--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:29:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -959.81 -962.95
2 -959.79 -962.80
--------------------------------------
TOTAL -959.80 -962.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886814 0.089835 0.372569 1.484912 0.850404 1311.18 1365.28 1.000
r(A<->C){all} 0.181000 0.023197 0.000059 0.490739 0.140454 91.91 143.18 1.006
r(A<->G){all} 0.171381 0.021104 0.000007 0.469425 0.132701 239.03 281.60 1.000
r(A<->T){all} 0.162604 0.018610 0.000091 0.435354 0.130305 125.70 163.28 1.005
r(C<->G){all} 0.168126 0.019947 0.000125 0.441893 0.129410 150.08 203.51 1.003
r(C<->T){all} 0.159770 0.019525 0.000012 0.443707 0.121128 132.20 218.94 1.000
r(G<->T){all} 0.157119 0.018060 0.000020 0.433644 0.120413 201.77 250.20 1.000
pi(A){all} 0.209931 0.000251 0.180279 0.242889 0.209687 1219.39 1330.38 1.000
pi(C){all} 0.280739 0.000294 0.246438 0.313759 0.280382 1268.20 1299.27 1.000
pi(G){all} 0.328884 0.000317 0.294117 0.362896 0.328518 1315.56 1408.28 1.000
pi(T){all} 0.180446 0.000203 0.153787 0.209039 0.180230 1080.18 1204.76 1.000
alpha{1,2} 0.419369 0.225127 0.000181 1.398486 0.250816 1026.29 1176.67 1.000
alpha{3} 0.449830 0.223991 0.000326 1.413658 0.289434 959.55 1171.41 1.001
pinvar{all} 0.997804 0.000007 0.992774 0.999999 0.998625 1304.50 1305.57 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -906.153463
Model 2: PositiveSelection -906.153435
Model 0: one-ratio -906.153467
Model 7: beta -906.153482
Model 8: beta&w>1 -906.153435
Model 0 vs 1 7.999999979801942E-6
Model 2 vs 1 5.600000008598727E-5
Model 8 vs 7 9.400000021742017E-5
>C1
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C2
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C3
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C4
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C5
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C6
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=235
C1 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C2 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C3 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C4 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C5 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C6 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
**************************************************
C1 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C2 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C3 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C4 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C5 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C6 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
**************************************************
C1 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C2 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C3 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C4 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C5 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C6 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
**************************************************
C1 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C2 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C3 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C4 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C5 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C6 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
**************************************************
C1 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C2 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C3 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C4 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C5 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C6 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7050]--->[7050]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.775 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C2 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C3 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C4 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C5 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
C6 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
**************************************************
C1 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C2 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C3 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C4 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C5 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
C6 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
**************************************************
C1 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C2 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C3 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C4 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C5 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
C6 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
**************************************************
C1 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C2 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C3 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C4 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C5 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
C6 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
**************************************************
C1 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C2 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C3 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C4 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C5 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
C6 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
***********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C2 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C3 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C4 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C5 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
C6 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
**************************************************
C1 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C2 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C3 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C4 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C5 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
C6 CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
**************************************************
C1 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C2 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C3 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C4 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C5 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
C6 CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
**************************************************
C1 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C2 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C3 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C4 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C5 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
C6 GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
**************************************************
C1 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C2 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C3 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C4 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C5 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
C6 CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
**************************************************
C1 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C2 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C3 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C4 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C5 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
C6 CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
**************************************************
C1 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C2 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C3 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C4 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C5 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
C6 ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
**************************************************
C1 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C2 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C3 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C4 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C5 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
C6 ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
**************************************************
C1 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C2 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C3 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C4 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C5 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
C6 GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
**************************************************
C1 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C2 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C3 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C4 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C5 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
C6 AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
**************************************************
C1 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C2 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C3 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C4 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C5 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
C6 ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
**************************************************
C1 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C2 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C3 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C4 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C5 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
C6 GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
**************************************************
C1 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C2 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C3 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C4 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C5 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
C6 CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
**************************************************
C1 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C2 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C3 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C4 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C5 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
C6 TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
**************************************************
C1 AGGAG
C2 AGGAG
C3 AGGAG
C4 AGGAG
C5 AGGAG
C6 AGGAG
*****
>C1
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C2
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C3
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C4
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C5
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C6
ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG
CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT
CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC
GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA
CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG
CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG
ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC
ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC
GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC
AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA
ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC
GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG
CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC
TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG
AGGAG
>C1
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C2
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C3
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C4
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C5
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
>C6
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 705 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789719
Setting output file names to "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1188441707
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0360240304
Seed = 269564717
Swapseed = 1579789719
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1577.823798 -- -24.965149
Chain 2 -- -1577.823558 -- -24.965149
Chain 3 -- -1577.823707 -- -24.965149
Chain 4 -- -1577.823798 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1577.823558 -- -24.965149
Chain 2 -- -1577.823798 -- -24.965149
Chain 3 -- -1577.823707 -- -24.965149
Chain 4 -- -1577.823707 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1577.824] (-1577.824) (-1577.824) (-1577.824) * [-1577.824] (-1577.824) (-1577.824) (-1577.824)
500 -- (-979.713) (-984.628) [-971.818] (-977.940) * (-977.700) [-966.473] (-983.235) (-968.185) -- 0:00:00
1000 -- [-967.512] (-974.609) (-975.676) (-978.303) * (-966.423) (-970.736) (-971.631) [-969.759] -- 0:00:00
1500 -- [-967.280] (-972.356) (-974.503) (-983.543) * (-970.827) (-965.063) [-969.182] (-973.826) -- 0:00:00
2000 -- (-965.798) [-964.533] (-973.489) (-967.025) * (-971.145) (-969.722) (-967.342) [-966.570] -- 0:08:19
2500 -- (-970.164) (-969.569) [-961.716] (-966.345) * (-969.435) (-976.029) [-966.093] (-971.399) -- 0:06:39
3000 -- (-964.854) (-963.132) [-968.972] (-975.453) * (-970.401) (-969.874) [-963.556] (-976.648) -- 0:05:32
3500 -- (-974.072) (-982.987) [-967.001] (-970.160) * (-968.301) [-966.984] (-970.143) (-972.781) -- 0:04:44
4000 -- (-971.990) (-970.139) [-965.299] (-967.543) * (-974.422) [-974.281] (-969.892) (-963.547) -- 0:04:09
