) (-961.988) * (-960.000) (-960.214) [-960.318] (-960.317) -- 0:00:28
      539500 -- (-959.121) (-958.174) [-959.801] (-963.933) * (-964.004) (-961.755) (-960.599) [-959.269] -- 0:00:28
      540000 -- (-958.622) [-959.751] (-960.251) (-960.181) * (-963.913) [-964.002] (-959.118) (-965.038) -- 0:00:28

      Average standard deviation of split frequencies: 0.011062

      540500 -- (-959.184) (-959.887) [-959.772] (-964.634) * [-959.401] (-961.919) (-962.402) (-960.860) -- 0:00:28
      541000 -- (-963.944) (-961.465) [-958.897] (-960.919) * [-961.637] (-967.544) (-960.008) (-964.933) -- 0:00:28
      541500 -- (-962.628) [-961.524] (-963.303) (-962.888) * (-959.690) [-960.785] (-958.246) (-963.062) -- 0:00:28
      542000 -- [-960.415] (-967.348) (-964.111) (-960.751) * (-961.295) (-962.181) (-961.994) [-960.838] -- 0:00:28
      542500 -- [-961.419] (-967.151) (-961.993) (-959.099) * (-961.302) [-961.777] (-964.617) (-959.371) -- 0:00:28
      543000 -- (-959.700) (-962.388) [-961.166] (-961.358) * [-961.822] (-961.433) (-962.614) (-958.623) -- 0:00:28
      543500 -- (-961.241) (-959.621) [-959.612] (-960.527) * [-961.399] (-964.141) (-962.123) (-965.002) -- 0:00:28
      544000 -- (-959.734) (-958.799) [-959.679] (-961.409) * [-961.948] (-960.502) (-962.371) (-963.916) -- 0:00:28
      544500 -- (-965.218) (-961.280) (-960.710) [-959.066] * [-962.694] (-961.009) (-962.743) (-958.574) -- 0:00:28
      545000 -- (-958.824) [-961.253] (-961.266) (-960.633) * [-961.726] (-964.131) (-960.935) (-958.717) -- 0:00:28

      Average standard deviation of split frequencies: 0.011656

      545500 -- (-959.259) (-958.670) (-960.479) [-960.467] * (-961.452) (-959.587) [-962.580] (-960.256) -- 0:00:28
      546000 -- (-960.551) (-959.393) [-960.633] (-962.342) * [-961.916] (-959.637) (-960.072) (-961.791) -- 0:00:28
      546500 -- (-960.048) [-960.466] (-960.279) (-961.586) * (-961.573) [-962.370] (-960.814) (-961.530) -- 0:00:28
      547000 -- (-962.694) (-959.344) (-961.749) [-963.238] * [-960.937] (-959.159) (-959.580) (-961.411) -- 0:00:28
      547500 -- (-959.029) (-961.921) (-959.488) [-961.738] * (-960.063) (-961.426) [-958.971] (-959.952) -- 0:00:28
      548000 -- (-958.928) [-965.357] (-959.893) (-962.475) * (-960.272) (-960.669) (-959.518) [-959.815] -- 0:00:28
      548500 -- (-958.657) (-960.192) [-961.707] (-959.909) * (-959.260) (-961.645) [-962.709] (-960.392) -- 0:00:27
      549000 -- (-958.657) (-960.872) (-960.332) [-959.081] * (-965.377) (-965.483) [-961.573] (-960.575) -- 0:00:27
      549500 -- [-960.024] (-958.426) (-961.100) (-960.115) * [-959.422] (-960.228) (-959.496) (-960.364) -- 0:00:27
      550000 -- [-958.612] (-958.837) (-960.311) (-959.927) * [-959.734] (-959.535) (-960.687) (-961.071) -- 0:00:27

      Average standard deviation of split frequencies: 0.010754

      550500 -- [-960.850] (-959.262) (-960.884) (-959.196) * (-962.713) [-959.719] (-962.452) (-958.989) -- 0:00:27
      551000 -- [-959.617] (-960.802) (-958.714) (-959.351) * [-961.450] (-959.191) (-966.319) (-959.345) -- 0:00:27
      551500 -- [-959.458] (-960.220) (-960.071) (-963.110) * [-959.712] (-963.876) (-959.539) (-959.623) -- 0:00:27
      552000 -- [-960.717] (-962.329) (-961.586) (-960.908) * (-959.661) (-960.708) [-961.798] (-964.983) -- 0:00:27
      552500 -- (-960.875) (-961.856) (-965.684) [-960.068] * (-958.951) (-959.576) (-960.645) [-962.928] -- 0:00:27
      553000 -- (-963.390) [-959.488] (-959.725) (-963.666) * (-964.013) [-959.421] (-960.820) (-961.122) -- 0:00:27
      553500 -- (-960.954) [-959.978] (-959.780) (-961.648) * (-959.730) [-959.863] (-960.621) (-960.981) -- 0:00:27
      554000 -- (-962.256) [-958.776] (-960.065) (-958.717) * [-965.333] (-958.349) (-960.876) (-960.373) -- 0:00:27
      554500 -- [-960.888] (-962.260) (-961.033) (-960.519) * (-963.046) [-958.327] (-958.889) (-960.280) -- 0:00:27
      555000 -- (-960.058) (-960.868) [-959.762] (-962.221) * (-960.098) [-958.438] (-961.298) (-960.014) -- 0:00:27