4500 -- (-971.027) [-976.668] (-976.224) (-963.944) * (-972.245) [-974.787] (-973.436) (-974.537) -- 0:03:41
5000 -- [-970.886] (-977.721) (-970.837) (-964.925) * (-973.712) (-975.970) (-967.282) [-969.682] -- 0:03:19
Average standard deviation of split frequencies: 0.117851
5500 -- (-972.167) [-966.269] (-964.812) (-972.280) * [-974.219] (-970.551) (-974.656) (-970.649) -- 0:03:00
6000 -- (-970.775) (-971.269) [-970.080] (-969.284) * (-965.859) [-970.406] (-977.111) (-967.717) -- 0:02:45
6500 -- (-966.500) (-967.782) [-972.310] (-970.015) * [-964.918] (-972.273) (-969.954) (-971.336) -- 0:02:32
7000 -- [-967.659] (-974.278) (-971.423) (-974.658) * [-967.840] (-963.002) (-970.414) (-968.642) -- 0:02:21
7500 -- (-974.212) [-970.024] (-966.991) (-970.185) * (-981.992) [-970.778] (-959.919) (-972.779) -- 0:02:12
8000 -- (-965.911) (-969.257) (-974.932) [-966.736] * (-971.273) (-966.604) [-959.552] (-970.922) -- 0:02:04
8500 -- (-968.750) [-971.284] (-972.234) (-967.946) * (-968.864) (-969.437) (-961.223) [-969.326] -- 0:01:56
9000 -- (-962.273) [-972.550] (-974.311) (-964.271) * (-977.377) [-968.033] (-960.566) (-981.246) -- 0:01:50
9500 -- (-977.195) (-973.843) (-967.869) [-965.479] * (-964.847) (-973.729) [-959.135] (-975.636) -- 0:01:44
10000 -- (-967.158) (-968.645) (-970.329) [-969.808] * (-974.808) (-966.212) [-959.632] (-970.418) -- 0:01:39
Average standard deviation of split frequencies: 0.111538
10500 -- (-967.626) [-974.207] (-972.395) (-970.562) * (-968.472) [-970.774] (-959.925) (-968.884) -- 0:01:34
11000 -- (-978.826) (-968.854) (-972.278) [-965.607] * [-967.019] (-968.149) (-961.692) (-970.900) -- 0:01:29
11500 -- [-971.457] (-976.130) (-970.576) (-964.892) * (-973.009) (-966.893) [-960.280] (-964.859) -- 0:01:25
12000 -- (-968.633) (-974.920) [-968.166] (-979.275) * (-969.683) [-966.605] (-959.040) (-965.353) -- 0:01:22
12500 -- (-976.280) [-965.949] (-968.275) (-970.897) * [-966.280] (-967.411) (-959.356) (-972.943) -- 0:01:19
13000 -- [-965.168] (-963.631) (-963.880) (-979.416) * [-965.815] (-968.152) (-962.015) (-965.348) -- 0:01:15
13500 -- [-968.015] (-974.022) (-969.524) (-971.234) * (-967.789) [-963.026] (-959.561) (-965.465) -- 0:01:13
14000 -- (-968.080) (-969.942) [-970.960] (-974.234) * (-970.067) [-968.834] (-962.307) (-968.503) -- 0:01:10
14500 -- (-972.056) (-975.366) (-963.766) [-965.346] * (-966.140) [-966.022] (-962.111) (-967.843) -- 0:01:07
15000 -- (-970.039) (-964.979) [-967.572] (-970.508) * [-971.426] (-972.074) (-962.794) (-967.494) -- 0:01:05
Average standard deviation of split frequencies: 0.073657
15500 -- [-962.462] (-970.126) (-966.006) (-973.239) * [-970.076] (-967.913) (-966.914) (-972.286) -- 0:01:03
16000 -- [-975.494] (-968.247) (-968.796) (-973.786) * (-965.834) (-973.462) (-959.311) [-972.205] -- 0:01:01
16500 -- (-967.136) (-969.176) [-962.224] (-983.737) * (-976.019) (-969.367) (-959.064) [-969.790] -- 0:00:59
17000 -- (-972.540) (-974.207) [-968.244] (-966.985) * (-978.075) (-963.205) [-959.566] (-967.155) -- 0:01:55
17500 -- (-970.709) [-968.529] (-969.684) (-984.526) * (-965.524) (-971.472) [-959.775] (-977.493) -- 0:01:52
18000 -- (-972.165) (-978.279) [-970.551] (-973.310) * (-968.911) (-969.437) [-959.737] (-971.310) -- 0:01:49
18500 -- (-965.612) (-975.632) [-968.304] (-970.203) * (-972.941) (-973.280) (-960.387) [-971.731] -- 0:01:46
19000 -- [-962.231] (-970.362) (-968.413) (-964.933) * (-962.914) [-976.137] (-963.060) (-967.685) -- 0:01:43
19500 -- (-967.442) (-974.244) [-969.897] (-969.975) * [-967.908] (-985.895) (-961.553) (-967.726) -- 0:01:40
20000 -- [-968.239] (-974.426) (-972.108) (-973.033) * (-965.374) (-972.254) [-960.855] (-974.677) -- 0:01:38
Average standard deviation of split frequencies: 0.064153
20500 -- (-971.474) [-965.729] (-972.867) (-976.636) * (-968.913) [-970.521] (-961.634) (-964.122) -- 0:01:35
21000 -- (-968.163) (-972.943) (-971.317) [-967.531] * [-968.536] (-968.917) (-961.064) (-969.118) -- 0:01:33
21500 -- [-970.317] (-972.320) (-971.592) (-978.449) * (-972.584) (-968.942) (-959.484) [-971.839] -- 0:01:31
22000 -- [-965.344] (-968.722) (-971.714) (-967.421) * (-972.699) [-964.155] (-960.877) (-965.780) -- 0:01:28
22500 -- [-965.748] (-969.662) (-972.078) (-967.248) * (-971.109) [-964.178] (-961.509) (-967.827) -- 0:01:26
23000 -- (-969.795) (-978.591) (-967.696) [-964.934] * [-965.518] (-965.388) (-960.210) (-976.664) -- 0:01:24
23500 -- [-972.206] (-970.602) (-975.814) (-973.566) * [-967.453] (-969.591) (-960.196) (-976.209) -- 0:01:23
24000 -- (-981.176) (-976.250) [-968.785] (-970.798) * (-970.585) (-968.044) [-961.013] (-968.354) -- 0:01:21
24500 -- (-977.399) [-970.493] (-964.727) (-966.164) * (-966.416) (-972.361) [-960.528] (-970.302) -- 0:01:19
25000 -- (-970.954) (-967.875) (-965.905) [-969.297] * [-969.976] (-965.826) (-958.763) (-972.991) -- 0:01:18
Average standard deviation of split frequencies: 0.041442
25500 -- (-967.084) (-971.224) (-966.408) [-965.815] * (-967.362) [-962.977] (-958.732) (-966.809) -- 0:01:16
26000 -- [-963.638] (-969.212) (-971.032) (-978.231) * (-964.806) (-977.098) [-959.233] (-970.463) -- 0:01:14
26500 -- (-963.975) (-968.381) (-981.392) [-970.830] * (-971.750) (-968.462) (-960.639) [-969.869] -- 0:01:13
27000 -- (-965.024) (-976.729) [-966.545] (-971.098) * (-971.304) [-970.267] (-960.179) (-969.758) -- 0:01:12
27500 -- (-967.319) [-966.328] (-968.787) (-972.315) * (-966.741) (-971.200) [-962.713] (-967.335) -- 0:01:10
28000 -- (-975.127) (-965.309) [-964.324] (-973.585) * (-970.958) [-965.520] (-959.613) (-976.270) -- 0:01:09
28500 -- (-973.636) [-969.783] (-968.840) (-968.288) * (-972.380) [-964.942] (-959.806) (-963.751) -- 0:01:08
29000 -- (-977.581) (-968.696) [-965.540] (-964.487) * (-971.113) (-968.772) (-959.156) [-967.584] -- 0:01:06
29500 -- [-976.383] (-971.637) (-969.275) (-971.445) * (-970.071) (-967.117) [-961.542] (-967.853) -- 0:01:05
30000 -- [-966.071] (-968.041) (-968.965) (-973.396) * (-973.252) [-970.076] (-959.353) (-969.731) -- 0:01:04
Average standard deviation of split frequencies: 0.039128
30500 -- [-966.865] (-969.017) (-973.540) (-967.915) * (-965.782) (-971.506) (-959.298) [-966.701] -- 0:01:03
31000 -- (-972.780) (-967.938) (-971.892) [-967.786] * (-968.419) [-972.484] (-959.054) (-968.416) -- 0:01:02
31500 -- [-965.247] (-969.419) (-975.170) (-968.861) * (-970.787) (-976.673) [-959.877] (-967.967) -- 0:01:01
32000 -- [-968.011] (-971.627) (-971.345) (-970.678) * (-968.817) [-969.460] (-961.109) (-963.609) -- 0:01:00
32500 -- [-966.588] (-976.154) (-969.522) (-966.437) * [-969.559] (-967.617) (-961.487) (-973.810) -- 0:00:59
33000 -- (-972.186) (-980.824) [-975.727] (-969.189) * [-971.794] (-967.985) (-960.411) (-972.549) -- 0:01:27
33500 -- (-973.422) [-972.841] (-966.610) (-976.003) * (-968.210) [-970.977] (-960.917) (-968.358) -- 0:01:26
34000 -- (-973.821) (-970.650) (-971.774) [-970.381] * (-973.781) (-965.328) [-959.812] (-982.038) -- 0:01:25
34500 -- [-966.019] (-967.081) (-969.978) (-971.887) * [-970.642] (-978.994) (-961.065) (-964.020) -- 0:01:23
35000 -- [-967.175] (-981.672) (-978.969) (-968.693) * (-972.661) [-973.287] (-963.387) (-975.719) -- 0:01:22
Average standard deviation of split frequencies: 0.036665
35500 -- (-976.239) (-973.791) [-971.800] (-974.422) * (-983.347) (-965.937) (-959.429) [-973.713] -- 0:01:21
36000 -- [-966.532] (-973.696) (-974.946) (-977.887) * (-980.414) (-966.694) [-963.159] (-967.418) -- 0:01:20
36500 -- [-976.839] (-977.280) (-973.377) (-965.959) * [-970.366] (-963.799) (-960.577) (-966.312) -- 0:01:19
37000 -- (-976.354) (-959.748) (-976.771) [-965.043] * (-971.970) [-960.228] (-961.496) (-965.486) -- 0:01:18
37500 -- (-963.928) [-962.165] (-969.221) (-976.181) * (-971.315) (-961.366) (-962.194) [-958.363] -- 0:01:17
38000 -- [-967.949] (-959.181) (-968.687) (-972.677) * (-968.576) (-964.727) [-961.619] (-963.519) -- 0:01:15
38500 -- (-968.573) [-961.619] (-972.153) (-965.887) * (-966.670) [-959.529] (-961.231) (-960.717) -- 0:01:14
39000 -- (-968.540) (-960.097) [-968.352] (-967.142) * (-974.305) (-959.749) [-958.874] (-960.860) -- 0:01:13
39500 -- (-975.243) (-959.587) (-963.330) [-973.175] * (-970.656) [-959.509] (-958.647) (-961.375) -- 0:01:12
40000 -- (-972.909) (-959.978) (-972.037) [-969.527] * (-974.522) [-959.544] (-959.620) (-962.500) -- 0:01:12
Average standard deviation of split frequencies: 0.032457
40500 -- (-971.218) (-961.691) [-969.835] (-971.071) * (-967.653) [-962.945] (-962.197) (-958.977) -- 0:01:11
41000 -- [-966.384] (-962.108) (-964.438) (-967.237) * [-965.383] (-962.489) (-962.469) (-961.639) -- 0:01:10
41500 -- (-970.363) [-959.744] (-973.860) (-975.154) * (-971.087) (-961.855) (-960.596) [-959.968] -- 0:01:09
42000 -- (-967.651) [-959.753] (-971.478) (-972.263) * [-974.162] (-963.457) (-963.463) (-960.274) -- 0:01:08
42500 -- (-967.744) (-960.032) (-976.096) [-977.628] * (-967.056) [-961.437] (-964.086) (-962.771) -- 0:01:07
43000 -- [-972.143] (-959.312) (-966.469) (-966.244) * (-967.047) [-959.545] (-962.695) (-963.688) -- 0:01:06
43500 -- [-967.669] (-958.980) (-968.673) (-974.234) * (-964.566) (-958.367) (-961.653) [-960.584] -- 0:01:05
44000 -- (-966.176) (-960.906) (-970.521) [-977.207] * (-964.436) (-960.586) [-963.213] (-962.531) -- 0:01:05
44500 -- (-969.236) (-959.806) [-968.812] (-971.678) * (-974.206) (-964.682) [-962.768] (-960.368) -- 0:01:04
45000 -- [-969.274] (-960.819) (-965.742) (-974.248) * [-967.639] (-958.458) (-959.262) (-959.905) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- [-961.787] (-960.066) (-974.743) (-973.132) * (-972.164) (-962.234) (-959.438) [-959.567] -- 0:01:02
46000 -- (-974.508) (-960.178) (-967.868) [-972.161] * (-968.950) (-960.212) [-960.106] (-959.231) -- 0:01:02
46500 -- (-967.958) (-961.970) (-976.246) [-969.391] * (-968.749) (-962.717) [-960.483] (-961.889) -- 0:01:01
47000 -- (-967.273) (-960.493) (-972.188) [-964.531] * (-971.571) (-959.786) [-959.626] (-965.180) -- 0:01:00
47500 -- (-966.091) (-960.744) [-968.494] (-974.788) * (-970.403) [-959.867] (-962.587) (-967.677) -- 0:01:20
48000 -- (-970.433) [-960.288] (-970.018) (-973.106) * (-973.306) (-963.058) [-961.906] (-959.558) -- 0:01:19
48500 -- [-973.405] (-958.360) (-971.925) (-975.785) * (-970.115) (-959.397) [-959.751] (-958.137) -- 0:01:18
49000 -- (-973.421) [-958.399] (-972.635) (-963.901) * [-967.366] (-960.383) (-962.479) (-965.107) -- 0:01:17
49500 -- (-967.691) (-964.042) [-964.240] (-962.593) * (-971.982) (-960.646) [-962.891] (-966.555) -- 0:01:16
50000 -- [-970.689] (-960.053) (-964.121) (-962.604) * (-965.913) (-958.473) (-962.779) [-960.324] -- 0:01:16
Average standard deviation of split frequencies: 0.025254
50500 -- (-968.098) [-962.102] (-973.521) (-964.014) * (-967.969) (-958.842) (-961.933) [-962.107] -- 0:01:15
51000 -- [-968.674] (-959.386) (-965.526) (-959.583) * (-968.430) [-961.119] (-966.652) (-960.710) -- 0:01:14
51500 -- [-967.276] (-959.769) (-973.005) (-962.118) * (-976.509) (-963.071) (-961.500) [-962.830] -- 0:01:13
52000 -- (-970.549) [-958.892] (-964.891) (-961.017) * (-976.458) (-960.573) [-960.307] (-961.545) -- 0:01:12
52500 -- (-969.649) (-960.703) (-977.401) [-959.120] * (-963.846) [-959.602] (-964.959) (-959.731) -- 0:01:12
53000 -- (-971.823) (-959.609) (-975.704) [-958.655] * (-975.295) [-961.185] (-960.069) (-960.216) -- 0:01:11
53500 -- [-963.050] (-960.034) (-960.377) (-960.440) * (-975.892) [-959.658] (-963.946) (-962.154) -- 0:01:10
54000 -- (-963.035) [-961.377] (-962.040) (-960.101) * (-974.036) [-960.768] (-962.471) (-960.471) -- 0:01:10
54500 -- (-968.668) (-959.316) (-959.921) [-961.181] * (-968.659) [-960.168] (-963.241) (-959.448) -- 0:01:09
55000 -- (-968.342) [-959.614] (-961.428) (-960.269) * (-968.233) [-959.422] (-960.997) (-958.736) -- 0:01:08
Average standard deviation of split frequencies: 0.023925
55500 -- (-979.176) (-960.719) [-959.848] (-961.328) * (-971.977) (-960.342) [-958.760] (-962.194) -- 0:01:08
56000 -- (-972.010) [-959.805] (-964.740) (-960.015) * [-968.432] (-958.391) (-962.022) (-958.759) -- 0:01:07
56500 -- [-968.981] (-962.704) (-963.852) (-958.567) * (-969.508) (-960.770) (-961.675) [-959.860] -- 0:01:06
57000 -- (-969.423) (-958.836) [-961.918] (-961.953) * (-971.054) [-963.474] (-960.519) (-958.993) -- 0:01:06
57500 -- [-970.133] (-960.892) (-964.328) (-963.233) * (-968.305) [-962.476] (-964.079) (-960.144) -- 0:01:05
58000 -- [-968.463] (-961.517) (-961.455) (-960.592) * (-972.989) (-960.225) (-960.421) [-961.924] -- 0:01:04
58500 -- (-969.871) (-960.516) (-962.505) [-962.865] * [-973.263] (-960.255) (-960.286) (-958.797) -- 0:01:04
59000 -- (-968.354) [-958.411] (-961.262) (-962.694) * (-965.969) (-964.616) (-961.149) [-959.869] -- 0:01:03
59500 -- (-970.847) [-958.280] (-959.843) (-962.008) * (-962.553) (-961.576) [-959.332] (-962.431) -- 0:01:03
60000 -- [-967.696] (-958.282) (-961.278) (-963.046) * (-960.826) (-959.262) (-961.056) [-958.546] -- 0:01:02
Average standard deviation of split frequencies: 0.020721
60500 -- (-976.552) (-966.535) (-962.798) [-960.147] * (-960.746) (-959.357) [-959.853] (-959.154) -- 0:01:02
61000 -- (-972.022) (-962.832) [-959.431] (-960.625) * (-962.294) (-964.200) (-958.792) [-959.150] -- 0:01:01
61500 -- [-959.927] (-965.637) (-959.506) (-961.842) * (-961.848) (-960.630) [-960.958] (-958.458) -- 0:01:01
62000 -- (-962.737) (-959.602) [-959.058] (-959.062) * (-962.655) [-962.622] (-960.506) (-958.660) -- 0:01:00
62500 -- (-960.035) (-958.813) [-959.738] (-959.664) * (-960.653) [-965.896] (-959.734) (-959.119) -- 0:01:15
63000 -- (-959.780) (-962.177) [-958.763] (-959.547) * (-963.515) (-964.953) (-958.962) [-959.273] -- 0:01:14
63500 -- [-961.614] (-958.944) (-959.716) (-959.292) * (-961.191) [-960.898] (-961.478) (-959.512) -- 0:01:13
64000 -- (-959.020) (-959.096) [-959.739] (-959.324) * [-959.902] (-961.265) (-959.998) (-960.556) -- 0:01:13
64500 -- (-960.981) [-959.144] (-958.544) (-959.929) * (-958.218) [-961.166] (-962.459) (-963.255) -- 0:01:12
65000 -- (-959.486) (-958.776) [-959.318] (-961.191) * (-961.112) (-961.281) (-959.851) [-960.782] -- 0:01:11
Average standard deviation of split frequencies: 0.017499
65500 -- (-959.460) [-959.168] (-959.124) (-960.968) * (-959.119) (-959.354) [-960.552] (-960.624) -- 0:01:11