      Average standard deviation of split frequencies: 0.010386

      555500 -- (-962.640) (-958.795) [-960.489] (-963.303) * [-959.702] (-959.420) (-959.711) (-959.374) -- 0:00:27
      556000 -- (-959.955) (-959.002) (-960.086) [-962.721] * (-959.925) (-961.825) (-963.313) [-959.280] -- 0:00:27
      556500 -- (-962.195) (-959.945) [-958.338] (-961.165) * [-958.292] (-961.812) (-963.826) (-959.353) -- 0:00:27
      557000 -- (-959.845) (-961.463) [-961.807] (-962.396) * (-959.488) [-961.151] (-959.097) (-964.340) -- 0:00:27
      557500 -- (-959.279) (-962.870) [-963.862] (-961.712) * (-960.045) (-963.563) [-959.311] (-960.195) -- 0:00:27
      558000 -- (-961.898) (-961.126) (-963.634) [-960.847] * (-965.032) [-960.151] (-959.739) (-961.506) -- 0:00:27
      558500 -- (-959.539) (-961.492) (-960.594) [-959.242] * (-960.904) [-960.669] (-962.304) (-960.589) -- 0:00:27
      559000 -- [-960.163] (-960.188) (-958.500) (-960.379) * [-959.853] (-959.704) (-960.824) (-961.970) -- 0:00:27
      559500 -- (-961.380) (-961.545) (-959.613) [-961.167] * (-959.602) [-962.253] (-962.659) (-960.393) -- 0:00:27
      560000 -- (-961.566) [-963.770] (-961.910) (-963.281) * (-959.305) (-960.190) [-961.484] (-962.642) -- 0:00:27

      Average standard deviation of split frequencies: 0.009984

      560500 -- (-960.828) (-959.738) (-966.603) [-960.433] * (-962.528) (-961.610) [-960.988] (-958.415) -- 0:00:27
      561000 -- (-959.666) (-958.675) (-961.762) [-960.522] * (-968.962) (-965.773) [-960.111] (-962.952) -- 0:00:27
      561500 -- [-959.463] (-962.205) (-958.900) (-960.680) * [-965.362] (-961.283) (-960.763) (-960.486) -- 0:00:27
      562000 -- (-959.710) (-965.697) (-963.363) [-960.809] * [-960.970] (-961.297) (-959.339) (-959.796) -- 0:00:27
      562500 -- (-962.226) [-959.551] (-961.865) (-958.242) * (-961.376) (-960.814) (-963.452) [-960.210] -- 0:00:27
      563000 -- (-962.576) [-959.621] (-963.649) (-960.886) * (-961.274) (-962.845) (-961.572) [-960.429] -- 0:00:27
      563500 -- (-960.087) [-961.808] (-961.780) (-958.825) * (-961.444) (-969.275) (-961.577) [-958.396] -- 0:00:27
      564000 -- (-959.155) (-959.520) [-959.241] (-962.647) * (-963.552) (-959.360) [-959.827] (-958.179) -- 0:00:27
      564500 -- (-958.783) [-959.143] (-959.051) (-961.680) * [-966.083] (-960.750) (-961.066) (-958.805) -- 0:00:27
      565000 -- (-960.601) (-958.228) [-959.237] (-960.958) * (-962.295) [-961.068] (-961.153) (-962.299) -- 0:00:26

      Average standard deviation of split frequencies: 0.010567

      565500 -- (-959.317) (-960.728) [-959.455] (-960.018) * (-962.938) [-958.766] (-961.036) (-958.980) -- 0:00:26
      566000 -- [-959.317] (-958.510) (-961.211) (-961.187) * [-960.092] (-958.766) (-960.078) (-958.996) -- 0:00:26
      566500 -- (-959.718) (-962.992) (-959.789) [-960.147] * [-960.289] (-960.172) (-961.005) (-959.142) -- 0:00:26
      567000 -- (-959.304) (-962.861) [-959.438] (-961.041) * (-966.581) [-959.363] (-963.359) (-960.360) -- 0:00:26
      567500 -- [-959.292] (-964.489) (-960.310) (-964.126) * (-964.792) [-958.459] (-964.222) (-967.788) -- 0:00:26
      568000 -- (-961.931) (-962.257) [-960.648] (-960.785) * (-961.894) [-960.816] (-958.668) (-961.944) -- 0:00:26
      568500 -- [-958.766] (-960.943) (-959.461) (-959.182) * (-963.931) (-962.499) [-959.665] (-961.381) -- 0:00:26
      569000 -- (-961.313) (-959.936) [-959.530] (-959.297) * (-965.145) (-963.000) [-959.085] (-959.939) -- 0:00:26
      569500 -- (-961.513) (-961.274) (-962.046) [-958.586] * (-960.045) (-960.713) (-958.474) [-959.416] -- 0:00:26
      570000 -- (-959.721) (-961.029) [-960.261] (-961.218) * (-960.241) (-962.784) (-958.505) [-959.810] -- 0:00:26

      Average standard deviation of split frequencies: 0.010636

      570500 -- [-959.035] (-963.185) (-958.993) (-959.519) * [-962.717] (-960.771) (-960.320) (-961.566) -- 0:00:26
      571000 -- (-961.720) (-960.548) [-959.001] (-961.445) * (-962.005) (-963.992) [-960.170] (-962.228) -- 0:00:26
      571500 -- [-964.207] (-959.028) (-961.293) (-961.993) * (-959.922) (-961.120) (-962.639) [-963.568] -- 0:00:26
      572000 -- (-963.648) [-961.354] (-962.311) (-961.553) * [-961.429] (-959.927) (-959.050) (-966.272) -- 0:00:26
      572500 -- [-958.787] (-964.176) (-961.207) (-963.328) * (-959.806) [-959.108] (-961.848) (-964.029) -- 0:00:26
      573000 -- (-960.153) (-961.737) (-958.597) [-961.639] * (-960.259) (-959.899) (-962.496) [-961.726] -- 0:00:26
      573500 -- (-959.103) [-958.871] (-959.681) (-962.907) * (-964.780) [-961.826] (-967.084) (-959.670) -- 0:00:26
      574000 -- (-962.593) (-958.865) [-960.104] (-959.552) * (-959.202) (-964.216) [-960.351] (-959.022) -- 0:00:26
      574500 -- (-959.245) (-958.497) (-959.728) [-960.063] * [-964.926] (-962.356) (-959.501) (-958.988) -- 0:00:26
      575000 -- (-960.002) [-958.502] (-963.743) (-961.108) * (-961.796) (-960.399) [-959.901] (-962.019) -- 0:00:26

      Average standard deviation of split frequencies: 0.010486

      575500 -- (-960.495) (-958.819) (-960.231) [-961.669] * (-961.061) [-959.421] (-961.009) (-963.190) -- 0:00:26
      576000 -- (-960.160) (-960.037) [-959.235] (-963.688) * [-960.026] (-959.689) (-959.965) (-958.664) -- 0:00:26
      576500 -- (-963.178) (-960.641) [-960.508] (-960.079) * (-961.502) (-959.616) [-959.861] (-959.863) -- 0:00:26
      577000 -- (-959.788) (-959.386) (-960.360) [-960.092] * (-961.936) [-960.627] (-958.735) (-958.742) -- 0:00:26
      577500 -- [-961.712] (-958.888) (-962.964) (-959.293) * (-963.215) (-964.578) [-961.643] (-960.913) -- 0:00:26
      578000 -- (-958.723) [-959.234] (-969.513) (-961.396) * (-964.287) [-960.514] (-959.835) (-961.503) -- 0:00:26
      578500 -- [-958.889] (-959.903) (-964.914) (-958.943) * [-963.494] (-959.864) (-958.686) (-965.849) -- 0:00:26
      579000 -- [-962.559] (-961.292) (-959.686) (-962.546) * (-964.573) (-965.346) [-958.805] (-958.418) -- 0:00:26
      579500 -- [-961.181] (-959.807) (-958.910) (-960.809) * [-963.384] (-960.133) (-959.200) (-959.506) -- 0:00:26
      580000 -- (-961.859) (-962.269) (-959.852) [-958.915] * (-962.703) [-959.385] (-961.863) (-960.247) -- 0:00:26

      Average standard deviation of split frequencies: 0.009285

      580500 -- (-960.123) [-959.112] (-958.740) (-962.090) * (-962.965) (-959.351) [-962.918] (-959.291) -- 0:00:26
      581000 -- (-963.354) (-959.185) [-959.156] (-962.789) * (-962.612) [-958.585] (-961.440) (-963.840) -- 0:00:25
      581500 -- (-960.511) (-960.492) [-959.494] (-962.166) * (-959.317) [-959.720] (-959.788) (-959.653) -- 0:00:25
      582000 -- (-960.144) (-959.829) [-960.123] (-959.241) * (-958.402) (-962.276) (-961.805) [-963.602] -- 0:00:25
      582500 -- (-963.367) (-961.726) (-960.759) [-959.067] * (-958.326) (-961.544) (-961.305) [-961.910] -- 0:00:25
      583000 -- [-959.004] (-958.536) (-959.059) (-959.189) * [-959.510] (-962.399) (-962.848) (-959.939) -- 0:00:25
      583500 -- (-960.412) (-958.907) (-958.648) [-959.573] * (-959.218) (-960.356) (-960.992) [-959.458] -- 0:00:25
      584000 -- (-965.250) [-959.415] (-958.829) (-960.779) * (-959.640) (-960.575) (-963.245) [-958.454] -- 0:00:25
      584500 -- (-961.084) (-960.498) (-960.835) [-959.595] * (-960.487) [-959.779] (-959.113) (-962.393) -- 0:00:25
      585000 -- (-962.395) (-959.040) [-959.877] (-960.317) * (-958.470) [-965.000] (-959.538) (-960.504) -- 0:00:25