66000 -- (-961.224) (-960.269) [-959.817] (-962.216) * (-959.255) [-959.886] (-963.382) (-966.874) -- 0:01:10
66500 -- (-958.960) [-959.768] (-959.626) (-961.500) * [-959.018] (-959.173) (-961.791) (-958.630) -- 0:01:10
67000 -- (-958.704) (-961.707) [-960.289] (-960.176) * (-960.988) (-961.814) [-959.346] (-959.703) -- 0:01:09
67500 -- (-960.296) (-960.160) (-962.715) [-959.839] * [-962.156] (-962.854) (-962.515) (-959.525) -- 0:01:09
68000 -- (-961.681) (-959.272) (-959.204) [-962.945] * (-963.156) [-961.049] (-959.350) (-959.361) -- 0:01:08
68500 -- [-960.599] (-959.249) (-959.390) (-962.886) * [-963.267] (-960.226) (-960.090) (-959.323) -- 0:01:07
69000 -- (-959.732) [-963.490] (-960.327) (-960.553) * (-962.411) (-959.002) (-959.812) [-959.005] -- 0:01:07
69500 -- [-963.799] (-966.880) (-961.705) (-959.922) * (-960.971) (-958.861) (-959.099) [-960.450] -- 0:01:06
70000 -- [-963.823] (-968.242) (-961.005) (-961.469) * (-960.752) (-959.224) [-958.417] (-959.936) -- 0:01:06
Average standard deviation of split frequencies: 0.021680
70500 -- (-963.752) [-965.002] (-961.601) (-961.128) * (-961.393) (-960.117) [-959.000] (-964.379) -- 0:01:05
71000 -- (-962.432) (-968.036) [-962.333] (-962.594) * (-961.146) (-961.137) (-960.026) [-961.231] -- 0:01:05
71500 -- (-960.092) (-964.169) (-961.114) [-959.165] * (-960.627) [-960.533] (-962.713) (-962.856) -- 0:01:04
72000 -- (-963.314) (-962.421) (-961.327) [-960.232] * (-960.721) (-960.811) [-962.052] (-960.648) -- 0:01:04
72500 -- (-965.373) [-959.982] (-962.364) (-958.706) * (-964.045) (-969.183) [-963.882] (-963.386) -- 0:01:03
73000 -- (-965.082) [-960.284] (-965.107) (-959.646) * (-958.765) (-966.286) (-963.303) [-958.386] -- 0:01:03
73500 -- [-958.231] (-961.159) (-962.738) (-959.903) * (-959.113) (-966.266) [-959.972] (-958.971) -- 0:01:03
74000 -- [-959.384] (-960.402) (-960.497) (-958.723) * [-964.028] (-967.703) (-963.313) (-958.180) -- 0:01:02
74500 -- (-959.919) (-960.040) (-959.942) [-959.362] * (-962.211) (-959.612) (-962.089) [-958.740] -- 0:01:02
75000 -- (-961.007) [-960.678] (-959.209) (-960.198) * (-959.207) [-959.377] (-961.417) (-959.896) -- 0:01:01
Average standard deviation of split frequencies: 0.018890
75500 -- (-960.052) (-962.557) (-959.483) [-958.974] * (-961.569) [-961.941] (-960.472) (-959.342) -- 0:01:01
76000 -- (-960.331) (-959.894) [-962.510] (-958.718) * (-964.594) [-961.711] (-965.848) (-962.257) -- 0:01:00
76500 -- (-959.207) (-961.701) (-960.548) [-959.230] * [-963.303] (-959.658) (-960.143) (-961.202) -- 0:01:00
77000 -- (-959.713) (-961.882) [-960.432] (-962.063) * (-960.510) [-959.293] (-960.530) (-962.193) -- 0:00:59
77500 -- (-959.164) [-962.236] (-963.202) (-958.451) * [-959.261] (-959.671) (-959.231) (-964.854) -- 0:00:59
78000 -- (-959.164) (-960.386) (-961.965) [-958.483] * (-960.762) (-960.587) [-958.804] (-961.648) -- 0:00:59
78500 -- (-958.490) [-961.167] (-960.997) (-959.637) * (-960.075) (-960.333) (-968.570) [-963.172] -- 0:01:10
79000 -- (-959.621) [-959.656] (-958.530) (-958.893) * (-960.705) (-963.307) [-960.119] (-958.715) -- 0:01:09
79500 -- (-960.936) (-960.790) [-959.741] (-960.203) * (-963.768) [-959.716] (-960.782) (-958.686) -- 0:01:09
80000 -- (-960.783) (-964.404) (-959.730) [-958.890] * (-961.676) (-959.723) (-960.566) [-959.855] -- 0:01:09
Average standard deviation of split frequencies: 0.018762
80500 -- (-961.853) (-959.993) [-959.996] (-960.959) * (-960.485) (-960.728) [-959.880] (-962.927) -- 0:01:08
81000 -- [-959.614] (-961.614) (-958.812) (-963.841) * (-961.142) (-959.433) [-960.768] (-962.785) -- 0:01:08
81500 -- [-960.589] (-959.395) (-960.284) (-961.612) * [-961.965] (-960.474) (-959.423) (-962.461) -- 0:01:07
82000 -- (-958.766) [-959.762] (-959.713) (-965.751) * [-959.200] (-962.252) (-961.492) (-960.097) -- 0:01:07
82500 -- (-960.535) (-960.172) [-960.842] (-965.565) * (-959.990) (-961.581) [-963.324] (-959.284) -- 0:01:06
83000 -- (-960.528) [-960.935] (-961.353) (-960.059) * (-961.263) (-961.765) [-961.662] (-965.232) -- 0:01:06
83500 -- (-964.546) [-962.983] (-961.665) (-962.989) * [-959.476] (-962.259) (-962.417) (-964.705) -- 0:01:05
84000 -- [-959.273] (-964.729) (-961.922) (-959.688) * (-961.233) (-962.502) (-961.073) [-962.432] -- 0:01:05
84500 -- [-958.896] (-960.189) (-960.798) (-960.631) * (-961.348) (-960.551) (-961.538) [-958.487] -- 0:01:05
85000 -- (-958.931) [-958.716] (-959.833) (-961.039) * (-960.618) (-959.078) [-958.205] (-961.773) -- 0:01:04
Average standard deviation of split frequencies: 0.019055
85500 -- [-963.034] (-959.370) (-959.535) (-958.616) * (-960.164) (-959.220) (-959.947) [-959.538] -- 0:01:04
86000 -- (-959.717) (-959.799) (-960.804) [-959.076] * (-960.179) (-961.102) (-959.040) [-958.888] -- 0:01:03
86500 -- [-959.136] (-960.112) (-960.158) (-959.320) * (-960.011) [-959.845] (-961.473) (-964.663) -- 0:01:03
87000 -- (-961.466) (-964.005) (-959.495) [-958.931] * (-959.133) [-959.520] (-961.051) (-961.043) -- 0:01:02
87500 -- (-961.047) [-958.930] (-959.257) (-961.716) * (-958.960) (-959.873) (-966.684) [-959.739] -- 0:01:02
88000 -- (-961.600) (-963.953) [-959.479] (-958.982) * (-964.507) [-959.806] (-962.538) (-959.715) -- 0:01:02
88500 -- (-963.403) [-961.222] (-961.569) (-966.064) * (-958.635) (-961.406) (-959.760) [-961.993] -- 0:01:01
89000 -- (-959.522) (-961.664) [-959.443] (-959.821) * (-958.890) (-960.837) (-959.356) [-961.382] -- 0:01:01
89500 -- (-962.318) (-960.102) (-960.364) [-962.102] * (-959.790) (-960.535) (-961.880) [-959.643] -- 0:01:01
90000 -- (-964.138) (-961.160) (-958.916) [-964.669] * (-960.633) [-961.900] (-960.995) (-958.540) -- 0:01:00
Average standard deviation of split frequencies: 0.016588
90500 -- (-960.279) [-960.913] (-959.142) (-961.075) * (-961.872) (-962.657) [-959.925] (-960.456) -- 0:01:00
91000 -- (-961.307) (-961.783) (-960.956) [-960.502] * (-963.565) [-961.387] (-963.545) (-958.401) -- 0:00:59
91500 -- (-960.222) (-960.712) [-961.431] (-960.803) * [-961.051] (-967.823) (-961.351) (-962.117) -- 0:00:59
92000 -- (-960.672) (-960.623) [-969.967] (-959.746) * (-960.735) (-963.219) [-960.499] (-960.992) -- 0:00:59
92500 -- (-963.628) (-959.876) [-962.859] (-964.869) * (-962.996) (-965.854) [-959.806] (-964.026) -- 0:00:58
93000 -- [-962.818] (-962.769) (-961.325) (-963.056) * (-958.957) [-960.785] (-961.311) (-959.856) -- 0:00:58
93500 -- (-959.802) (-965.912) [-962.684] (-959.879) * (-964.748) (-959.110) [-960.324] (-958.663) -- 0:00:58
94000 -- [-960.132] (-963.265) (-963.212) (-964.036) * (-966.546) (-959.355) [-961.706] (-959.034) -- 0:00:57
94500 -- [-963.552] (-962.481) (-963.650) (-960.092) * (-959.565) (-960.295) (-958.441) [-958.900] -- 0:00:57
95000 -- (-959.163) [-965.364] (-958.554) (-962.064) * (-958.932) (-959.499) [-960.855] (-958.790) -- 0:00:57
Average standard deviation of split frequencies: 0.014030
95500 -- (-960.033) (-962.136) [-959.846] (-962.821) * [-958.879] (-959.718) (-962.370) (-958.854) -- 0:01:06
96000 -- (-958.925) [-959.393] (-959.159) (-962.930) * (-959.795) (-958.900) [-960.165] (-959.719) -- 0:01:05
96500 -- (-958.738) (-959.138) (-964.473) [-963.548] * [-958.567] (-963.696) (-959.887) (-961.002) -- 0:01:05
97000 -- [-959.033] (-959.222) (-959.994) (-960.785) * [-959.020] (-965.528) (-962.641) (-963.548) -- 0:01:05
97500 -- (-961.232) (-960.622) (-958.568) [-959.365] * [-960.977] (-958.742) (-965.129) (-961.075) -- 0:01:04
98000 -- [-960.474] (-959.926) (-959.947) (-965.877) * [-960.823] (-959.796) (-959.570) (-959.149) -- 0:01:04
98500 -- (-958.679) (-964.590) (-959.484) [-962.704] * [-960.743] (-960.673) (-959.440) (-960.067) -- 0:01:04
99000 -- (-959.806) (-963.481) (-961.606) [-959.494] * (-960.715) [-959.019] (-962.572) (-960.138) -- 0:01:03
99500 -- (-962.811) (-960.808) [-961.129] (-959.682) * (-960.816) [-958.611] (-961.696) (-961.205) -- 0:01:03
100000 -- (-961.640) (-960.826) [-960.459] (-961.818) * (-960.842) [-961.166] (-961.292) (-964.022) -- 0:01:02
Average standard deviation of split frequencies: 0.016390
100500 -- (-959.713) (-961.621) [-958.993] (-960.100) * (-961.023) (-962.333) (-966.143) [-962.811] -- 0:01:02
101000 -- (-961.911) (-959.629) [-958.789] (-960.649) * (-964.045) (-960.606) [-961.139] (-961.178) -- 0:01:02
101500 -- (-959.752) (-960.212) [-958.569] (-960.815) * (-967.262) [-962.214] (-960.696) (-958.598) -- 0:01:01
102000 -- [-959.107] (-959.755) (-958.546) (-963.513) * (-963.942) [-961.258] (-958.977) (-959.019) -- 0:01:01
102500 -- [-960.058] (-960.535) (-959.233) (-966.275) * [-959.488] (-960.900) (-958.846) (-961.617) -- 0:01:01
103000 -- (-960.989) [-961.706] (-960.225) (-964.936) * (-963.906) [-960.693] (-961.456) (-963.500) -- 0:01:00
103500 -- (-959.611) (-959.437) [-959.959] (-960.646) * [-961.833] (-959.600) (-958.976) (-958.568) -- 0:01:00
104000 -- (-963.063) (-964.597) (-959.855) [-964.160] * [-962.442] (-959.090) (-961.538) (-958.790) -- 0:01:00
104500 -- (-962.478) (-960.374) (-962.481) [-961.859] * [-961.440] (-961.347) (-962.201) (-960.976) -- 0:00:59
105000 -- (-959.915) (-959.407) (-962.121) [-961.065] * (-962.608) [-961.637] (-961.510) (-961.865) -- 0:00:59
Average standard deviation of split frequencies: 0.015916
105500 -- (-959.982) (-960.905) [-960.254] (-959.773) * (-962.935) [-959.487] (-962.330) (-965.357) -- 0:00:59
106000 -- (-963.190) (-961.233) [-963.320] (-962.108) * (-961.807) (-958.997) (-963.484) [-962.239] -- 0:00:59
106500 -- (-959.661) [-962.148] (-960.206) (-958.997) * (-959.642) (-958.955) [-959.848] (-960.222) -- 0:00:58
107000 -- (-962.895) (-960.067) [-960.037] (-960.894) * (-962.988) (-958.513) [-959.763] (-960.333) -- 0:00:58
107500 -- (-962.381) (-960.660) (-961.063) [-959.426] * (-962.357) [-959.374] (-962.026) (-959.371) -- 0:00:58
108000 -- (-959.134) (-961.606) (-959.311) [-960.977] * [-962.632] (-961.740) (-960.296) (-960.218) -- 0:00:57
108500 -- (-962.828) [-962.231] (-959.455) (-961.331) * (-963.170) [-959.499] (-960.352) (-971.678) -- 0:00:57
109000 -- (-958.920) [-960.608] (-962.351) (-959.986) * (-961.582) (-961.106) (-961.235) [-966.558] -- 0:00:57
109500 -- (-959.009) [-965.042] (-960.868) (-960.035) * (-961.672) (-960.425) [-960.244] (-960.408) -- 0:00:56
110000 -- (-961.395) (-962.762) (-962.409) [-960.753] * (-960.249) [-958.705] (-958.730) (-967.330) -- 0:00:56
Average standard deviation of split frequencies: 0.016565
110500 -- (-959.003) (-962.546) (-964.942) [-959.745] * [-960.441] (-963.343) (-958.772) (-969.009) -- 0:00:56
111000 -- (-960.476) (-960.562) [-961.593] (-961.937) * [-960.667] (-963.264) (-959.260) (-960.346) -- 0:00:56
111500 -- (-962.013) [-959.154] (-965.363) (-960.779) * (-959.791) [-962.802] (-959.585) (-965.568) -- 0:01:03
112000 -- (-959.416) [-959.669] (-964.475) (-958.701) * (-962.471) (-962.365) [-963.019] (-962.637) -- 0:01:03
112500 -- (-962.813) [-962.181] (-962.571) (-959.485) * (-959.850) [-961.541] (-961.439) (-961.024) -- 0:01:03
113000 -- (-960.462) (-958.954) (-959.715) [-959.532] * [-959.586] (-962.649) (-961.919) (-960.816) -- 0:01:02
113500 -- (-962.256) [-961.262] (-960.833) (-959.894) * (-960.819) (-961.661) [-960.377] (-962.945) -- 0:01:02
114000 -- (-961.347) (-959.658) [-960.558] (-959.715) * [-961.610] (-960.228) (-961.750) (-966.978) -- 0:01:02
114500 -- (-959.278) (-958.371) [-961.370] (-958.799) * [-959.389] (-959.011) (-965.910) (-960.080) -- 0:01:01
115000 -- (-964.456) [-958.748] (-961.944) (-959.066) * (-959.642) (-959.320) (-961.235) [-962.223] -- 0:01:01
Average standard deviation of split frequencies: 0.018180
115500 -- [-963.151] (-960.024) (-960.301) (-958.221) * [-960.109] (-959.404) (-959.350) (-961.390) -- 0:01:01
116000 -- (-960.439) (-962.662) (-959.805) [-962.252] * (-960.135) (-961.072) [-960.290] (-961.118) -- 0:01:00
116500 -- (-958.814) (-966.574) [-959.480] (-958.867) * (-959.542) (-960.094) [-961.082] (-961.508) -- 0:01:00
117000 -- (-960.318) [-963.079] (-959.570) (-960.559) * (-959.055) (-959.175) (-958.842) [-963.350] -- 0:01:00
117500 -- (-960.203) [-958.604] (-959.116) (-961.592) * (-959.563) (-958.980) (-959.986) [-959.005] -- 0:01:00
118000 -- (-959.520) [-960.727] (-960.021) (-962.461) * (-959.307) (-959.174) [-962.753] (-962.395) -- 0:00:59
118500 -- (-959.084) [-961.252] (-958.881) (-962.466) * (-961.273) (-958.490) [-959.456] (-961.749) -- 0:00:59
119000 -- [-959.295] (-962.631) (-959.896) (-961.524) * (-958.930) [-959.086] (-959.415) (-962.307) -- 0:00:59
119500 -- (-958.670) (-960.674) [-962.094] (-963.825) * (-958.975) [-960.816] (-962.667) (-958.979) -- 0:00:58
120000 -- (-960.398) (-960.976) [-963.103] (-963.343) * (-960.566) [-960.150] (-960.588) (-964.325) -- 0:00:58
Average standard deviation of split frequencies: 0.016244
120500 -- [-960.867] (-960.590) (-960.547) (-968.767) * (-962.250) (-960.006) (-961.818) [-959.299] -- 0:00:58
121000 -- (-959.921) (-962.826) [-961.927] (-965.133) * (-966.299) (-959.831) (-960.820) [-958.967] -- 0:00:58
121500 -- (-958.384) (-959.481) (-958.898) [-959.768] * (-964.909) (-962.258) (-958.544) [-958.975] -- 0:00:57
122000 -- [-960.249] (-960.423) (-959.611) (-960.289) * (-960.237) (-960.901) [-961.447] (-958.836) -- 0:00:57
122500 -- (-958.538) (-962.572) [-959.006] (-961.903) * [-960.728] (-963.723) (-959.418) (-961.665) -- 0:00:57
123000 -- [-958.737] (-961.232) (-958.892) (-960.835) * [-960.196] (-961.370) (-963.486) (-959.584) -- 0:00:57
123500 -- (-960.516) [-962.539] (-960.190) (-961.136) * [-960.984] (-961.466) (-964.513) (-960.833) -- 0:00:56
124000 -- (-960.859) (-963.084) [-958.513] (-959.581) * [-958.891] (-959.337) (-960.505) (-961.666) -- 0:00:56
124500 -- (-961.059) (-961.846) [-959.584] (-959.466) * [-958.149] (-962.665) (-960.123) (-964.836) -- 0:00:56
125000 -- (-962.704) [-960.324] (-959.563) (-959.569) * [-960.690] (-964.186) (-959.674) (-962.032) -- 0:00:56
Average standard deviation of split frequencies: 0.012908
125500 -- [-960.405] (-959.607) (-959.207) (-961.428) * (-962.683) (-961.612) [-960.650] (-960.346) -- 0:00:55
126000 -- (-960.944) [-959.068] (-961.442) (-960.901) * [-959.038] (-962.463) (-960.997) (-961.783) -- 0:00:55
126500 -- [-962.816] (-962.043) (-961.631) (-959.360) * (-959.698) (-961.418) [-959.664] (-961.182) -- 0:00:55
127000 -- (-961.898) (-964.388) (-959.863) [-958.405] * (-959.440) (-963.209) (-960.709) [-958.951] -- 0:00:54
127500 -- (-961.647) [-959.576] (-958.578) (-959.038) * (-958.582) (-961.914) [-960.010] (-959.388) -- 0:00:54
128000 -- (-960.154) [-959.412] (-962.033) (-960.614) * (-958.331) (-960.553) (-962.029) [-958.874] -- 0:01:01
128500 -- (-959.320) (-959.260) [-959.065] (-958.889) * (-962.167) (-962.777) [-963.449] (-959.743) -- 0:01:01
129000 -- (-959.288) (-961.694) (-960.043) [-959.230] * (-962.093) (-959.299) [-966.309] (-961.363) -- 0:01:00
129500 -- [-958.684] (-962.481) (-962.168) (-964.431) * [-960.071] (-959.802) (-962.184) (-963.771) -- 0:01:00
130000 -- (-959.396) (-965.837) (-959.481) [-958.733] * (-961.116) (-959.211) (-966.836) [-962.334] -- 0:01:00
Average standard deviation of split frequencies: 0.015000
130500 -- (-959.297) [-960.293] (-958.260) (-960.049) * [-961.348] (-959.908) (-962.419) (-962.381) -- 0:00:59
131000 -- (-962.073) (-960.523) (-959.472) [-958.201] * (-960.550) [-958.510] (-963.399) (-964.687) -- 0:00:59
131500 -- (-962.725) (-963.128) [-960.386] (-958.542) * (-961.249) (-958.379) (-963.874) [-962.461] -- 0:00:59
132000 -- (-959.829) (-967.808) [-960.232] (-959.115) * (-958.468) (-962.920) [-960.521] (-962.633) -- 0:00:59
132500 -- (-961.368) [-960.775] (-961.882) (-959.112) * (-958.874) [-960.810] (-961.048) (-960.652) -- 0:00:58
133000 -- [-961.027] (-963.302) (-960.687) (-959.264) * [-960.281] (-962.262) (-961.867) (-960.773) -- 0:00:58
133500 -- [-964.972] (-960.173) (-961.072) (-959.479) * (-966.254) (-963.963) (-961.015) [-961.363] -- 0:00:58
134000 -- (-959.466) [-959.767] (-961.681) (-960.723) * (-963.720) (-964.325) [-961.384] (-961.980) -- 0:00:58
134500 -- (-959.536) (-965.720) (-963.421) [-959.414] * (-963.857) (-967.524) (-959.237) [-962.032] -- 0:00:57
135000 -- (-960.520) [-962.158] (-960.338) (-959.247) * (-963.971) [-960.394] (-959.625) (-960.400) -- 0:00:57
Average standard deviation of split frequencies: 0.016784
135500 -- (-960.557) (-961.873) (-959.538) [-961.499] * (-962.391) (-963.568) [-958.611] (-965.929) -- 0:00:57
136000 -- (-961.141) [-962.454] (-958.683) (-959.337) * [-960.444] (-961.800) (-958.451) (-963.445) -- 0:00:57
136500 -- (-959.947) (-959.140) [-961.501] (-964.411) * (-958.964) (-961.912) [-958.614] (-964.691) -- 0:00:56
137000 -- [-960.608] (-963.262) (-961.266) (-961.616) * (-966.650) (-959.661) [-960.226] (-964.807) -- 0:00:56
137500 -- (-963.301) (-961.357) (-962.119) [-959.635] * (-959.905) (-959.549) [-959.543] (-963.531) -- 0:00:56
138000 -- (-962.083) (-960.247) (-961.589) [-959.403] * (-965.956) [-958.865] (-958.766) (-960.690) -- 0:00:56
138500 -- [-963.600] (-958.892) (-961.282) (-962.484) * (-967.924) [-960.067] (-960.641) (-961.818) -- 0:00:55
139000 -- (-960.872) (-959.445) [-962.551] (-959.102) * (-966.135) (-958.459) (-962.233) [-960.670] -- 0:00:55
139500 -- (-962.895) (-961.092) [-958.339] (-960.384) * [-958.779] (-959.692) (-959.322) (-959.401) -- 0:00:55
140000 -- (-961.256) (-960.665) [-958.363] (-960.230) * [-961.821] (-962.090) (-960.437) (-959.101) -- 0:00:55
Average standard deviation of split frequencies: 0.016756
140500 -- (-960.213) (-959.820) [-959.143] (-959.500) * (-966.636) [-960.162] (-959.476) (-958.631) -- 0:00:55
141000 -- [-962.850] (-961.138) (-959.109) (-960.356) * (-961.264) (-960.868) [-958.938] (-959.454) -- 0:00:54
141500 -- (-960.041) (-964.950) [-959.297] (-962.720) * (-958.908) (-961.344) [-959.852] (-960.407) -- 0:00:54
142000 -- (-961.266) (-963.086) [-958.909] (-963.710) * [-958.957] (-961.583) (-960.989) (-960.760) -- 0:00:54
142500 -- (-958.813) (-961.895) [-961.446] (-964.577) * (-960.199) [-965.380] (-959.679) (-959.899) -- 0:00:54
143000 -- (-958.926) (-959.398) [-959.653] (-971.605) * (-961.017) (-962.288) (-959.634) [-961.490] -- 0:00:53
143500 -- [-960.561] (-962.686) (-960.772) (-960.803) * (-963.130) (-963.958) [-961.806] (-961.668) -- 0:00:53
144000 -- (-965.167) [-964.026] (-966.848) (-958.584) * [-958.503] (-962.046) (-962.361) (-963.076) -- 0:00:53
144500 -- (-960.085) (-962.143) (-959.278) [-960.357] * [-958.317] (-962.564) (-961.681) (-964.410) -- 0:00:59
145000 -- [-961.008] (-961.365) (-962.408) (-962.267) * [-959.262] (-959.871) (-961.681) (-961.532) -- 0:00:58
Average standard deviation of split frequencies: 0.015990
145500 -- [-959.723] (-961.028) (-959.638) (-961.205) * (-959.397) [-959.242] (-961.017) (-959.351) -- 0:00:58
146000 -- (-962.273) (-961.401) (-959.688) [-959.621] * (-961.214) (-958.785) (-961.544) [-959.977] -- 0:00:58
146500 -- (-962.976) [-960.857] (-962.022) (-960.331) * [-963.241] (-958.593) (-961.883) (-960.599) -- 0:00:58
147000 -- (-963.187) (-961.567) (-962.101) [-960.440] * (-962.077) (-958.787) [-959.374] (-960.190) -- 0:00:58
147500 -- (-962.185) (-961.185) [-961.233] (-958.616) * (-963.485) [-959.304] (-962.766) (-958.812) -- 0:00:57
148000 -- (-963.863) (-960.679) (-959.647) [-959.546] * [-961.003] (-964.583) (-966.422) (-959.459) -- 0:00:57
148500 -- (-962.253) [-959.968] (-959.802) (-961.366) * (-961.132) (-959.197) [-962.531] (-959.240) -- 0:00:57
149000 -- (-962.974) [-960.064] (-959.377) (-959.385) * (-958.345) (-960.111) [-960.987] (-958.843) -- 0:00:57
149500 -- (-961.246) (-958.772) (-960.194) [-959.528] * (-960.338) (-958.833) [-960.745] (-961.790) -- 0:00:56
150000 -- (-963.780) (-958.624) [-960.222] (-961.882) * [-960.344] (-966.050) (-963.083) (-966.304) -- 0:00:56
Average standard deviation of split frequencies: 0.014452
150500 -- (-965.285) (-961.093) (-960.121) [-960.432] * (-962.581) (-959.368) (-961.405) [-965.519] -- 0:00:56
151000 -- (-963.264) (-964.045) [-959.221] (-962.248) * [-959.592] (-958.867) (-962.294) (-966.344) -- 0:00:56
151500 -- (-964.605) (-960.218) (-961.504) [-959.782] * (-958.381) (-961.302) [-961.986] (-962.116) -- 0:00:56
152000 -- (-964.398) (-959.592) (-960.268) [-960.661] * (-958.770) (-960.357) [-960.264] (-963.324) -- 0:00:55
152500 -- (-963.376) [-961.980] (-960.707) (-959.715) * (-958.699) [-961.144] (-959.959) (-959.993) -- 0:00:55
153000 -- (-966.397) [-960.981] (-961.365) (-959.384) * [-959.655] (-961.068) (-960.352) (-962.167) -- 0:00:55
153500 -- (-961.460) (-958.685) [-958.891] (-959.700) * [-960.193] (-964.128) (-962.028) (-958.256) -- 0:00:55
154000 -- (-961.878) (-959.073) [-961.027] (-959.637) * [-962.499] (-961.633) (-960.235) (-960.060) -- 0:00:54
154500 -- (-961.522) (-960.479) (-959.687) [-959.876] * (-961.153) (-961.652) (-960.947) [-960.343] -- 0:00:54
155000 -- (-960.769) (-963.273) (-962.026) [-959.663] * (-959.418) (-960.201) (-960.365) [-962.392] -- 0:00:54
Average standard deviation of split frequencies: 0.013900
155500 -- [-960.771] (-961.146) (-959.701) (-959.998) * [-958.696] (-965.073) (-958.497) (-961.328) -- 0:00:54
156000 -- [-960.713] (-958.640) (-959.166) (-960.383) * (-959.964) (-963.656) [-959.733] (-959.761) -- 0:00:54
156500 -- (-963.047) (-960.815) (-959.173) [-959.077] * [-960.163] (-961.435) (-960.737) (-958.681) -- 0:00:53
157000 -- (-963.344) [-963.097] (-959.307) (-960.701) * (-958.586) (-964.142) [-958.820] (-959.087) -- 0:00:53
157500 -- [-959.904] (-960.476) (-961.354) (-961.630) * (-960.026) (-962.725) (-959.938) [-961.986] -- 0:00:53
158000 -- (-960.703) [-959.108] (-960.670) (-962.052) * (-962.525) (-961.828) (-960.077) [-959.424] -- 0:00:53
158500 -- (-960.428) (-960.574) [-959.627] (-961.314) * (-962.817) (-961.214) (-959.976) [-959.058] -- 0:00:53
159000 -- (-960.802) (-959.582) (-958.953) [-961.064] * (-962.013) [-961.513] (-959.418) (-961.635) -- 0:00:52
159500 -- (-961.127) (-960.809) (-959.503) [-959.939] * [-964.934] (-960.733) (-961.219) (-964.045) -- 0:00:52
160000 -- (-962.616) (-963.427) (-959.232) [-958.469] * (-959.591) (-962.287) [-963.135] (-959.542) -- 0:00:52
Average standard deviation of split frequencies: 0.016678
160500 -- [-962.287] (-958.930) (-960.285) (-961.820) * (-960.991) (-960.301) [-961.819] (-962.173) -- 0:00:57
161000 -- (-959.210) [-959.136] (-960.985) (-959.105) * (-961.175) (-959.755) [-958.873] (-960.046) -- 0:00:57
161500 -- [-959.200] (-959.144) (-966.664) (-959.377) * [-960.634] (-960.789) (-958.937) (-960.425) -- 0:00:57
162000 -- [-959.261] (-963.122) (-960.139) (-960.046) * (-963.255) (-962.709) (-960.125) [-959.097] -- 0:00:56
162500 -- [-958.989] (-960.700) (-961.953) (-958.948) * (-960.140) (-959.037) [-961.486] (-960.277) -- 0:00:56
163000 -- (-961.290) (-961.050) (-960.455) [-963.395] * (-965.033) [-962.198] (-961.954) (-959.345) -- 0:00:56
163500 -- [-961.648] (-960.461) (-964.431) (-960.977) * (-962.856) [-961.270] (-962.799) (-961.304) -- 0:00:56
164000 -- (-960.629) (-960.875) [-960.596] (-964.397) * (-964.562) (-961.167) [-963.231] (-958.394) -- 0:00:56
164500 -- (-958.574) [-960.134] (-960.184) (-963.025) * (-961.306) [-959.392] (-958.765) (-958.909) -- 0:00:55
165000 -- [-959.897] (-959.657) (-961.621) (-960.274) * (-962.110) [-960.756] (-961.745) (-958.837) -- 0:00:55
Average standard deviation of split frequencies: 0.017039
165500 -- [-959.969] (-960.439) (-958.512) (-959.879) * (-964.930) (-959.198) [-958.947] (-960.047) -- 0:00:55
166000 -- (-958.946) (-960.341) (-958.376) [-958.713] * (-961.560) (-959.655) (-961.382) [-960.585] -- 0:00:55
166500 -- (-959.533) (-963.038) (-958.290) [-959.265] * (-960.794) (-959.032) (-960.873) [-959.230] -- 0:00:55
167000 -- (-959.660) [-962.290] (-960.354) (-960.797) * (-959.936) (-960.682) (-960.288) [-960.401] -- 0:00:54
167500 -- (-959.578) [-959.354] (-959.935) (-960.250) * (-959.725) [-959.937] (-960.251) (-960.947) -- 0:00:54
168000 -- (-960.732) [-961.937] (-960.593) (-962.347) * (-961.917) (-960.669) [-960.724] (-964.245) -- 0:00:54
168500 -- (-959.040) (-959.999) [-961.031] (-959.996) * (-960.068) (-961.939) [-960.098] (-962.425) -- 0:00:54
169000 -- [-961.821] (-959.761) (-962.010) (-959.579) * (-958.684) (-962.790) [-963.683] (-960.750) -- 0:00:54
169500 -- (-959.273) [-959.349] (-965.557) (-962.614) * [-963.120] (-961.423) (-963.672) (-959.252) -- 0:00:53
170000 -- [-958.884] (-959.852) (-963.853) (-960.591) * (-960.761) [-961.251] (-958.906) (-960.071) -- 0:00:53
Average standard deviation of split frequencies: 0.015991
170500 -- (-960.930) (-958.851) (-962.296) [-960.771] * [-958.871] (-959.492) (-959.316) (-961.847) -- 0:00:53
171000 -- [-959.855] (-959.302) (-962.208) (-958.464) * [-959.306] (-959.638) (-959.373) (-960.896) -- 0:00:53
171500 -- [-960.623] (-960.401) (-960.855) (-958.500) * [-961.455] (-959.124) (-959.697) (-958.905) -- 0:00:53
172000 -- (-961.314) (-958.851) (-959.520) [-959.782] * (-959.749) (-960.551) [-959.391] (-958.809) -- 0:00:52
172500 -- (-964.536) [-959.985] (-960.309) (-959.543) * [-961.359] (-958.329) (-963.926) (-959.484) -- 0:00:52
173000 -- (-961.294) (-958.640) (-958.215) [-960.543] * (-959.452) (-959.954) [-960.674] (-960.044) -- 0:00:52
173500 -- (-962.316) [-958.588] (-960.477) (-961.077) * (-959.285) (-960.259) (-960.201) [-959.908] -- 0:00:52
174000 -- (-959.774) (-958.608) (-958.578) [-960.556] * [-959.873] (-961.048) (-964.405) (-962.235) -- 0:00:52
174500 -- (-959.918) [-958.527] (-959.637) (-962.330) * (-960.336) (-960.974) (-959.844) [-962.077] -- 0:00:52
175000 -- (-961.498) [-959.169] (-958.342) (-959.280) * (-960.033) (-961.009) [-959.835] (-959.964) -- 0:00:51
Average standard deviation of split frequencies: 0.016453
175500 -- [-959.507] (-967.166) (-959.421) (-960.064) * [-959.474] (-964.860) (-961.604) (-960.674) -- 0:00:51
176000 -- (-961.592) (-962.699) [-960.747] (-959.582) * (-959.842) (-961.519) [-961.699] (-960.893) -- 0:00:51
176500 -- (-961.387) [-959.031] (-963.067) (-960.075) * (-961.294) [-958.785] (-962.315) (-962.302) -- 0:00:51
177000 -- [-960.546] (-959.434) (-961.115) (-958.445) * (-960.525) [-958.413] (-963.225) (-961.714) -- 0:00:51
177500 -- (-960.483) (-959.326) (-964.331) [-959.187] * (-959.194) (-958.626) [-964.273] (-961.127) -- 0:00:55
178000 -- [-961.382] (-960.114) (-963.002) (-958.545) * (-960.482) (-960.965) (-963.671) [-961.736] -- 0:00:55
178500 -- (-959.238) [-958.440] (-958.796) (-959.951) * (-959.772) (-959.435) (-958.930) [-959.552] -- 0:00:55
179000 -- (-958.447) (-959.826) (-963.036) [-961.744] * [-960.324] (-958.617) (-959.022) (-961.801) -- 0:00:55
179500 -- (-958.660) (-961.779) [-965.640] (-959.992) * [-962.560] (-960.448) (-961.152) (-958.443) -- 0:00:54
180000 -- (-959.263) (-959.540) [-962.617] (-959.285) * (-962.588) (-960.594) [-959.070] (-958.683) -- 0:00:54
Average standard deviation of split frequencies: 0.016380
180500 -- (-959.535) (-959.093) [-962.146] (-960.474) * [-962.119] (-960.458) (-959.853) (-959.792) -- 0:00:54
181000 -- [-959.649] (-958.216) (-963.295) (-963.317) * (-962.893) (-960.255) (-960.718) [-960.737] -- 0:00:54
181500 -- (-959.398) (-959.726) [-963.975] (-965.404) * (-960.939) [-961.340] (-960.948) (-959.420) -- 0:00:54
182000 -- [-959.253] (-959.328) (-962.300) (-966.863) * [-961.979] (-960.816) (-961.283) (-958.303) -- 0:00:53
182500 -- (-960.461) (-960.148) (-963.232) [-959.450] * (-962.368) (-964.777) (-963.107) [-958.654] -- 0:00:53
183000 -- (-966.291) [-961.387] (-961.732) (-960.444) * [-963.157] (-961.041) (-963.309) (-961.170) -- 0:00:53
183500 -- (-963.963) (-961.965) (-958.959) [-959.521] * (-963.348) [-961.320] (-959.928) (-961.538) -- 0:00:53
184000 -- [-968.577] (-962.834) (-958.793) (-960.275) * (-965.900) (-962.089) [-960.219] (-963.076) -- 0:00:53
184500 -- (-964.876) (-959.512) (-959.387) [-959.854] * (-964.638) (-961.033) [-961.951] (-964.411) -- 0:00:53
185000 -- (-959.618) [-959.974] (-960.980) (-958.510) * (-963.720) [-962.092] (-958.792) (-959.522) -- 0:00:52
Average standard deviation of split frequencies: 0.013339
185500 -- [-959.164] (-960.381) (-964.066) (-961.291) * (-960.255) (-960.965) [-959.692] (-962.699) -- 0:00:52
186000 -- (-959.347) [-959.617] (-961.813) (-959.289) * (-959.557) (-960.003) [-960.175] (-963.945) -- 0:00:52
186500 -- (-963.710) (-962.367) (-962.341) [-960.971] * (-958.800) [-959.986] (-962.571) (-962.564) -- 0:00:52
187000 -- (-962.604) (-965.711) [-960.776] (-961.059) * (-960.076) [-960.565] (-961.386) (-963.567) -- 0:00:52
187500 -- (-961.352) [-959.191] (-961.029) (-958.811) * (-961.542) (-959.726) [-958.875] (-960.032) -- 0:00:52
188000 -- (-958.748) [-959.067] (-967.135) (-960.696) * (-962.640) [-963.109] (-958.946) (-961.401) -- 0:00:51
188500 -- (-959.458) [-959.537] (-966.658) (-962.964) * (-962.321) (-963.637) [-959.119] (-960.943) -- 0:00:51
189000 -- (-960.611) (-964.039) (-961.290) [-961.247] * [-959.976] (-962.863) (-959.646) (-959.516) -- 0:00:51