      Average standard deviation of split frequencies: 0.009653

      585500 -- (-958.681) (-960.105) [-960.979] (-960.742) * (-958.651) [-960.783] (-962.621) (-961.116) -- 0:00:25
      586000 -- (-960.709) (-960.379) [-961.154] (-959.039) * [-959.778] (-959.502) (-960.655) (-960.180) -- 0:00:25
      586500 -- (-959.510) [-959.190] (-961.059) (-959.695) * (-961.103) (-963.149) (-959.956) [-959.643] -- 0:00:25
      587000 -- (-958.655) (-959.066) [-958.633] (-960.529) * [-959.286] (-963.270) (-958.880) (-960.369) -- 0:00:25
      587500 -- (-959.281) (-959.265) (-959.273) [-960.632] * [-960.617] (-960.484) (-958.841) (-960.485) -- 0:00:25
      588000 -- (-960.682) (-962.838) [-962.796] (-961.127) * [-959.240] (-961.189) (-959.291) (-964.060) -- 0:00:25
      588500 -- (-963.892) [-960.135] (-968.096) (-961.057) * (-960.551) (-960.209) [-958.486] (-961.228) -- 0:00:25
      589000 -- (-962.997) [-960.048] (-963.334) (-959.313) * (-960.760) (-960.504) [-959.392] (-963.325) -- 0:00:25
      589500 -- [-960.686] (-959.790) (-961.619) (-959.011) * [-963.541] (-960.602) (-959.210) (-961.984) -- 0:00:25
      590000 -- (-961.649) [-960.481] (-962.683) (-963.708) * (-960.321) (-961.343) [-960.404] (-960.199) -- 0:00:25

      Average standard deviation of split frequencies: 0.010187

      590500 -- [-959.692] (-961.551) (-960.532) (-960.825) * [-958.934] (-959.720) (-962.958) (-959.197) -- 0:00:25
      591000 -- (-961.384) [-960.566] (-960.778) (-959.406) * (-960.324) (-961.652) [-961.732] (-960.283) -- 0:00:25
      591500 -- (-960.178) (-959.303) [-961.023] (-963.808) * (-962.470) (-964.376) (-964.808) [-961.811] -- 0:00:25
      592000 -- (-959.936) (-958.214) (-959.484) [-960.985] * (-963.488) (-963.496) (-959.912) [-960.658] -- 0:00:25
      592500 -- [-958.854] (-958.986) (-959.387) (-964.371) * [-960.460] (-959.376) (-959.976) (-958.990) -- 0:00:25
      593000 -- (-963.646) [-958.371] (-959.255) (-961.196) * (-961.044) [-961.324] (-966.220) (-960.366) -- 0:00:25
      593500 -- (-962.270) (-958.979) [-958.966] (-959.727) * (-960.160) (-966.951) [-964.388] (-959.666) -- 0:00:25
      594000 -- (-959.237) [-961.429] (-958.340) (-958.187) * [-960.163] (-960.314) (-961.405) (-963.556) -- 0:00:25
      594500 -- (-960.771) (-961.461) [-960.442] (-962.622) * (-959.394) (-959.810) (-966.367) [-960.084] -- 0:00:25
      595000 -- [-963.740] (-967.217) (-960.215) (-959.361) * [-959.698] (-959.937) (-959.461) (-958.924) -- 0:00:25

      Average standard deviation of split frequencies: 0.010183

      595500 -- (-962.119) (-959.088) [-959.997] (-959.822) * (-958.750) (-959.300) (-962.561) [-959.022] -- 0:00:25
      596000 -- [-959.506] (-958.799) (-958.707) (-967.398) * (-959.395) (-961.624) (-961.260) [-960.715] -- 0:00:25
      596500 -- [-963.535] (-959.078) (-959.294) (-959.893) * (-961.400) (-959.906) [-960.018] (-958.886) -- 0:00:25
      597000 -- (-964.954) [-963.477] (-960.626) (-959.110) * (-961.400) [-959.889] (-961.957) (-958.694) -- 0:00:24
      597500 -- (-961.294) [-963.221] (-960.422) (-959.214) * [-960.462] (-959.209) (-962.671) (-959.155) -- 0:00:24
      598000 -- (-961.570) (-965.537) (-959.515) [-961.301] * (-960.534) (-960.179) [-960.066] (-960.087) -- 0:00:24
      598500 -- (-963.091) [-959.029] (-961.034) (-961.871) * (-960.011) (-962.624) [-962.262] (-959.438) -- 0:00:24
      599000 -- (-959.353) (-960.500) (-960.838) [-959.499] * [-959.022] (-960.135) (-959.502) (-959.776) -- 0:00:24
      599500 -- (-961.328) (-960.443) (-960.732) [-961.149] * (-963.614) (-959.660) (-958.767) [-962.271] -- 0:00:24
      600000 -- (-959.760) (-959.819) [-959.933] (-962.154) * (-962.883) (-961.556) (-959.804) [-961.455] -- 0:00:24

      Average standard deviation of split frequencies: 0.010055

      600500 -- [-961.072] (-963.722) (-961.347) (-958.805) * (-964.240) (-962.008) (-961.730) [-960.513] -- 0:00:24
      601000 -- (-960.008) [-961.871] (-960.837) (-960.811) * (-962.378) [-962.476] (-959.635) (-962.964) -- 0:00:24
      601500 -- (-959.664) (-965.110) [-960.692] (-964.067) * (-962.657) [-964.870] (-962.532) (-962.781) -- 0:00:24
      602000 -- (-958.800) (-959.447) (-961.853) [-959.295] * (-960.619) (-963.675) [-960.757] (-961.368) -- 0:00:24
      602500 -- [-959.830] (-959.243) (-961.562) (-961.777) * (-958.367) [-960.102] (-963.637) (-960.487) -- 0:00:24
      603000 -- (-959.645) [-965.272] (-961.793) (-958.854) * (-960.854) (-960.475) (-963.102) [-961.379] -- 0:00:24
      603500 -- (-960.344) (-961.603) [-960.328] (-964.129) * (-962.476) (-960.469) [-959.899] (-959.841) -- 0:00:24
      604000 -- (-963.754) (-959.881) [-960.704] (-962.763) * [-961.838] (-961.714) (-963.033) (-958.846) -- 0:00:24
      604500 -- (-963.629) (-959.821) [-960.231] (-959.931) * [-960.378] (-961.368) (-960.102) (-960.478) -- 0:00:24
      605000 -- (-960.758) (-959.536) [-959.491] (-958.740) * [-958.998] (-960.794) (-962.619) (-961.443) -- 0:00:24

      Average standard deviation of split frequencies: 0.010064

      605500 -- (-963.112) (-962.579) [-959.337] (-958.936) * (-960.388) [-962.669] (-961.946) (-960.952) -- 0:00:24
      606000 -- [-961.269] (-960.405) (-959.241) (-959.977) * (-959.368) [-959.968] (-961.149) (-959.551) -- 0:00:24
      606500 -- (-961.852) (-963.099) [-959.718] (-961.973) * (-960.770) (-960.999) (-963.217) [-960.467] -- 0:00:24
      607000 -- (-960.514) (-959.500) [-964.844] (-959.941) * (-959.004) (-962.970) (-959.483) [-962.300] -- 0:00:24
      607500 -- (-961.293) (-962.181) [-960.291] (-963.155) * [-960.974] (-962.571) (-962.952) (-962.208) -- 0:00:24
      608000 -- (-962.787) (-960.153) [-960.869] (-962.899) * [-960.679] (-960.858) (-961.135) (-964.334) -- 0:00:24
      608500 -- (-961.062) (-960.873) (-960.841) [-963.573] * (-960.412) (-961.531) [-959.250] (-960.119) -- 0:00:24
      609000 -- (-959.576) (-962.046) (-962.375) [-962.443] * [-960.010] (-960.098) (-959.604) (-958.378) -- 0:00:24
      609500 -- (-960.543) (-959.882) (-958.704) [-961.510] * [-962.276] (-959.968) (-959.616) (-963.943) -- 0:00:24
      610000 -- (-961.821) (-960.019) (-961.436) [-960.566] * (-962.894) (-962.152) (-960.485) [-961.667] -- 0:00:24

      Average standard deviation of split frequencies: 0.010373

      610500 -- (-964.301) (-959.673) [-960.271] (-959.546) * [-961.338] (-963.222) (-960.332) (-961.667) -- 0:00:24
      611000 -- (-961.788) (-960.273) [-958.931] (-964.825) * [-959.064] (-962.455) (-958.787) (-962.513) -- 0:00:24
      611500 -- [-968.209] (-958.622) (-960.129) (-959.616) * (-959.367) (-958.819) [-960.545] (-959.702) -- 0:00:24
      612000 -- (-963.182) (-959.793) (-960.558) [-965.969] * [-960.937] (-961.504) (-960.115) (-958.116) -- 0:00:24
      612500 -- (-963.141) [-961.986] (-960.605) (-963.557) * (-959.460) (-963.076) (-962.050) [-958.354] -- 0:00:24
      613000 -- [-962.773] (-968.347) (-959.233) (-960.780) * (-958.491) (-963.291) (-960.988) [-958.479] -- 0:00:23
      613500 -- (-965.165) [-959.674] (-960.351) (-959.354) * (-959.473) [-960.678] (-961.989) (-959.025) -- 0:00:23
      614000 -- (-963.062) (-960.714) [-960.741] (-959.746) * [-959.664] (-962.444) (-958.957) (-960.393) -- 0:00:23
      614500 -- (-960.507) (-961.140) (-961.805) [-961.720] * (-962.208) (-960.383) [-958.936] (-962.859) -- 0:00:23
      615000 -- (-960.276) (-960.223) [-966.736] (-966.952) * (-963.003) [-960.530] (-959.430) (-962.103) -- 0:00:23

      Average standard deviation of split frequencies: 0.010140

      615500 -- (-963.851) [-959.466] (-962.894) (-963.258) * (-961.303) (-959.393) (-959.616) [-959.554] -- 0:00:23
      616000 -- (-961.400) (-959.965) (-961.045) [-959.762] * (-959.985) (-960.209) (-958.625) [-962.986] -- 0:00:23
      616500 -- (-962.731) [-960.503] (-962.499) (-958.608) * (-960.140) (-959.343) (-958.752) [-960.392] -- 0:00:23
      617000 -- (-961.865) [-959.504] (-961.475) (-958.735) * (-959.293) (-960.806) (-960.119) [-961.323] -- 0:00:23
      617500 -- (-963.694) (-959.448) [-962.273] (-959.745) * (-959.649) (-959.081) [-961.766] (-961.512) -- 0:00:23
      618000 -- [-965.251] (-961.392) (-960.703) (-960.120) * (-959.755) [-960.254] (-961.266) (-959.960) -- 0:00:23
      618500 -- (-959.172) (-960.999) [-962.302] (-960.500) * (-963.186) [-960.746] (-961.838) (-959.749) -- 0:00:23
      619000 -- (-959.398) (-963.255) (-962.963) [-961.876] * (-960.229) (-962.762) [-960.826] (-959.538) -- 0:00:23
      619500 -- (-964.402) [-961.633] (-963.546) (-960.752) * (-961.445) (-959.165) (-959.368) [-958.984] -- 0:00:23
      620000 -- [-959.922] (-959.349) (-962.111) (-961.700) * (-963.423) [-960.483] (-960.690) (-960.738) -- 0:00:23