189500 -- (-960.403) [-964.215] (-960.771) (-958.996) * [-959.522] (-967.071) (-960.798) (-961.491) -- 0:00:51
190000 -- (-960.704) (-962.847) [-960.801] (-959.434) * (-959.187) [-964.294] (-963.557) (-961.502) -- 0:00:51
Average standard deviation of split frequencies: 0.015707
190500 -- [-961.221] (-961.381) (-960.852) (-958.548) * (-959.849) (-960.172) (-959.345) [-960.885] -- 0:00:50
191000 -- (-961.287) (-959.668) (-959.633) [-960.058] * (-960.251) (-959.672) (-960.281) [-960.790] -- 0:00:50
191500 -- (-962.220) [-959.708] (-960.212) (-959.793) * [-960.571] (-960.830) (-959.917) (-960.196) -- 0:00:50
192000 -- [-961.451] (-958.761) (-960.985) (-962.342) * (-962.138) (-963.757) [-962.475] (-960.254) -- 0:00:50
192500 -- (-959.503) (-960.578) [-959.554] (-960.356) * [-962.945] (-960.411) (-960.250) (-961.434) -- 0:00:50
193000 -- (-959.838) (-959.830) [-960.443] (-961.802) * (-959.988) [-961.382] (-960.470) (-961.565) -- 0:00:50
193500 -- [-959.037] (-961.996) (-961.988) (-960.358) * (-964.169) [-962.293] (-960.028) (-966.418) -- 0:00:50
194000 -- (-960.928) [-960.602] (-961.123) (-960.755) * (-960.165) (-962.730) (-960.288) [-961.985] -- 0:00:54
194500 -- (-960.173) (-961.625) [-959.640] (-961.782) * (-963.797) (-960.996) [-958.416] (-962.026) -- 0:00:53
195000 -- (-960.222) (-959.308) (-959.611) [-960.576] * [-961.608] (-960.786) (-961.922) (-960.669) -- 0:00:53
Average standard deviation of split frequencies: 0.015064
195500 -- (-963.838) [-960.996] (-959.173) (-961.996) * (-963.522) [-960.042] (-959.997) (-961.535) -- 0:00:53
196000 -- [-960.565] (-959.934) (-962.573) (-958.439) * (-960.542) [-961.063] (-959.980) (-958.501) -- 0:00:53
196500 -- (-959.427) (-964.346) [-961.042] (-959.441) * (-960.417) (-960.388) [-959.223] (-959.054) -- 0:00:53
197000 -- [-959.747] (-961.836) (-959.993) (-962.286) * (-959.077) (-961.127) (-960.282) [-958.559] -- 0:00:52
197500 -- (-964.038) [-960.246] (-958.995) (-961.371) * [-958.692] (-958.729) (-959.024) (-960.980) -- 0:00:52
198000 -- (-958.779) [-961.451] (-959.656) (-959.543) * (-959.711) [-960.875] (-959.626) (-961.454) -- 0:00:52
198500 -- [-959.231] (-962.383) (-961.497) (-959.803) * (-963.679) (-959.171) [-959.415] (-962.842) -- 0:00:52
199000 -- (-958.738) (-962.845) (-962.874) [-960.794] * (-959.756) [-959.774] (-959.684) (-959.029) -- 0:00:52
199500 -- (-959.381) [-958.726] (-959.590) (-962.106) * (-960.895) (-961.090) (-958.588) [-958.385] -- 0:00:52
200000 -- (-959.342) [-960.503] (-958.777) (-960.436) * (-963.211) [-961.602] (-961.274) (-959.002) -- 0:00:51
Average standard deviation of split frequencies: 0.015400
200500 -- [-958.507] (-963.742) (-958.385) (-960.129) * (-960.007) (-961.612) [-962.630] (-959.768) -- 0:00:51
201000 -- (-960.645) (-959.751) [-960.634] (-960.075) * [-960.415] (-962.229) (-960.751) (-959.039) -- 0:00:51
201500 -- (-959.332) (-966.695) [-959.723] (-960.199) * [-960.019] (-961.708) (-962.845) (-959.698) -- 0:00:51
202000 -- (-962.136) [-963.848] (-960.601) (-961.120) * (-961.963) (-962.562) [-961.198] (-959.629) -- 0:00:51
202500 -- (-959.485) (-960.250) (-961.580) [-958.607] * (-962.396) (-960.515) (-960.313) [-959.055] -- 0:00:51
203000 -- (-960.000) (-961.213) (-963.295) [-958.497] * (-961.248) [-960.145] (-958.897) (-959.818) -- 0:00:51
203500 -- (-960.985) [-962.189] (-959.878) (-958.757) * (-959.530) [-958.659] (-958.298) (-959.083) -- 0:00:50
204000 -- (-961.424) (-962.017) [-959.090] (-959.399) * (-959.839) (-959.154) [-959.918] (-963.191) -- 0:00:50
204500 -- (-960.673) [-962.070] (-961.759) (-959.653) * (-959.991) [-959.348] (-961.571) (-961.423) -- 0:00:50
205000 -- [-962.934] (-960.661) (-959.504) (-961.709) * (-961.640) [-960.745] (-961.456) (-961.816) -- 0:00:50
Average standard deviation of split frequencies: 0.016146
205500 -- [-959.259] (-961.451) (-959.363) (-960.953) * (-963.204) (-960.520) (-965.307) [-961.303] -- 0:00:50
206000 -- (-959.354) [-960.783] (-959.889) (-961.580) * (-961.195) [-959.884] (-958.697) (-963.193) -- 0:00:50
206500 -- (-958.812) [-959.948] (-961.218) (-959.763) * (-959.325) (-960.813) (-960.039) [-961.891] -- 0:00:49
207000 -- (-958.300) [-961.229] (-966.144) (-962.042) * [-960.023] (-963.316) (-960.610) (-966.353) -- 0:00:49
207500 -- (-960.907) (-961.412) [-960.447] (-959.169) * (-959.503) (-962.313) (-961.764) [-960.513] -- 0:00:49
208000 -- (-962.164) (-960.280) [-961.606] (-960.935) * [-959.846] (-959.837) (-958.616) (-962.034) -- 0:00:49
208500 -- (-959.625) [-960.863] (-959.746) (-962.506) * (-960.678) (-959.468) (-959.047) [-959.340] -- 0:00:49
209000 -- (-958.595) [-960.232] (-959.099) (-960.465) * (-962.710) [-958.542] (-959.491) (-958.405) -- 0:00:49
209500 -- (-960.747) (-964.658) [-960.127] (-959.539) * [-961.657] (-959.616) (-959.408) (-958.929) -- 0:00:49
210000 -- (-959.893) (-963.640) (-960.179) [-967.062] * [-963.347] (-959.352) (-960.825) (-961.010) -- 0:00:52
Average standard deviation of split frequencies: 0.015539
210500 -- [-959.113] (-968.423) (-960.419) (-960.809) * (-965.113) (-960.249) (-961.346) [-960.010] -- 0:00:52
211000 -- (-960.485) (-960.781) (-960.447) [-958.714] * (-962.136) (-964.209) (-961.080) [-959.018] -- 0:00:52
211500 -- [-959.612] (-959.362) (-960.467) (-959.316) * (-960.003) (-965.127) [-959.136] (-960.652) -- 0:00:52
212000 -- [-959.332] (-960.567) (-961.843) (-958.508) * [-958.789] (-965.056) (-960.468) (-959.131) -- 0:00:52
212500 -- (-960.485) (-960.635) (-961.292) [-958.603] * (-961.352) (-968.334) (-962.524) [-962.283] -- 0:00:51
213000 -- (-958.584) (-961.295) [-960.099] (-959.066) * (-959.270) (-963.022) (-962.313) [-961.279] -- 0:00:51
213500 -- (-959.380) [-960.521] (-960.186) (-960.346) * (-959.368) (-964.626) (-960.067) [-958.946] -- 0:00:51
214000 -- [-959.957] (-961.432) (-960.964) (-963.998) * (-962.092) [-964.932] (-960.890) (-960.931) -- 0:00:51
214500 -- (-958.207) [-961.753] (-962.082) (-960.809) * [-961.292] (-966.314) (-960.566) (-961.540) -- 0:00:51
215000 -- (-963.970) (-959.884) (-958.311) [-958.993] * [-959.516] (-963.637) (-961.950) (-959.577) -- 0:00:51
Average standard deviation of split frequencies: 0.015622
215500 -- [-960.240] (-958.549) (-959.598) (-963.547) * (-959.153) [-960.358] (-960.073) (-960.889) -- 0:00:50
216000 -- (-958.520) (-964.314) [-962.053] (-965.561) * (-959.535) (-960.166) [-960.939] (-960.595) -- 0:00:50
216500 -- (-960.083) (-959.180) [-961.762] (-963.805) * (-959.702) [-959.184] (-961.018) (-960.124) -- 0:00:50
217000 -- (-962.953) [-959.396] (-959.437) (-961.800) * (-959.058) (-959.978) [-960.024] (-959.793) -- 0:00:50
217500 -- [-962.896] (-959.604) (-960.126) (-959.890) * [-959.982] (-959.729) (-964.040) (-963.095) -- 0:00:50
218000 -- (-960.719) [-958.661] (-958.348) (-965.239) * (-960.819) [-960.288] (-959.307) (-963.341) -- 0:00:50
218500 -- (-962.226) [-960.840] (-961.520) (-960.668) * (-962.003) [-959.439] (-960.513) (-967.637) -- 0:00:50
219000 -- (-959.757) (-961.668) (-960.881) [-960.429] * [-962.323] (-959.395) (-960.983) (-964.119) -- 0:00:49
219500 -- (-960.872) (-958.504) (-959.644) [-959.655] * (-961.337) [-958.779] (-961.625) (-963.423) -- 0:00:49
220000 -- (-960.717) (-959.232) (-964.299) [-959.100] * (-962.005) (-960.006) [-961.703] (-960.247) -- 0:00:49
Average standard deviation of split frequencies: 0.016259
220500 -- (-961.263) (-960.369) (-963.872) [-960.908] * (-965.309) (-960.854) (-961.125) [-960.801] -- 0:00:49
221000 -- (-961.962) (-962.263) (-962.433) [-959.894] * (-964.536) (-961.038) (-959.643) [-960.684] -- 0:00:49
221500 -- (-961.961) (-961.111) [-959.551] (-959.733) * (-965.440) (-961.084) [-958.882] (-959.178) -- 0:00:49
222000 -- (-958.345) [-958.364] (-963.093) (-963.513) * (-962.085) (-958.965) (-958.614) [-959.406] -- 0:00:49
222500 -- (-959.101) (-959.327) [-961.851] (-962.444) * (-959.213) [-963.147] (-962.006) (-959.154) -- 0:00:48
223000 -- (-959.413) (-959.912) [-963.551] (-962.048) * [-959.203] (-959.182) (-961.347) (-959.802) -- 0:00:48
223500 -- [-959.371] (-964.068) (-960.800) (-958.290) * [-958.508] (-959.371) (-962.695) (-959.019) -- 0:00:48
224000 -- (-958.896) (-963.993) (-959.669) [-958.354] * (-961.226) (-959.517) (-961.523) [-959.614] -- 0:00:48
224500 -- (-959.701) [-960.206] (-958.949) (-958.353) * (-961.319) (-961.949) (-961.160) [-960.330] -- 0:00:48
225000 -- (-962.448) (-960.410) [-959.668] (-959.039) * [-959.701] (-959.565) (-959.829) (-958.706) -- 0:00:48
Average standard deviation of split frequencies: 0.014833
225500 -- (-964.332) (-958.762) (-960.233) [-962.125] * [-964.159] (-961.382) (-961.592) (-958.979) -- 0:00:48
226000 -- (-960.046) [-961.479] (-959.922) (-963.991) * (-960.867) [-958.822] (-959.639) (-959.322) -- 0:00:47
226500 -- (-959.817) (-960.352) (-960.073) [-962.955] * (-959.524) (-959.663) [-958.757] (-960.762) -- 0:00:51
227000 -- (-964.742) (-959.625) [-959.753] (-966.184) * (-961.844) (-959.101) [-959.921] (-960.742) -- 0:00:51
227500 -- (-964.518) (-958.735) (-963.923) [-961.603] * (-959.853) (-959.503) (-959.696) [-959.663] -- 0:00:50
228000 -- (-959.990) (-958.808) (-960.326) [-960.635] * (-960.287) [-960.834] (-959.211) (-959.823) -- 0:00:50
228500 -- (-960.054) [-958.917] (-959.613) (-960.434) * (-960.915) (-961.233) [-960.448] (-965.332) -- 0:00:50
229000 -- (-962.455) [-960.337] (-960.589) (-961.655) * [-959.548] (-961.790) (-962.951) (-963.469) -- 0:00:50
229500 -- (-963.545) [-960.856] (-958.642) (-962.227) * (-959.413) [-964.415] (-966.203) (-960.363) -- 0:00:50
230000 -- [-959.123] (-965.803) (-959.711) (-962.943) * [-959.722] (-963.040) (-960.121) (-958.381) -- 0:00:50
Average standard deviation of split frequencies: 0.015100
230500 -- [-958.774] (-961.085) (-960.279) (-964.523) * [-959.277] (-960.420) (-959.103) (-959.569) -- 0:00:50
231000 -- (-959.873) [-959.568] (-964.576) (-964.212) * (-960.278) (-962.357) (-961.422) [-958.959] -- 0:00:49
231500 -- (-959.255) (-961.195) (-961.079) [-960.735] * (-959.479) [-961.004] (-962.227) (-959.785) -- 0:00:49
232000 -- (-960.548) (-959.949) [-961.167] (-958.859) * [-959.563] (-959.974) (-958.872) (-961.058) -- 0:00:49
232500 -- (-960.360) [-958.969] (-959.702) (-959.123) * [-959.123] (-963.228) (-959.858) (-961.783) -- 0:00:49
233000 -- (-959.264) (-960.784) [-960.541] (-959.145) * [-961.757] (-961.324) (-959.117) (-960.056) -- 0:00:49
233500 -- (-960.160) (-958.739) [-958.349] (-962.508) * (-959.960) (-961.883) (-962.261) [-959.735] -- 0:00:49
234000 -- (-960.842) [-960.643] (-958.380) (-962.724) * (-959.887) [-959.732] (-961.743) (-960.207) -- 0:00:49
234500 -- (-958.850) (-962.005) [-958.666] (-961.513) * [-962.198] (-960.837) (-960.658) (-958.592) -- 0:00:48
235000 -- (-958.558) (-961.100) [-958.653] (-961.745) * (-961.137) (-961.783) [-961.618] (-959.870) -- 0:00:48
Average standard deviation of split frequencies: 0.014981
235500 -- [-960.501] (-963.099) (-958.674) (-961.820) * (-959.975) (-961.528) (-961.283) [-958.982] -- 0:00:48
236000 -- (-961.616) (-962.609) [-959.124] (-961.924) * [-965.585] (-971.119) (-963.955) (-959.855) -- 0:00:48
236500 -- [-960.938] (-963.196) (-960.172) (-960.859) * (-959.579) [-961.470] (-962.818) (-961.661) -- 0:00:48
237000 -- (-963.918) (-963.016) [-959.002] (-960.756) * (-960.123) (-963.345) (-961.535) [-959.846] -- 0:00:48
237500 -- (-963.249) (-962.177) (-959.388) [-961.122] * (-961.770) [-959.603] (-963.144) (-961.113) -- 0:00:48
238000 -- (-961.830) (-960.714) [-960.247] (-962.518) * [-959.231] (-963.340) (-962.768) (-959.734) -- 0:00:48
238500 -- [-959.338] (-959.670) (-958.402) (-958.944) * (-960.695) (-964.569) (-963.917) [-958.612] -- 0:00:47
239000 -- [-960.089] (-959.315) (-958.838) (-960.595) * (-962.281) (-960.537) (-961.864) [-959.473] -- 0:00:47
239500 -- (-959.459) (-959.684) [-958.841] (-960.372) * (-962.811) (-959.471) [-960.487] (-962.136) -- 0:00:47
240000 -- (-960.252) (-960.794) [-959.056] (-959.598) * (-963.231) (-958.726) [-962.015] (-961.315) -- 0:00:47
Average standard deviation of split frequencies: 0.014633
240500 -- (-960.571) (-959.533) [-959.133] (-962.380) * (-960.523) (-962.966) (-963.901) [-960.646] -- 0:00:47
241000 -- [-960.239] (-960.330) (-958.980) (-961.549) * (-964.908) (-960.379) [-960.180] (-960.537) -- 0:00:47
241500 -- (-960.588) (-960.331) [-959.355] (-961.848) * (-964.682) [-959.625] (-961.737) (-958.986) -- 0:00:47
242000 -- (-961.170) (-959.818) [-958.877] (-959.769) * (-958.708) (-960.825) [-963.891] (-959.614) -- 0:00:46
242500 -- (-958.734) (-960.061) [-962.007] (-961.591) * (-961.822) (-959.198) (-960.495) [-961.858] -- 0:00:46
243000 -- (-959.954) (-960.772) [-959.651] (-961.649) * [-960.282] (-959.286) (-963.481) (-965.016) -- 0:00:46
243500 -- (-963.667) (-962.706) [-960.420] (-958.624) * [-960.130] (-961.280) (-962.304) (-960.680) -- 0:00:49
244000 -- [-959.366] (-964.806) (-958.984) (-959.557) * [-961.249] (-962.152) (-959.700) (-960.165) -- 0:00:49
244500 -- (-962.656) (-964.728) [-961.733] (-962.724) * [-960.255] (-962.801) (-962.252) (-958.312) -- 0:00:49
245000 -- [-963.802] (-966.361) (-961.703) (-960.022) * (-961.906) [-963.653] (-960.291) (-959.322) -- 0:00:49
Average standard deviation of split frequencies: 0.013918
245500 -- (-961.296) (-964.072) (-962.097) [-962.311] * (-960.579) (-960.006) [-960.992] (-960.968) -- 0:00:49
246000 -- (-960.249) [-959.366] (-959.043) (-960.274) * [-960.325] (-959.781) (-959.125) (-959.826) -- 0:00:49
246500 -- (-963.056) (-959.759) [-961.487] (-962.053) * (-959.747) [-958.307] (-959.888) (-960.924) -- 0:00:48
247000 -- [-959.666] (-959.055) (-961.896) (-963.330) * [-960.488] (-959.648) (-958.855) (-959.777) -- 0:00:48
247500 -- (-960.009) [-958.280] (-959.230) (-960.727) * (-958.661) [-963.716] (-958.374) (-959.091) -- 0:00:48
248000 -- (-960.074) (-959.169) [-960.838] (-963.743) * (-958.238) [-959.246] (-958.587) (-958.979) -- 0:00:48
248500 -- (-960.042) (-959.343) [-959.001] (-963.018) * (-958.198) [-961.132] (-958.586) (-960.033) -- 0:00:48
249000 -- (-961.236) (-958.910) (-959.822) [-959.009] * (-958.877) [-959.838] (-959.398) (-960.443) -- 0:00:48
249500 -- [-959.168] (-958.946) (-958.609) (-962.464) * [-959.622] (-965.871) (-960.255) (-959.385) -- 0:00:48
250000 -- (-967.526) [-960.122] (-960.176) (-965.715) * (-958.853) (-960.601) [-960.695] (-961.324) -- 0:00:48
Average standard deviation of split frequencies: 0.015441