      Average standard deviation of split frequencies: 0.009874

      620500 -- (-960.999) [-959.754] (-961.527) (-962.311) * (-959.331) [-960.125] (-960.042) (-959.886) -- 0:00:23
      621000 -- (-960.267) [-960.883] (-965.069) (-960.870) * (-960.021) [-960.210] (-962.264) (-959.364) -- 0:00:23
      621500 -- (-962.960) (-959.683) [-963.779] (-962.387) * [-959.071] (-959.269) (-960.011) (-960.504) -- 0:00:23
      622000 -- (-959.157) (-958.896) (-961.493) [-959.494] * [-961.757] (-963.575) (-958.765) (-959.166) -- 0:00:23
      622500 -- (-959.206) (-960.702) (-964.389) [-959.270] * [-959.253] (-962.088) (-964.371) (-962.266) -- 0:00:23
      623000 -- (-965.750) (-961.637) [-959.031] (-959.564) * (-959.285) [-960.077] (-964.484) (-961.449) -- 0:00:23
      623500 -- (-965.938) (-960.270) (-962.182) [-963.135] * (-959.019) (-964.511) (-960.081) [-959.858] -- 0:00:23
      624000 -- [-960.329] (-964.539) (-969.819) (-960.799) * [-962.668] (-960.231) (-961.847) (-962.728) -- 0:00:23
      624500 -- [-961.504] (-961.765) (-960.581) (-961.131) * (-967.688) (-958.941) (-961.677) [-959.137] -- 0:00:23
      625000 -- [-959.599] (-959.684) (-960.617) (-959.945) * (-970.328) [-959.767] (-961.113) (-962.831) -- 0:00:23

      Average standard deviation of split frequencies: 0.009978

      625500 -- (-958.930) [-958.731] (-958.522) (-963.261) * [-960.084] (-964.387) (-959.382) (-963.494) -- 0:00:23
      626000 -- [-959.436] (-960.027) (-960.482) (-958.920) * (-959.332) [-964.576] (-959.996) (-962.865) -- 0:00:23
      626500 -- (-959.249) (-958.736) (-958.688) [-958.266] * (-965.298) (-964.418) [-959.983] (-958.950) -- 0:00:23
      627000 -- (-959.945) [-959.320] (-958.664) (-958.934) * (-958.748) (-960.825) [-960.776] (-960.139) -- 0:00:23
      627500 -- (-963.063) [-962.943] (-958.979) (-958.834) * [-959.816] (-961.344) (-960.702) (-960.826) -- 0:00:23
      628000 -- (-962.067) (-963.037) (-959.153) [-958.937] * (-962.355) (-961.377) [-960.361] (-960.272) -- 0:00:23
      628500 -- (-959.494) (-963.887) [-958.332] (-960.451) * (-962.635) (-958.845) [-960.775] (-960.013) -- 0:00:23
      629000 -- [-959.289] (-962.922) (-964.108) (-966.341) * (-966.198) (-961.455) (-963.228) [-961.456] -- 0:00:23
      629500 -- (-961.307) (-960.651) (-961.156) [-960.280] * (-961.310) (-960.665) [-960.464] (-959.969) -- 0:00:22
      630000 -- [-961.210] (-965.483) (-959.496) (-960.463) * [-964.019] (-959.469) (-960.166) (-965.302) -- 0:00:22

      Average standard deviation of split frequencies: 0.009764

      630500 -- (-963.439) (-963.615) [-959.471] (-960.356) * (-960.811) (-959.293) (-959.286) [-965.875] -- 0:00:22
      631000 -- (-960.877) [-961.477] (-962.038) (-961.720) * [-961.145] (-962.373) (-963.818) (-960.998) -- 0:00:22
      631500 -- (-960.617) (-959.689) [-959.854] (-961.250) * [-962.409] (-960.313) (-959.375) (-965.199) -- 0:00:22
      632000 -- [-958.908] (-958.539) (-958.505) (-958.523) * (-962.755) (-960.083) (-960.257) [-961.002] -- 0:00:22
      632500 -- (-959.501) [-958.877] (-962.883) (-959.750) * (-960.909) [-960.771] (-958.799) (-963.779) -- 0:00:22
      633000 -- [-958.779] (-960.187) (-961.236) (-959.353) * (-959.703) (-958.882) [-962.837] (-963.276) -- 0:00:22
      633500 -- (-960.924) [-959.489] (-958.519) (-959.858) * [-958.794] (-961.261) (-960.000) (-962.734) -- 0:00:22
      634000 -- (-963.761) (-958.181) (-958.742) [-964.566] * (-960.681) (-959.373) [-960.883] (-960.590) -- 0:00:22
      634500 -- (-962.153) (-959.198) (-959.197) [-959.887] * (-961.496) (-960.169) [-959.336] (-958.372) -- 0:00:22
      635000 -- [-960.347] (-964.465) (-960.933) (-963.662) * (-963.931) [-960.198] (-959.727) (-958.445) -- 0:00:22