250500 -- (-960.620) (-960.356) [-960.456] (-960.061) * [-960.330] (-959.747) (-960.522) (-958.776) -- 0:00:47
251000 -- (-963.362) [-961.280] (-960.524) (-962.143) * (-959.220) (-960.808) (-960.468) [-959.813] -- 0:00:47
251500 -- (-960.953) [-960.343] (-965.044) (-963.768) * (-958.225) (-961.293) (-960.339) [-960.694] -- 0:00:47
252000 -- (-959.047) (-959.841) (-963.816) [-959.670] * (-958.953) (-959.137) [-961.176] (-962.158) -- 0:00:47
252500 -- (-959.990) (-959.196) [-961.978] (-960.661) * (-958.757) (-961.080) [-960.488] (-960.436) -- 0:00:47
253000 -- [-958.692] (-958.392) (-967.531) (-960.771) * (-960.193) (-964.054) (-963.255) [-961.214] -- 0:00:47
253500 -- (-958.658) [-960.980] (-966.096) (-958.484) * [-959.560] (-963.871) (-962.225) (-961.019) -- 0:00:47
254000 -- [-958.726] (-959.450) (-964.877) (-958.262) * (-965.846) (-961.790) [-960.495] (-963.074) -- 0:00:46
254500 -- (-958.648) (-959.205) [-961.056] (-959.245) * (-960.729) (-960.285) (-959.897) [-961.622] -- 0:00:46
255000 -- (-959.504) (-963.547) (-961.495) [-959.355] * (-958.828) (-964.167) [-958.745] (-959.085) -- 0:00:46
Average standard deviation of split frequencies: 0.014247
255500 -- (-960.234) (-961.710) [-958.460] (-959.786) * (-962.608) (-966.984) [-961.510] (-958.579) -- 0:00:46
256000 -- (-961.098) [-964.326] (-960.131) (-959.825) * (-960.337) (-961.684) (-961.360) [-960.511] -- 0:00:46
256500 -- (-961.703) (-960.011) (-961.079) [-959.778] * [-959.584] (-959.555) (-960.494) (-960.941) -- 0:00:46
257000 -- (-962.284) [-961.364] (-960.580) (-960.842) * (-958.976) [-961.930] (-962.424) (-960.751) -- 0:00:46
257500 -- (-960.147) (-961.801) (-960.689) [-958.852] * (-959.577) [-960.321] (-963.841) (-959.032) -- 0:00:46
258000 -- (-963.897) (-962.704) (-964.543) [-962.447] * (-961.594) [-960.179] (-960.546) (-960.602) -- 0:00:46
258500 -- (-962.055) (-963.024) (-964.849) [-960.084] * [-961.352] (-959.245) (-960.758) (-959.934) -- 0:00:45
259000 -- [-959.827] (-964.810) (-968.688) (-958.977) * (-961.392) (-960.831) (-959.460) [-959.858] -- 0:00:45
259500 -- (-959.825) [-960.792] (-960.553) (-962.708) * (-962.459) (-964.861) [-959.208] (-958.731) -- 0:00:45
260000 -- (-960.962) (-961.329) [-962.511] (-959.616) * (-960.482) [-962.449] (-959.271) (-958.582) -- 0:00:48
Average standard deviation of split frequencies: 0.014087
260500 -- [-960.877] (-963.795) (-962.975) (-959.764) * [-959.500] (-964.172) (-961.470) (-959.765) -- 0:00:48
261000 -- (-961.180) (-964.141) (-960.032) [-958.611] * (-962.420) [-960.603] (-960.644) (-962.194) -- 0:00:48
261500 -- [-961.286] (-961.021) (-959.935) (-964.630) * [-959.507] (-960.448) (-961.198) (-961.277) -- 0:00:48
262000 -- (-959.791) [-958.941] (-960.192) (-959.125) * (-959.778) (-958.601) [-959.255] (-959.256) -- 0:00:47
262500 -- (-959.577) [-960.504] (-962.253) (-959.347) * (-961.932) (-959.485) [-958.399] (-961.585) -- 0:00:47
263000 -- [-963.298] (-962.328) (-961.152) (-962.242) * (-960.045) (-961.696) (-959.631) [-963.914] -- 0:00:47
263500 -- (-963.043) [-960.211] (-959.141) (-959.057) * (-958.367) [-960.322] (-960.020) (-963.636) -- 0:00:47
264000 -- (-961.721) (-960.863) (-960.454) [-958.845] * (-959.589) [-960.235] (-960.021) (-963.192) -- 0:00:47
264500 -- (-960.322) (-959.536) [-961.527] (-960.754) * [-959.613] (-959.738) (-958.737) (-961.762) -- 0:00:47
265000 -- (-960.060) (-959.381) [-963.832] (-960.220) * [-959.506] (-959.828) (-958.952) (-959.193) -- 0:00:47
Average standard deviation of split frequencies: 0.013646
265500 -- (-964.991) (-959.560) (-959.807) [-962.751] * (-960.244) [-961.223] (-958.593) (-961.124) -- 0:00:47
266000 -- [-959.410] (-960.429) (-960.870) (-962.661) * [-963.454] (-959.441) (-959.080) (-959.078) -- 0:00:46
266500 -- [-961.802] (-961.399) (-960.297) (-961.864) * [-961.310] (-960.538) (-959.470) (-959.224) -- 0:00:46
267000 -- (-960.635) (-960.280) [-960.388] (-962.986) * (-962.371) (-963.927) (-959.259) [-958.850] -- 0:00:46
267500 -- (-960.414) [-959.354] (-966.331) (-959.175) * (-963.398) (-964.966) (-964.959) [-958.420] -- 0:00:46
268000 -- (-959.744) (-960.785) [-961.481] (-961.077) * [-959.956] (-964.035) (-962.574) (-960.243) -- 0:00:46
268500 -- (-960.459) [-959.378] (-960.866) (-961.874) * (-959.509) (-960.958) [-961.184] (-961.493) -- 0:00:46
269000 -- [-959.418] (-959.597) (-960.714) (-960.582) * [-959.369] (-960.882) (-960.958) (-960.614) -- 0:00:46
269500 -- (-963.519) (-959.354) (-961.850) [-960.539] * (-962.113) (-959.461) [-960.955] (-963.501) -- 0:00:46
270000 -- (-959.523) (-959.449) (-961.826) [-960.589] * (-960.171) [-961.420] (-960.873) (-961.812) -- 0:00:45
Average standard deviation of split frequencies: 0.013062
270500 -- (-959.941) (-959.179) (-963.719) [-962.729] * [-959.637] (-961.561) (-964.978) (-960.650) -- 0:00:45
271000 -- [-961.840] (-959.691) (-959.924) (-964.486) * (-959.798) (-961.110) [-960.530] (-959.175) -- 0:00:45
271500 -- (-962.532) (-961.180) [-962.235] (-965.336) * (-960.133) (-962.138) [-959.399] (-959.322) -- 0:00:45
272000 -- (-961.313) (-960.199) (-962.518) [-961.082] * (-960.257) (-962.342) [-958.570] (-960.283) -- 0:00:45
272500 -- (-961.375) (-958.613) [-961.893] (-961.600) * (-960.334) (-958.300) (-958.606) [-958.959] -- 0:00:45
273000 -- (-960.174) (-959.197) (-959.378) [-959.900] * (-960.876) [-958.306] (-960.224) (-959.337) -- 0:00:45
273500 -- (-961.119) (-959.152) [-961.157] (-960.996) * (-962.072) (-959.616) [-959.280] (-959.762) -- 0:00:45
274000 -- (-963.123) (-960.037) [-962.281] (-963.382) * (-960.348) (-961.565) (-960.968) [-958.674] -- 0:00:45
274500 -- [-959.219] (-965.484) (-961.379) (-961.434) * (-962.119) (-963.528) [-959.397] (-960.252) -- 0:00:44
275000 -- (-963.040) [-962.570] (-959.342) (-963.997) * [-961.379] (-963.591) (-960.388) (-961.873) -- 0:00:44
Average standard deviation of split frequencies: 0.012315
275500 -- (-959.252) (-963.549) [-959.177] (-963.885) * (-960.794) [-960.539] (-959.519) (-960.322) -- 0:00:44
276000 -- [-959.451] (-963.936) (-960.369) (-959.876) * (-961.768) (-959.283) (-959.369) [-959.736] -- 0:00:47
276500 -- [-960.141] (-958.748) (-959.639) (-958.823) * (-960.847) (-959.298) [-959.099] (-960.790) -- 0:00:47
277000 -- [-960.139] (-961.457) (-962.402) (-958.824) * (-961.993) [-960.397] (-959.147) (-960.810) -- 0:00:46
277500 -- (-962.967) (-962.522) (-960.451) [-960.052] * (-961.733) (-959.082) (-960.290) [-960.833] -- 0:00:46
278000 -- (-963.048) (-959.300) [-958.750] (-959.751) * (-959.330) (-960.674) [-958.822] (-961.464) -- 0:00:46
278500 -- [-960.717] (-967.926) (-958.750) (-959.807) * (-961.657) (-963.744) [-958.822] (-962.634) -- 0:00:46
279000 -- [-959.867] (-964.463) (-961.409) (-959.806) * (-959.340) (-958.945) (-961.228) [-961.817] -- 0:00:46
279500 -- [-959.470] (-960.110) (-960.988) (-962.046) * (-959.282) [-962.212] (-962.476) (-959.321) -- 0:00:46
280000 -- (-959.553) (-960.994) [-960.124] (-960.998) * [-958.954] (-961.075) (-961.305) (-958.879) -- 0:00:46
Average standard deviation of split frequencies: 0.012765
280500 -- [-959.577] (-961.166) (-960.370) (-960.043) * (-959.650) [-959.147] (-958.640) (-961.586) -- 0:00:46
281000 -- (-959.279) [-960.557] (-961.021) (-961.374) * (-958.985) (-959.820) [-959.484] (-960.205) -- 0:00:46
281500 -- (-959.636) [-960.282] (-960.902) (-961.286) * (-959.411) [-962.493] (-962.038) (-964.425) -- 0:00:45
282000 -- (-958.583) [-958.991] (-961.080) (-961.748) * (-963.694) (-958.587) (-960.097) [-962.731] -- 0:00:45
282500 -- (-959.835) [-959.815] (-958.838) (-959.798) * (-959.841) (-961.030) [-965.666] (-962.306) -- 0:00:45
283000 -- (-960.770) (-963.766) (-961.399) [-959.223] * (-958.689) (-965.150) (-959.510) [-960.317] -- 0:00:45
283500 -- (-960.455) [-967.989] (-960.476) (-960.769) * (-962.021) (-958.971) (-960.982) [-958.640] -- 0:00:45
284000 -- [-958.943] (-962.655) (-961.292) (-959.061) * (-959.427) (-960.549) (-960.105) [-959.133] -- 0:00:45
284500 -- (-961.413) [-960.586] (-960.057) (-960.441) * (-959.670) [-959.802] (-959.933) (-959.576) -- 0:00:45
285000 -- [-959.260] (-958.470) (-958.915) (-967.674) * (-959.766) [-959.521] (-959.343) (-961.430) -- 0:00:45
Average standard deviation of split frequencies: 0.010961
285500 -- (-959.811) [-961.356] (-958.814) (-961.149) * (-959.569) (-961.829) (-959.671) [-959.434] -- 0:00:45
286000 -- [-959.529] (-962.488) (-959.985) (-963.056) * (-962.195) (-959.579) (-960.217) [-959.272] -- 0:00:44
286500 -- (-960.388) (-959.107) (-963.565) [-962.177] * [-960.886] (-959.764) (-958.424) (-958.516) -- 0:00:44
287000 -- (-961.282) [-958.409] (-962.241) (-963.794) * (-959.682) (-959.603) (-958.995) [-959.137] -- 0:00:44
287500 -- [-961.248] (-962.593) (-963.593) (-960.728) * (-959.236) (-958.923) (-960.239) [-959.103] -- 0:00:44
288000 -- (-961.442) (-961.634) [-960.342] (-964.343) * (-960.648) (-960.047) (-960.247) [-960.835] -- 0:00:44
288500 -- (-962.830) (-960.949) (-958.727) [-961.364] * (-962.857) (-958.524) (-961.932) [-958.943] -- 0:00:44
289000 -- (-958.970) [-962.375] (-958.699) (-962.094) * (-958.992) [-959.415] (-962.822) (-958.218) -- 0:00:44
289500 -- (-959.367) [-960.063] (-960.448) (-959.417) * [-958.799] (-963.054) (-963.894) (-958.517) -- 0:00:44
290000 -- (-961.850) [-961.650] (-960.446) (-960.511) * [-960.065] (-966.606) (-961.949) (-959.606) -- 0:00:44
Average standard deviation of split frequencies: 0.010840
290500 -- [-960.973] (-959.768) (-960.743) (-958.632) * (-959.859) [-960.835] (-964.912) (-960.109) -- 0:00:43
291000 -- [-962.734] (-960.457) (-960.497) (-961.237) * (-961.009) [-960.851] (-963.078) (-958.721) -- 0:00:43
291500 -- (-959.699) (-960.508) (-959.440) [-961.856] * (-960.925) (-963.885) [-959.396] (-961.800) -- 0:00:43
292000 -- [-961.544] (-962.925) (-959.498) (-960.073) * [-960.979] (-962.035) (-960.167) (-962.947) -- 0:00:43
292500 -- (-960.298) (-958.760) (-960.425) [-959.066] * (-960.650) (-958.256) (-960.089) [-964.380] -- 0:00:43
293000 -- [-958.602] (-964.220) (-959.657) (-960.502) * (-959.971) (-962.198) [-960.091] (-958.721) -- 0:00:45
293500 -- (-959.129) (-962.487) [-958.862] (-962.479) * (-960.267) (-958.344) (-961.320) [-964.203] -- 0:00:45
294000 -- [-959.068] (-961.881) (-961.317) (-959.190) * (-959.084) (-960.205) (-963.702) [-960.658] -- 0:00:45
294500 -- (-961.557) (-961.697) [-961.366] (-959.294) * (-960.547) (-958.323) [-960.591] (-959.843) -- 0:00:45
295000 -- (-965.823) [-960.480] (-961.757) (-960.838) * (-960.046) [-960.040] (-960.449) (-960.732) -- 0:00:45
Average standard deviation of split frequencies: 0.011064
295500 -- [-962.668] (-962.396) (-962.442) (-958.570) * (-960.718) [-960.565] (-961.896) (-961.053) -- 0:00:45
296000 -- (-963.207) [-959.207] (-958.733) (-960.371) * (-960.911) (-960.123) (-959.033) [-961.464] -- 0:00:45
296500 -- (-960.681) (-959.219) (-961.677) [-960.657] * (-959.114) [-959.679] (-959.020) (-960.114) -- 0:00:45
297000 -- (-959.989) [-960.032] (-960.733) (-964.977) * [-958.820] (-959.865) (-961.022) (-963.111) -- 0:00:44
297500 -- (-958.036) [-960.310] (-959.440) (-959.885) * (-960.362) [-958.891] (-960.913) (-961.614) -- 0:00:44
298000 -- (-959.074) (-960.552) [-959.413] (-962.309) * (-962.394) (-959.846) [-959.619] (-959.338) -- 0:00:44
298500 -- [-960.498] (-961.251) (-959.432) (-962.653) * (-960.411) (-961.882) (-959.782) [-961.248] -- 0:00:44
299000 -- [-962.060] (-962.841) (-960.528) (-964.277) * (-961.252) (-959.757) (-959.422) [-960.124] -- 0:00:44
299500 -- (-958.462) (-960.970) [-958.936] (-960.283) * (-961.368) (-962.192) [-959.486] (-960.953) -- 0:00:44
300000 -- (-958.579) [-964.663] (-959.273) (-965.229) * (-964.586) (-960.602) [-959.075] (-959.426) -- 0:00:44
Average standard deviation of split frequencies: 0.011965
300500 -- (-961.063) [-960.060] (-962.357) (-961.628) * [-959.004] (-960.391) (-959.710) (-962.397) -- 0:00:44
301000 -- [-960.766] (-962.562) (-961.227) (-960.791) * (-960.452) (-960.609) [-961.437] (-961.161) -- 0:00:44
301500 -- (-960.809) (-959.830) (-961.436) [-958.997] * (-959.764) [-958.353] (-960.734) (-961.412) -- 0:00:44
302000 -- [-959.523] (-961.363) (-961.781) (-965.543) * (-960.661) [-959.134] (-961.540) (-959.942) -- 0:00:43
302500 -- [-964.951] (-961.457) (-961.231) (-963.332) * [-959.925] (-960.327) (-961.741) (-959.494) -- 0:00:43
303000 -- (-962.750) [-959.610] (-960.798) (-960.022) * [-962.942] (-964.425) (-959.331) (-958.641) -- 0:00:43
303500 -- [-960.164] (-961.041) (-961.266) (-960.912) * (-961.617) (-964.781) [-958.591] (-958.692) -- 0:00:43
304000 -- [-958.751] (-962.336) (-963.690) (-961.051) * (-965.387) (-960.062) (-958.588) [-959.201] -- 0:00:43
304500 -- (-958.763) (-958.778) (-962.964) [-958.392] * (-964.794) (-962.282) (-959.164) [-959.410] -- 0:00:43
305000 -- (-958.172) (-959.169) (-964.361) [-959.715] * (-959.289) (-959.233) [-960.685] (-963.546) -- 0:00:43
Average standard deviation of split frequencies: 0.012892
305500 -- (-958.628) [-960.965] (-962.907) (-959.113) * [-960.222] (-961.452) (-963.202) (-958.361) -- 0:00:43
306000 -- (-959.674) (-961.217) (-963.591) [-958.719] * (-958.225) (-958.761) (-960.040) [-963.127] -- 0:00:43
306500 -- (-962.029) (-958.312) [-959.550] (-959.562) * (-958.900) [-958.602] (-959.684) (-963.293) -- 0:00:42
307000 -- (-958.750) [-958.782] (-959.827) (-962.082) * (-959.082) [-960.047] (-960.706) (-965.428) -- 0:00:42
307500 -- (-958.195) (-961.317) (-961.398) [-960.412] * (-961.030) [-963.382] (-961.576) (-961.421) -- 0:00:42
308000 -- (-960.422) (-962.663) (-960.891) [-962.527] * (-962.744) [-959.646] (-960.463) (-962.059) -- 0:00:42
308500 -- (-959.045) (-966.021) [-959.775] (-962.331) * (-960.640) (-963.811) (-960.463) [-960.213] -- 0:00:42
309000 -- (-959.932) (-962.170) [-960.640] (-964.485) * (-962.826) [-961.047] (-961.242) (-964.652) -- 0:00:42
309500 -- [-962.451] (-960.009) (-961.586) (-960.370) * (-961.982) (-961.607) [-960.172] (-962.680) -- 0:00:44
310000 -- (-961.805) (-959.952) (-960.323) [-961.500] * (-962.152) (-962.868) [-960.183] (-962.626) -- 0:00:44
Average standard deviation of split frequencies: 0.011820
310500 -- [-963.218] (-961.572) (-960.494) (-959.865) * (-961.420) (-960.666) [-960.011] (-961.135) -- 0:00:44
311000 -- (-958.353) [-961.624] (-960.168) (-966.768) * [-964.514] (-958.862) (-962.750) (-959.447) -- 0:00:44
311500 -- (-960.868) (-962.404) [-962.329] (-962.212) * (-960.671) (-960.533) (-966.071) [-960.758] -- 0:00:44
312000 -- (-963.044) [-963.682] (-961.103) (-961.852) * (-961.682) (-964.727) (-958.906) [-962.237] -- 0:00:44
312500 -- (-959.300) (-963.331) [-959.851] (-959.289) * [-960.387] (-961.283) (-960.341) (-960.147) -- 0:00:44
313000 -- (-961.642) (-962.301) [-958.262] (-960.110) * [-961.611] (-962.529) (-960.059) (-960.681) -- 0:00:43
313500 -- (-959.482) [-961.289] (-959.111) (-963.223) * (-962.320) (-959.404) (-962.754) [-961.451] -- 0:00:43
314000 -- (-959.982) (-960.939) (-963.657) [-960.982] * [-959.147] (-959.482) (-958.398) (-965.464) -- 0:00:43
314500 -- (-958.483) (-963.223) [-961.005] (-961.114) * (-961.718) (-961.593) (-960.276) [-960.871] -- 0:00:43
315000 -- [-958.208] (-958.804) (-962.692) (-962.318) * (-959.622) [-959.997] (-960.431) (-960.328) -- 0:00:43
Average standard deviation of split frequencies: 0.011777
315500 -- [-961.655] (-958.612) (-961.656) (-962.808) * [-959.995] (-959.400) (-958.159) (-959.162) -- 0:00:43
316000 -- (-959.163) [-959.112] (-965.279) (-962.759) * (-960.329) [-958.981] (-959.132) (-960.990) -- 0:00:43
316500 -- (-961.794) [-960.927] (-961.628) (-959.610) * [-959.361] (-959.753) (-959.286) (-960.926) -- 0:00:43
317000 -- (-959.415) (-960.493) (-961.833) [-960.484] * (-960.372) [-960.118] (-961.290) (-959.470) -- 0:00:43
317500 -- (-959.709) [-959.293] (-962.063) (-965.793) * (-960.622) (-960.112) (-961.995) [-960.262] -- 0:00:42
318000 -- [-963.123] (-959.797) (-959.389) (-963.103) * (-960.625) [-959.797] (-962.440) (-959.130) -- 0:00:42
318500 -- (-962.726) (-964.339) (-959.863) [-960.542] * (-962.987) (-958.955) (-960.541) [-961.881] -- 0:00:42
319000 -- [-961.931] (-959.971) (-966.737) (-958.963) * (-967.974) (-958.982) (-960.815) [-959.382] -- 0:00:42
319500 -- (-961.624) [-960.344] (-959.531) (-959.236) * (-959.726) [-960.593] (-964.024) (-960.709) -- 0:00:42
320000 -- (-965.483) (-959.877) (-959.596) [-959.030] * (-961.547) (-963.296) [-959.580] (-969.936) -- 0:00:42
Average standard deviation of split frequencies: 0.010600
320500 -- (-968.227) [-958.569] (-958.977) (-958.737) * (-961.327) [-961.430] (-960.400) (-959.821) -- 0:00:42
321000 -- (-961.147) (-959.821) [-958.433] (-959.588) * (-960.631) (-959.988) (-961.166) [-959.494] -- 0:00:42
321500 -- (-959.764) [-959.889] (-960.925) (-959.086) * (-962.058) [-958.854] (-962.864) (-964.567) -- 0:00:42
322000 -- (-960.938) [-959.487] (-965.190) (-963.730) * (-959.947) [-960.238] (-963.719) (-959.309) -- 0:00:42
322500 -- (-960.103) (-958.628) (-961.788) [-959.186] * (-960.163) (-963.820) (-961.283) [-959.944] -- 0:00:42
323000 -- (-958.461) (-959.074) [-959.850] (-959.271) * (-960.536) [-958.360] (-960.990) (-960.118) -- 0:00:41
323500 -- [-958.777] (-960.042) (-959.423) (-961.551) * (-960.856) [-958.265] (-962.477) (-958.316) -- 0:00:41
324000 -- (-960.483) (-960.726) (-959.524) [-962.313] * (-959.474) (-960.165) [-959.183] (-960.306) -- 0:00:41
324500 -- (-962.039) (-960.287) (-962.583) [-959.036] * (-966.142) [-959.976] (-962.185) (-966.307) -- 0:00:41
325000 -- (-962.660) (-959.082) [-964.225] (-961.681) * (-962.023) (-963.454) [-960.630] (-965.920) -- 0:00:41
Average standard deviation of split frequencies: 0.011188
325500 -- (-959.270) [-959.379] (-963.285) (-967.841) * (-963.046) (-964.151) (-959.493) [-963.600] -- 0:00:41
326000 -- [-964.363] (-959.295) (-958.699) (-966.501) * [-963.502] (-964.372) (-962.605) (-965.453) -- 0:00:43
326500 -- (-958.600) (-958.928) [-958.490] (-963.284) * [-960.518] (-959.465) (-961.393) (-961.564) -- 0:00:43
327000 -- (-959.123) [-962.281] (-958.471) (-960.450) * (-960.519) [-959.151] (-960.248) (-960.579) -- 0:00:43
327500 -- [-958.869] (-963.360) (-960.219) (-960.185) * (-959.453) (-960.942) (-962.239) [-959.206] -- 0:00:43
328000 -- (-959.750) (-962.885) (-959.632) [-959.360] * (-968.030) [-961.218] (-959.638) (-962.606) -- 0:00:43
328500 -- (-960.686) (-960.449) [-959.534] (-958.737) * [-962.194] (-961.723) (-962.754) (-961.289) -- 0:00:42
329000 -- (-960.705) (-961.753) (-961.120) [-962.189] * [-958.989] (-959.812) (-964.206) (-960.923) -- 0:00:42
329500 -- [-959.801] (-960.321) (-958.697) (-960.563) * [-959.799] (-961.222) (-958.883) (-960.903) -- 0:00:42
330000 -- (-962.625) (-959.899) [-961.019] (-958.359) * (-960.183) (-963.664) [-959.724] (-960.349) -- 0:00:42
Average standard deviation of split frequencies: 0.010851
330500 -- (-959.537) (-962.286) (-959.418) [-960.218] * [-958.848] (-964.586) (-959.046) (-964.587) -- 0:00:42
331000 -- [-961.596] (-962.186) (-965.822) (-961.180) * [-961.908] (-960.956) (-958.890) (-962.292) -- 0:00:42
331500 -- (-962.759) [-962.985] (-964.368) (-959.441) * [-960.596] (-960.193) (-960.039) (-961.302) -- 0:00:42
332000 -- (-960.137) (-958.658) (-959.776) [-958.936] * (-962.543) (-960.075) [-959.033] (-959.601) -- 0:00:42
332500 -- (-963.251) (-958.713) (-963.447) [-958.493] * (-962.051) (-959.917) [-961.306] (-960.006) -- 0:00:42
333000 -- (-960.224) [-958.874] (-959.884) (-961.010) * (-959.166) (-960.901) [-958.946] (-958.068) -- 0:00:42
333500 -- (-958.752) (-958.908) [-960.733] (-959.387) * (-961.073) [-960.244] (-963.130) (-959.228) -- 0:00:41
334000 -- (-962.729) (-961.270) [-959.236] (-962.126) * (-964.977) (-959.464) (-959.427) [-961.213] -- 0:00:41
334500 -- (-964.659) (-964.899) (-959.080) [-961.762] * (-959.860) [-959.245] (-961.092) (-968.703) -- 0:00:41
335000 -- (-965.895) (-961.735) (-961.289) [-959.974] * (-961.749) [-962.582] (-960.478) (-964.043) -- 0:00:41
Average standard deviation of split frequencies: 0.011925
335500 -- (-961.953) [-965.982] (-961.958) (-960.527) * (-961.691) (-962.253) [-960.977] (-967.983) -- 0:00:41
336000 -- (-959.560) (-960.146) (-960.827) [-958.579] * [-961.857] (-960.340) (-961.130) (-962.228) -- 0:00:41
336500 -- (-961.884) (-963.136) [-959.803] (-960.070) * [-961.685] (-958.802) (-959.236) (-966.009) -- 0:00:41
337000 -- (-962.407) (-960.101) [-959.284] (-958.749) * (-960.971) (-958.723) [-961.378] (-964.264) -- 0:00:41
337500 -- (-959.584) (-961.449) (-959.930) [-958.083] * (-964.569) (-958.149) (-967.224) [-959.204] -- 0:00:41
338000 -- (-960.895) (-965.918) [-962.852] (-962.771) * (-964.709) (-959.213) (-959.081) [-962.437] -- 0:00:41
338500 -- (-962.804) [-963.053] (-962.751) (-960.249) * (-960.933) (-958.442) (-958.953) [-960.731] -- 0:00:41
339000 -- (-960.130) [-959.572] (-963.122) (-960.183) * [-962.174] (-962.863) (-965.175) (-962.097) -- 0:00:40
339500 -- (-960.677) [-958.516] (-961.115) (-960.024) * [-960.576] (-959.639) (-959.794) (-958.874) -- 0:00:40
340000 -- (-963.725) (-960.559) (-962.456) [-959.106] * (-960.365) (-961.240) (-958.899) [-959.088] -- 0:00:40
Average standard deviation of split frequencies: 0.012070
340500 -- (-963.575) [-961.702] (-963.525) (-961.143) * [-959.748] (-961.113) (-958.555) (-965.056) -- 0:00:40
341000 -- [-962.219] (-963.287) (-960.751) (-958.938) * [-959.813] (-959.278) (-963.332) (-961.737) -- 0:00:40
341500 -- [-960.605] (-960.016) (-960.394) (-959.536) * (-961.181) [-959.204] (-962.427) (-963.047) -- 0:00:40
342000 -- (-961.815) (-961.429) [-959.041] (-959.216) * (-960.842) [-959.627] (-962.229) (-963.029) -- 0:00:40
342500 -- (-962.191) (-960.335) [-958.920] (-958.405) * (-961.582) (-959.124) (-959.416) [-960.330] -- 0:00:42
343000 -- (-961.756) [-960.229] (-959.325) (-962.262) * (-960.949) (-960.429) [-960.877] (-958.438) -- 0:00:42
343500 -- (-962.138) [-961.452] (-963.443) (-961.672) * [-962.203] (-958.978) (-960.789) (-958.328) -- 0:00:42
344000 -- (-962.126) (-961.681) (-963.442) [-960.345] * (-959.078) (-961.523) (-961.082) [-961.557] -- 0:00:41
344500 -- [-962.524] (-960.005) (-959.454) (-960.117) * [-959.829] (-960.533) (-961.666) (-959.689) -- 0:00:41
345000 -- (-964.758) (-959.801) [-960.967] (-960.091) * (-959.454) [-958.969] (-963.743) (-960.683) -- 0:00:41
Average standard deviation of split frequencies: 0.012692
345500 -- (-960.271) (-960.681) [-960.904] (-958.904) * [-959.527] (-959.967) (-962.783) (-960.731) -- 0:00:41
346000 -- [-961.950] (-966.590) (-961.311) (-958.965) * (-959.910) [-960.878] (-963.342) (-964.043) -- 0:00:41
346500 -- (-959.469) (-960.451) (-960.924) [-959.247] * [-959.830] (-960.584) (-958.343) (-959.168) -- 0:00:41
347000 -- (-959.511) (-961.776) [-959.795] (-959.684) * [-959.296] (-960.722) (-960.423) (-962.271) -- 0:00:41
347500 -- (-961.285) (-960.373) [-959.397] (-962.286) * (-959.131) (-960.049) (-959.642) [-960.722] -- 0:00:41
348000 -- (-963.391) (-959.550) [-959.934] (-959.128) * (-959.012) (-962.037) (-961.272) [-960.162] -- 0:00:41
348500 -- (-959.099) [-959.771] (-958.798) (-959.422) * (-962.904) [-959.136] (-959.290) (-960.275) -- 0:00:41
349000 -- (-959.142) (-960.435) (-960.573) [-960.782] * (-961.855) [-959.283] (-959.524) (-958.760) -- 0:00:41
349500 -- (-959.524) (-961.655) [-960.073] (-960.335) * (-960.568) [-959.130] (-962.312) (-959.047) -- 0:00:40
350000 -- (-959.968) (-960.706) (-959.888) [-960.523] * [-960.119] (-959.468) (-962.274) (-959.037) -- 0:00:40
Average standard deviation of split frequencies: 0.012248
350500 -- (-960.591) (-962.728) (-959.418) [-959.312] * (-959.713) (-960.426) [-961.239] (-964.255) -- 0:00:40
351000 -- (-959.040) (-959.804) [-959.584] (-961.601) * (-960.215) [-959.765] (-959.908) (-959.674) -- 0:00:40
351500 -- (-961.151) (-959.800) [-961.894] (-958.846) * (-960.156) [-958.478] (-960.320) (-959.061) -- 0:00:40
352000 -- (-963.336) (-960.268) [-959.737] (-961.490) * (-961.392) (-959.199) (-959.145) [-958.791] -- 0:00:40
352500 -- [-960.502] (-962.247) (-960.238) (-959.432) * (-962.054) [-959.462] (-959.676) (-961.810) -- 0:00:40
353000 -- (-962.001) [-959.879] (-965.072) (-958.800) * (-961.542) [-961.867] (-960.764) (-961.384) -- 0:00:40
353500 -- (-962.462) (-960.404) (-960.606) [-959.822] * (-960.179) (-964.220) (-961.485) [-959.985] -- 0:00:40
354000 -- (-960.919) (-960.865) (-961.869) [-962.669] * (-962.770) [-962.462] (-960.064) (-959.947) -- 0:00:40
354500 -- (-962.466) (-960.724) [-960.875] (-962.161) * [-960.135] (-960.366) (-960.092) (-959.346) -- 0:00:40
355000 -- [-960.190] (-958.603) (-961.561) (-962.111) * (-961.507) (-962.645) (-961.736) [-962.554] -- 0:00:39
Average standard deviation of split frequencies: 0.012151
355500 -- (-961.689) [-959.093] (-959.975) (-959.552) * (-961.215) (-966.140) (-964.093) [-961.042] -- 0:00:39
356000 -- (-959.887) (-961.925) (-959.682) [-959.982] * (-959.652) (-964.507) (-968.385) [-959.107] -- 0:00:39
356500 -- (-960.331) (-960.718) (-959.010) [-959.212] * (-960.886) (-963.103) (-961.189) [-958.695] -- 0:00:39
357000 -- (-960.216) (-963.566) (-958.439) [-961.244] * [-961.498] (-964.308) (-959.624) (-959.951) -- 0:00:39
357500 -- (-961.040) [-961.630] (-964.347) (-961.713) * (-959.571) [-959.379] (-961.893) (-959.515) -- 0:00:39
358000 -- (-962.535) (-961.497) [-960.979] (-963.789) * (-960.124) (-960.808) (-964.580) [-959.600] -- 0:00:39
358500 -- [-962.467] (-958.669) (-960.870) (-962.990) * (-961.751) (-958.437) (-962.607) [-959.669] -- 0:00:39
359000 -- [-962.285] (-961.637) (-960.816) (-960.432) * (-960.815) [-958.815] (-959.880) (-961.858) -- 0:00:41
359500 -- (-962.530) (-963.147) (-962.149) [-962.040] * (-961.107) (-963.275) [-958.710] (-959.573) -- 0:00:40
360000 -- (-959.186) (-959.827) [-960.082] (-961.734) * (-958.680) (-961.942) (-959.950) [-959.144] -- 0:00:40
Average standard deviation of split frequencies: 0.012302
360500 -- [-958.440] (-962.082) (-961.220) (-962.601) * [-958.664] (-959.635) (-959.769) (-958.430) -- 0:00:40
361000 -- (-958.921) (-965.138) [-959.617] (-960.802) * (-958.582) [-958.672] (-959.335) (-958.431) -- 0:00:40
361500 -- (-959.034) (-965.576) (-958.694) [-961.362] * (-967.350) (-961.422) (-960.143) [-958.384] -- 0:00:40
362000 -- (-961.007) (-959.549) [-959.937] (-962.707) * (-962.281) [-960.051] (-967.822) (-959.155) -- 0:00:40
362500 -- (-960.830) (-959.361) (-960.385) [-964.783] * (-959.046) [-958.471] (-961.499) (-959.277) -- 0:00:40
363000 -- [-963.501] (-959.820) (-963.868) (-964.731) * (-960.050) (-959.465) (-961.725) [-959.145] -- 0:00:40
363500 -- (-962.358) (-960.228) [-959.832] (-965.160) * [-959.716] (-958.455) (-961.544) (-959.300) -- 0:00:40
364000 -- (-960.721) (-960.601) (-959.718) [-962.369] * (-958.522) [-959.174] (-958.765) (-958.686) -- 0:00:40
364500 -- [-959.111] (-958.471) (-959.346) (-960.952) * (-960.685) (-960.091) [-959.498] (-958.694) -- 0:00:40
365000 -- (-965.234) [-960.893] (-959.985) (-960.940) * [-960.713] (-958.549) (-959.334) (-958.726) -- 0:00:40
Average standard deviation of split frequencies: 0.010759
365500 -- [-960.132] (-959.695) (-964.385) (-963.163) * [-960.145] (-959.436) (-959.598) (-959.770) -- 0:00:39
366000 -- (-960.150) [-960.879] (-963.425) (-959.325) * (-958.600) [-959.132] (-959.147) (-958.998) -- 0:00:39
366500 -- [-962.027] (-961.327) (-963.490) (-958.266) * (-959.161) (-961.112) (-960.545) [-958.922] -- 0:00:39
367000 -- (-959.093) (-961.301) [-960.610] (-961.611) * [-959.118] (-963.612) (-963.400) (-959.356) -- 0:00:39
367500 -- (-959.080) (-959.174) [-959.987] (-958.738) * [-959.557] (-960.073) (-959.652) (-960.845) -- 0:00:39
368000 -- [-959.044] (-959.444) (-961.113) (-962.472) * (-962.828) [-961.948] (-961.905) (-961.131) -- 0:00:39
368500 -- [-962.359] (-958.695) (-960.653) (-959.196) * (-962.808) (-959.759) [-960.749] (-962.061) -- 0:00:39
369000 -- (-965.198) (-959.904) [-961.430] (-961.067) * [-960.576] (-961.932) (-961.706) (-962.199) -- 0:00:39
369500 -- (-967.997) (-959.744) (-963.567) [-963.832] * (-959.363) (-961.418) (-960.292) [-961.563] -- 0:00:39
370000 -- (-968.041) [-961.684] (-959.285) (-961.268) * [-959.278] (-960.709) (-960.342) (-964.774) -- 0:00:39
Average standard deviation of split frequencies: 0.011446
370500 -- (-963.532) (-962.027) (-959.752) [-960.282] * (-959.287) [-960.188] (-960.309) (-960.476) -- 0:00:39
371000 -- (-959.793) (-961.531) (-959.765) [-960.643] * (-958.933) [-959.003] (-958.161) (-962.116) -- 0:00:38
371500 -- [-961.492] (-961.069) (-963.050) (-959.540) * (-960.244) (-958.511) [-958.649] (-962.012) -- 0:00:38
372000 -- (-961.119) (-959.275) (-959.552) [-962.260] * (-959.588) (-960.787) [-959.581] (-963.901) -- 0:00:38
372500 -- [-961.294] (-961.030) (-960.152) (-961.700) * (-961.636) (-960.570) [-960.442] (-962.952) -- 0:00:38
373000 -- (-959.517) (-960.619) (-958.985) [-958.409] * (-961.762) (-961.900) (-960.247) [-962.026] -- 0:00:38