      Average standard deviation of split frequencies: 0.009682

      635500 -- (-960.146) (-963.233) (-962.416) [-962.030] * (-959.058) (-971.509) (-960.615) [-959.974] -- 0:00:22
      636000 -- (-960.157) (-963.407) (-958.963) [-960.327] * (-960.235) [-962.233] (-959.498) (-958.531) -- 0:00:22
      636500 -- (-965.797) (-964.913) (-960.016) [-959.966] * (-960.086) (-959.985) [-959.987] (-959.742) -- 0:00:22
      637000 -- [-961.673] (-968.638) (-960.726) (-960.395) * (-961.123) [-959.900] (-959.324) (-958.714) -- 0:00:22
      637500 -- (-961.493) (-963.449) [-958.260] (-960.572) * (-961.081) (-960.486) [-959.386] (-958.752) -- 0:00:22
      638000 -- (-961.080) (-962.180) (-962.680) [-960.996] * [-961.447] (-960.508) (-960.729) (-959.868) -- 0:00:22
      638500 -- (-958.620) (-961.413) [-960.972] (-958.995) * (-960.737) [-960.286] (-961.699) (-959.603) -- 0:00:22
      639000 -- (-960.660) (-959.399) [-964.618] (-959.961) * (-967.665) (-959.950) (-959.658) [-959.948] -- 0:00:22
      639500 -- (-961.906) [-958.326] (-960.387) (-960.793) * [-959.513] (-964.877) (-959.950) (-959.716) -- 0:00:22
      640000 -- (-961.325) [-959.358] (-960.751) (-958.340) * [-960.982] (-968.994) (-958.876) (-964.652) -- 0:00:22

      Average standard deviation of split frequencies: 0.009427

      640500 -- (-960.037) (-958.698) (-961.897) [-959.620] * (-961.900) (-961.546) [-960.481] (-961.354) -- 0:00:22
      641000 -- (-961.161) (-961.500) (-958.800) [-958.452] * (-964.050) [-958.725] (-961.752) (-958.921) -- 0:00:22
      641500 -- (-961.282) (-962.457) (-960.173) [-960.406] * (-960.317) (-964.005) [-962.284] (-959.596) -- 0:00:22
      642000 -- (-963.640) [-958.815] (-959.309) (-960.351) * (-961.002) [-959.289] (-962.484) (-959.911) -- 0:00:22
      642500 -- (-961.498) (-960.124) (-967.675) [-961.084] * (-959.690) [-960.313] (-960.317) (-960.742) -- 0:00:22
      643000 -- [-959.591] (-961.007) (-963.713) (-961.249) * (-960.982) (-962.157) (-962.307) [-960.821] -- 0:00:22
      643500 -- (-959.021) (-961.194) [-960.068] (-961.473) * (-960.535) (-960.395) [-960.932] (-959.190) -- 0:00:22
      644000 -- [-959.303] (-963.045) (-959.442) (-964.423) * (-959.021) (-960.503) (-958.870) [-960.976] -- 0:00:22
      644500 -- [-960.986] (-959.554) (-958.560) (-959.994) * (-963.201) (-959.168) [-961.411] (-964.854) -- 0:00:22
      645000 -- (-959.931) (-961.277) (-960.918) [-961.135] * (-963.873) [-960.729] (-960.617) (-959.748) -- 0:00:22

      Average standard deviation of split frequencies: 0.008757

      645500 -- (-959.179) (-959.827) (-959.825) [-961.194] * (-961.078) (-962.862) [-962.228] (-961.891) -- 0:00:21
      646000 -- (-961.367) [-959.254] (-967.086) (-964.840) * [-958.959] (-962.303) (-962.789) (-959.735) -- 0:00:21
      646500 -- [-959.701] (-961.766) (-962.291) (-962.242) * (-958.454) (-960.425) [-959.568] (-960.511) -- 0:00:21
      647000 -- (-961.244) [-958.363] (-962.628) (-961.131) * (-958.661) [-960.902] (-960.088) (-966.621) -- 0:00:21
      647500 -- [-961.118] (-958.806) (-965.403) (-960.627) * (-968.522) (-959.412) (-960.174) [-961.468] -- 0:00:21
      648000 -- (-964.110) (-960.220) (-961.175) [-960.145] * (-961.907) (-960.573) (-965.412) [-961.832] -- 0:00:21
      648500 -- (-964.227) [-964.916] (-960.425) (-960.475) * (-970.705) (-960.876) (-964.671) [-961.601] -- 0:00:21
      649000 -- (-959.845) (-960.515) (-961.014) [-961.507] * (-961.361) (-960.648) (-962.837) [-959.763] -- 0:00:21
      649500 -- (-967.558) (-958.811) (-959.542) [-960.635] * (-961.517) (-960.508) (-959.481) [-961.598] -- 0:00:21
      650000 -- (-962.981) (-959.111) (-959.028) [-960.845] * [-965.486] (-958.943) (-959.220) (-959.987) -- 0:00:21

      Average standard deviation of split frequencies: 0.008468

      650500 -- (-964.188) (-958.609) [-959.032] (-959.141) * [-960.179] (-960.171) (-962.201) (-958.212) -- 0:00:21
      651000 -- (-964.813) [-960.805] (-958.857) (-960.670) * (-961.888) (-959.590) (-958.927) [-958.186] -- 0:00:21
      651500 -- [-961.734] (-962.733) (-960.093) (-959.090) * (-963.560) (-959.805) (-962.984) [-960.947] -- 0:00:21
      652000 -- (-960.058) [-960.538] (-961.866) (-959.569) * (-961.342) [-960.012] (-963.031) (-960.458) -- 0:00:21
      652500 -- [-961.642] (-962.799) (-966.604) (-961.443) * (-958.936) [-960.507] (-964.840) (-961.131) -- 0:00:21
      653000 -- (-960.360) [-959.211] (-965.975) (-960.148) * (-961.730) (-959.784) [-959.467] (-960.810) -- 0:00:21
      653500 -- (-961.434) [-959.832] (-959.313) (-963.983) * (-960.831) [-958.489] (-959.242) (-959.758) -- 0:00:21
      654000 -- (-963.927) [-960.093] (-960.947) (-959.933) * [-960.205] (-959.382) (-960.177) (-959.054) -- 0:00:21
      654500 -- (-959.247) (-958.673) [-966.237] (-959.416) * [-959.638] (-961.551) (-961.253) (-959.732) -- 0:00:21
      655000 -- [-961.720] (-960.602) (-961.098) (-962.045) * [-960.687] (-964.775) (-961.958) (-959.459) -- 0:00:21

      Average standard deviation of split frequencies: 0.008129

      655500 -- (-963.653) (-961.533) [-961.250] (-961.045) * (-960.383) [-962.173] (-959.353) (-960.060) -- 0:00:21
      656000 -- [-961.646] (-966.077) (-959.804) (-963.800) * [-960.025] (-964.089) (-960.850) (-958.967) -- 0:00:21
      656500 -- (-966.224) [-958.411] (-961.450) (-960.953) * (-959.778) (-959.389) [-959.025] (-960.652) -- 0:00:21
      657000 -- (-959.386) (-960.296) [-960.027] (-961.491) * (-961.766) (-959.321) (-958.772) [-959.695] -- 0:00:21
      657500 -- [-958.887] (-960.947) (-959.219) (-963.000) * [-958.885] (-961.655) (-961.330) (-961.862) -- 0:00:21
      658000 -- (-958.288) [-958.996] (-960.002) (-966.069) * [-959.056] (-959.838) (-961.094) (-962.595) -- 0:00:21
      658500 -- [-959.481] (-958.989) (-959.767) (-964.601) * (-959.525) (-962.528) [-962.067] (-958.256) -- 0:00:21
      659000 -- (-960.511) [-960.800] (-961.520) (-960.237) * [-963.224] (-963.882) (-959.950) (-958.213) -- 0:00:21
      659500 -- (-962.208) (-961.238) [-958.457] (-959.891) * (-963.080) (-962.962) (-960.381) [-961.462] -- 0:00:21
      660000 -- (-964.621) (-960.727) [-960.301] (-962.063) * [-964.789] (-959.406) (-960.154) (-964.915) -- 0:00:21

      Average standard deviation of split frequencies: 0.008250

      660500 -- (-962.047) (-963.741) (-961.732) [-961.006] * [-962.752] (-959.902) (-960.686) (-962.061) -- 0:00:21
      661000 -- (-959.859) (-960.151) [-960.774] (-959.316) * (-964.188) (-959.748) [-961.870] (-961.521) -- 0:00:21
      661500 -- (-961.613) [-961.145] (-960.427) (-966.878) * (-961.369) [-960.932] (-964.635) (-967.467) -- 0:00:20
      662000 -- (-964.906) (-959.548) (-958.650) [-958.973] * (-958.864) [-959.987] (-964.267) (-965.042) -- 0:00:20
      662500 -- (-958.965) (-959.271) [-958.858] (-959.337) * [-960.392] (-964.809) (-964.979) (-960.643) -- 0:00:20
      663000 -- (-965.303) (-965.746) [-959.301] (-962.187) * (-960.974) [-960.857] (-964.537) (-960.420) -- 0:00:20
      663500 -- [-958.773] (-959.634) (-959.111) (-959.332) * (-961.276) [-961.864] (-961.115) (-960.998) -- 0:00:20
      664000 -- (-959.700) (-960.416) [-959.449] (-960.429) * (-959.700) [-962.063] (-959.444) (-960.531) -- 0:00:20
      664500 -- (-965.683) (-960.109) (-961.003) [-960.067] * (-958.738) (-961.588) (-959.914) [-959.204] -- 0:00:20
      665000 -- (-960.125) (-959.313) (-960.332) [-960.797] * [-961.519] (-960.464) (-959.775) (-961.106) -- 0:00:20

      Average standard deviation of split frequencies: 0.008715

      665500 -- [-959.336] (-959.195) (-958.961) (-961.709) * (-961.351) (-959.418) (-958.958) [-962.765] -- 0:00:20
      666000 -- [-959.504] (-961.420) (-958.703) (-960.787) * [-958.813] (-958.189) (-958.826) (-960.555) -- 0:00:20
      666500 -- (-967.276) (-960.498) [-964.508] (-959.241) * (-959.449) (-961.426) (-960.666) [-959.137] -- 0:00:20
      667000 -- (-959.215) (-961.785) (-959.361) [-958.749] * [-959.047] (-960.283) (-960.718) (-961.264) -- 0:00:20
      667500 -- (-959.021) (-961.666) [-958.382] (-961.636) * (-960.413) (-961.140) [-958.584] (-960.771) -- 0:00:20
      668000 -- (-959.552) [-962.170] (-961.599) (-961.238) * [-959.711] (-962.551) (-963.280) (-960.546) -- 0:00:20
      668500 -- (-959.032) (-963.272) [-960.664] (-959.207) * (-959.238) (-961.331) (-963.996) [-961.143] -- 0:00:20
      6690