373500 -- [-960.250] (-960.231) (-958.946) (-963.005) * (-960.443) (-964.404) (-959.333) [-958.612] -- 0:00:38
374000 -- [-959.840] (-961.865) (-958.992) (-961.349) * (-958.795) (-961.986) (-960.348) [-959.796] -- 0:00:38
374500 -- (-958.827) [-960.284] (-960.732) (-960.016) * [-962.082] (-961.529) (-959.936) (-959.312) -- 0:00:38
375000 -- (-959.723) (-962.079) (-964.801) [-960.495] * [-959.918] (-961.308) (-958.720) (-961.264) -- 0:00:38
Average standard deviation of split frequencies: 0.012694
375500 -- (-959.552) (-963.051) [-959.476] (-959.819) * (-959.601) (-959.683) [-959.990] (-960.505) -- 0:00:39
376000 -- (-960.032) (-959.360) (-961.938) [-959.011] * [-959.410] (-960.845) (-961.298) (-959.818) -- 0:00:39
376500 -- (-958.707) (-958.719) [-958.289] (-960.163) * (-959.485) [-961.988] (-959.841) (-958.854) -- 0:00:39
377000 -- [-961.244] (-960.242) (-959.466) (-960.574) * (-961.812) (-958.487) (-961.075) [-959.188] -- 0:00:39
377500 -- (-958.393) (-964.892) (-963.329) [-960.431] * (-961.760) [-961.922] (-961.013) (-959.980) -- 0:00:39
378000 -- [-961.474] (-959.145) (-962.382) (-960.394) * (-961.238) (-960.938) [-959.936] (-963.057) -- 0:00:39
378500 -- (-961.471) (-960.388) (-959.933) [-964.403] * (-961.639) (-960.490) [-966.224] (-965.852) -- 0:00:39
379000 -- (-962.296) (-962.038) (-958.606) [-962.075] * [-961.300] (-960.627) (-965.549) (-960.302) -- 0:00:39
379500 -- (-960.121) (-959.629) (-961.537) [-958.429] * [-961.790] (-959.346) (-966.847) (-959.769) -- 0:00:39
380000 -- (-960.372) [-961.176] (-960.996) (-958.478) * [-963.021] (-960.446) (-961.287) (-959.213) -- 0:00:39
Average standard deviation of split frequencies: 0.011455
380500 -- (-963.132) (-960.245) [-960.529] (-959.606) * (-959.122) (-961.668) (-962.148) [-961.030] -- 0:00:39
381000 -- (-959.564) (-962.413) [-961.667] (-960.128) * [-959.912] (-961.269) (-962.095) (-961.629) -- 0:00:38
381500 -- (-961.326) (-958.391) (-961.299) [-959.278] * (-959.818) (-958.533) (-959.114) [-960.140] -- 0:00:38
382000 -- [-960.336] (-961.366) (-962.406) (-960.563) * (-960.507) (-958.293) [-961.941] (-960.292) -- 0:00:38
382500 -- (-962.540) [-960.171] (-964.494) (-964.639) * [-959.548] (-958.181) (-959.266) (-960.567) -- 0:00:38
383000 -- (-958.798) [-959.302] (-960.455) (-959.667) * (-960.947) (-959.917) (-959.927) [-960.074] -- 0:00:38
383500 -- (-962.629) [-958.899] (-961.714) (-961.146) * (-960.725) (-962.500) [-959.260] (-960.524) -- 0:00:38
384000 -- (-961.907) [-960.501] (-959.979) (-958.601) * (-962.106) (-960.687) (-965.747) [-959.648] -- 0:00:38
384500 -- (-962.242) (-959.659) [-961.385] (-958.171) * [-959.388] (-959.130) (-966.676) (-964.111) -- 0:00:38
385000 -- (-960.587) [-961.175] (-959.796) (-959.196) * [-959.217] (-962.971) (-963.754) (-960.968) -- 0:00:38
Average standard deviation of split frequencies: 0.011063
385500 -- (-964.639) (-959.111) (-958.602) [-958.887] * [-961.381] (-963.414) (-962.131) (-964.181) -- 0:00:38
386000 -- (-959.256) (-959.789) [-961.103] (-963.329) * (-964.177) (-963.893) (-962.146) [-961.932] -- 0:00:38
386500 -- (-959.368) (-962.665) (-959.874) [-958.330] * (-960.761) [-961.508] (-963.563) (-961.957) -- 0:00:38
387000 -- (-961.387) (-959.553) [-962.218] (-960.761) * [-959.379] (-960.834) (-961.340) (-961.982) -- 0:00:38
387500 -- (-962.070) [-961.450] (-960.956) (-962.285) * (-960.251) [-960.785] (-959.783) (-960.906) -- 0:00:37
388000 -- (-965.609) (-958.883) (-959.733) [-961.664] * (-961.513) [-958.875] (-959.783) (-964.286) -- 0:00:37
388500 -- [-963.285] (-961.466) (-960.851) (-959.104) * [-959.846] (-959.246) (-959.026) (-962.040) -- 0:00:37
389000 -- (-964.093) (-960.407) [-959.577] (-962.239) * [-958.620] (-960.632) (-964.445) (-963.525) -- 0:00:37
389500 -- (-959.922) (-966.835) [-959.514] (-962.314) * [-958.533] (-961.973) (-961.431) (-961.015) -- 0:00:37
390000 -- [-958.574] (-960.645) (-959.078) (-959.768) * [-959.136] (-959.627) (-958.802) (-959.250) -- 0:00:37
Average standard deviation of split frequencies: 0.011162
390500 -- (-960.031) (-960.067) [-959.214] (-958.851) * [-960.697] (-960.642) (-958.820) (-958.413) -- 0:00:37
391000 -- (-961.195) [-961.509] (-963.071) (-959.851) * (-959.263) (-960.025) (-964.175) [-958.799] -- 0:00:37
391500 -- [-960.909] (-962.750) (-958.668) (-960.972) * (-961.343) (-959.788) (-958.584) [-961.677] -- 0:00:37
392000 -- (-960.012) [-965.468] (-958.684) (-960.601) * (-959.016) (-959.979) (-959.837) [-961.286] -- 0:00:38
392500 -- [-962.957] (-959.485) (-960.409) (-958.951) * (-963.015) [-959.984] (-960.437) (-964.373) -- 0:00:38
393000 -- (-962.093) (-964.372) (-958.639) [-958.732] * (-963.415) [-959.991] (-960.767) (-967.369) -- 0:00:38
393500 -- (-965.262) (-961.473) [-960.379] (-961.983) * [-959.170] (-959.620) (-959.907) (-960.259) -- 0:00:38
394000 -- (-960.784) [-959.102] (-965.855) (-964.510) * (-959.863) (-963.408) (-961.202) [-959.423] -- 0:00:38
394500 -- [-961.949] (-958.781) (-963.199) (-964.327) * [-962.400] (-959.150) (-961.757) (-961.066) -- 0:00:38
395000 -- [-961.080] (-958.954) (-966.804) (-960.229) * (-964.408) (-959.912) [-960.524] (-961.383) -- 0:00:38
Average standard deviation of split frequencies: 0.010639
395500 -- [-958.441] (-961.057) (-960.336) (-963.213) * (-961.926) (-960.259) (-966.022) [-959.487] -- 0:00:38
396000 -- (-958.461) (-962.571) [-959.098] (-958.335) * (-959.494) (-965.555) [-966.945] (-958.959) -- 0:00:38
396500 -- [-960.670] (-964.967) (-960.475) (-959.032) * [-963.713] (-961.780) (-960.646) (-959.230) -- 0:00:38
397000 -- (-961.661) (-968.095) (-963.045) [-959.145] * [-964.619] (-959.202) (-962.276) (-960.124) -- 0:00:37
397500 -- (-962.871) [-959.852] (-962.161) (-961.264) * (-963.986) (-962.687) (-959.877) [-960.125] -- 0:00:37
398000 -- (-960.788) (-961.712) (-962.891) [-961.685] * (-962.542) [-960.749] (-962.491) (-961.122) -- 0:00:37
398500 -- (-960.318) (-960.269) [-962.717] (-960.814) * (-961.557) (-959.881) (-960.797) [-960.799] -- 0:00:37
399000 -- [-961.189] (-959.893) (-959.789) (-962.360) * (-966.028) (-959.799) (-959.943) [-960.150] -- 0:00:37
399500 -- (-963.709) [-959.936] (-963.637) (-962.918) * (-967.038) (-960.915) [-961.290] (-961.739) -- 0:00:37
400000 -- (-959.930) (-962.653) [-963.241] (-961.137) * [-959.334] (-960.151) (-960.047) (-958.814) -- 0:00:37
Average standard deviation of split frequencies: 0.011324
400500 -- [-960.233] (-961.445) (-966.323) (-960.287) * (-960.575) (-960.588) (-964.331) [-960.701] -- 0:00:37
401000 -- (-959.491) [-959.947] (-959.697) (-959.483) * (-961.523) (-958.829) [-960.319] (-960.507) -- 0:00:37
401500 -- [-960.202] (-959.241) (-958.912) (-959.750) * [-961.900] (-958.495) (-960.084) (-959.136) -- 0:00:37
402000 -- (-961.671) (-959.564) (-958.547) [-958.813] * (-959.544) (-962.276) (-960.007) [-960.696] -- 0:00:37
402500 -- [-961.172] (-961.934) (-958.851) (-959.538) * [-959.933] (-960.119) (-963.309) (-961.717) -- 0:00:37
403000 -- [-963.460] (-968.026) (-959.481) (-961.061) * [-961.465] (-959.805) (-962.351) (-961.904) -- 0:00:37
403500 -- (-962.674) [-960.232] (-960.004) (-969.382) * (-963.136) [-958.447] (-960.671) (-961.784) -- 0:00:36
404000 -- [-960.073] (-960.503) (-963.479) (-966.961) * (-960.540) (-959.073) (-965.553) [-965.284] -- 0:00:36
404500 -- [-959.187] (-961.213) (-959.878) (-959.344) * (-960.953) (-959.463) (-959.226) [-961.330] -- 0:00:36
405000 -- [-959.543] (-960.691) (-962.166) (-960.458) * (-963.112) (-960.102) [-961.310] (-959.368) -- 0:00:36
Average standard deviation of split frequencies: 0.010668
405500 -- (-959.299) (-963.916) [-963.092] (-960.268) * [-959.256] (-960.512) (-959.443) (-960.068) -- 0:00:36
406000 -- (-961.644) (-960.829) [-960.404] (-959.366) * (-961.934) [-959.714] (-959.188) (-959.779) -- 0:00:36
406500 -- [-961.178] (-959.089) (-961.356) (-960.869) * (-965.778) (-959.282) (-959.078) [-959.452] -- 0:00:36
407000 -- (-959.768) [-962.273] (-960.271) (-959.257) * (-962.250) [-960.275] (-961.579) (-958.635) -- 0:00:36
407500 -- [-959.742] (-959.331) (-961.636) (-961.761) * [-960.445] (-961.286) (-961.777) (-960.485) -- 0:00:36
408000 -- (-961.543) (-959.577) (-961.649) [-960.266] * [-960.204] (-961.424) (-961.662) (-960.087) -- 0:00:36
408500 -- (-963.388) (-960.199) (-958.674) [-961.439] * (-960.845) (-962.343) [-959.869] (-960.513) -- 0:00:37
409000 -- (-959.451) (-961.028) [-959.094] (-960.582) * [-959.496] (-960.202) (-959.900) (-960.357) -- 0:00:37
409500 -- (-959.484) [-960.680] (-959.791) (-958.594) * [-959.261] (-960.677) (-962.109) (-964.305) -- 0:00:37
410000 -- [-962.296] (-961.831) (-960.327) (-965.290) * (-959.517) (-959.353) [-958.953] (-962.485) -- 0:00:37
Average standard deviation of split frequencies: 0.010833
410500 -- (-959.568) (-962.872) [-960.005] (-962.737) * (-963.011) [-964.761] (-960.415) (-962.506) -- 0:00:37
411000 -- [-960.034] (-962.865) (-961.656) (-960.287) * (-960.340) (-972.628) (-960.786) [-961.591] -- 0:00:37
411500 -- [-962.191] (-960.618) (-960.249) (-961.912) * (-961.901) [-964.099] (-958.648) (-962.233) -- 0:00:37
412000 -- (-961.494) (-960.614) (-961.436) [-960.231] * (-961.136) (-958.885) (-959.978) [-965.242] -- 0:00:37
412500 -- (-961.705) (-961.450) (-958.211) [-960.231] * (-959.636) (-959.065) (-963.730) [-960.153] -- 0:00:37
413000 -- (-963.526) (-961.946) [-958.211] (-959.178) * [-960.562] (-963.096) (-962.768) (-960.162) -- 0:00:36
413500 -- (-958.961) (-964.407) (-958.298) [-958.141] * (-961.612) [-960.521] (-959.768) (-962.711) -- 0:00:36
414000 -- (-962.365) (-962.950) [-959.046] (-958.669) * (-962.106) [-961.214] (-958.613) (-961.660) -- 0:00:36
414500 -- (-958.949) [-960.748] (-959.490) (-959.314) * (-961.325) [-958.414] (-962.617) (-959.876) -- 0:00:36
415000 -- (-958.534) (-959.034) [-960.698] (-962.765) * [-960.215] (-960.926) (-963.153) (-960.406) -- 0:00:36
Average standard deviation of split frequencies: 0.011261
415500 -- (-959.924) (-959.519) [-961.980] (-965.738) * (-962.255) (-967.375) [-959.069] (-960.727) -- 0:00:36
416000 -- [-958.765] (-960.171) (-959.640) (-961.618) * (-959.826) (-969.044) [-959.412] (-961.353) -- 0:00:36
416500 -- (-961.955) (-959.379) [-958.569] (-960.055) * [-959.125] (-962.046) (-959.206) (-962.077) -- 0:00:36
417000 -- [-962.236] (-960.890) (-959.601) (-959.035) * (-958.789) [-962.404] (-961.350) (-961.740) -- 0:00:36
417500 -- (-960.490) [-959.748] (-961.349) (-962.897) * (-961.426) (-959.815) (-964.214) [-962.788] -- 0:00:36
418000 -- [-959.962] (-959.232) (-959.600) (-961.131) * [-959.193] (-962.045) (-961.419) (-960.888) -- 0:00:36
418500 -- [-960.440] (-966.505) (-958.797) (-959.127) * (-961.915) (-961.196) (-959.681) [-963.454] -- 0:00:36
419000 -- (-962.847) (-961.724) [-959.269] (-961.125) * (-960.028) (-961.524) [-963.120] (-960.905) -- 0:00:36
419500 -- [-962.419] (-961.251) (-959.199) (-959.663) * (-958.975) (-961.802) [-960.461] (-963.631) -- 0:00:35
420000 -- (-959.991) (-958.427) (-967.360) [-959.792] * [-959.984] (-959.785) (-958.738) (-965.419) -- 0:00:35
Average standard deviation of split frequencies: 0.011907
420500 -- (-959.670) [-960.778] (-962.395) (-959.259) * [-961.604] (-963.860) (-964.828) (-965.893) -- 0:00:35
421000 -- (-959.710) [-961.697] (-962.437) (-958.894) * (-963.883) [-959.697] (-960.925) (-958.606) -- 0:00:35
421500 -- (-961.915) (-961.337) [-960.416] (-961.415) * [-961.971] (-964.514) (-959.097) (-961.457) -- 0:00:35
422000 -- (-965.760) (-960.855) [-962.057] (-964.223) * [-960.130] (-965.153) (-959.713) (-960.610) -- 0:00:35
422500 -- (-962.169) (-960.037) [-962.224] (-963.823) * (-965.072) (-963.265) (-959.782) [-959.235] -- 0:00:35
423000 -- (-961.165) (-961.283) [-960.693] (-966.160) * (-963.550) (-960.420) (-961.211) [-959.630] -- 0:00:35
423500 -- (-958.841) (-960.968) [-960.572] (-964.167) * (-960.667) [-963.282] (-961.713) (-963.563) -- 0:00:35
424000 -- [-959.681] (-958.391) (-960.228) (-962.301) * (-962.089) [-961.525] (-958.849) (-963.384) -- 0:00:35
424500 -- [-959.826] (-959.260) (-960.525) (-959.666) * (-961.185) (-961.614) [-959.253] (-960.149) -- 0:00:35
425000 -- (-961.380) (-960.626) (-961.470) [-960.627] * (-966.007) [-959.083] (-962.055) (-962.423) -- 0:00:36
Average standard deviation of split frequencies: 0.011688
425500 -- [-958.581] (-960.787) (-961.059) (-960.676) * (-963.421) (-960.346) (-964.603) [-962.542] -- 0:00:36
426000 -- (-958.288) (-960.582) (-958.587) [-960.568] * (-961.508) [-961.724] (-959.139) (-960.909) -- 0:00:36
426500 -- (-960.841) (-960.317) (-964.371) [-958.964] * (-961.409) (-962.532) [-958.925] (-962.682) -- 0:00:36
427000 -- [-958.580] (-959.261) (-960.674) (-958.414) * (-963.196) (-960.702) [-958.913] (-959.334) -- 0:00:36
427500 -- (-959.977) (-959.077) [-959.944] (-958.641) * (-961.285) (-960.051) (-962.008) [-959.138] -- 0:00:36
428000 -- (-959.315) (-959.119) [-959.973] (-963.468) * (-960.598) (-959.549) [-960.974] (-963.424) -- 0:00:36
428500 -- (-961.490) (-960.678) (-965.075) [-964.167] * [-960.598] (-960.864) (-961.065) (-961.822) -- 0:00:36
429000 -- (-958.345) (-965.070) (-960.530) [-963.368] * (-960.840) (-960.718) (-959.384) [-959.511] -- 0:00:35
429500 -- [-958.650] (-961.018) (-959.934) (-965.205) * (-964.501) [-960.438] (-959.356) (-959.512) -- 0:00:35
430000 -- (-963.154) [-959.349] (-960.734) (-961.270) * (-962.290) (-960.548) [-961.160] (-959.376) -- 0:00:35
Average standard deviation of split frequencies: 0.011203
430500 -- (-960.151) (-960.917) [-963.442] (-965.068) * (-962.189) (-961.219) [-962.118] (-960.126) -- 0:00:35
431000 -- (-963.512) (-964.346) [-960.937] (-962.455) * (-961.029) [-959.940] (-963.226) (-960.535) -- 0:00:35
431500 -- (-961.240) (-963.726) (-961.107) [-959.450] * [-958.773] (-960.872) (-962.022) (-959.889) -- 0:00:35
432000 -- (-960.665) (-958.935) [-959.358] (-959.396) * (-958.731) [-960.280] (-960.520) (-960.372) -- 0:00:35
432500 -- (-958.972) [-962.240] (-961.910) (-961.524) * (-962.640) (-967.657) (-963.688) [-960.993] -- 0:00:35
433000 -- [-958.824] (-959.471) (-959.767) (-961.832) * [-958.910] (-959.323) (-959.369) (-961.850) -- 0:00:35
433500 -- [-959.945] (-959.956) (-959.972) (-960.709) * [-959.076] (-965.861) (-960.828) (-962.412) -- 0:00:35
434000 -- (-963.132) [-958.740] (-963.475) (-958.251) * [-961.159] (-963.399) (-964.548) (-960.306) -- 0:00:35
434500 -- [-965.982] (-960.747) (-963.675) (-961.480) * [-961.109] (-961.517) (-960.330) (-962.141) -- 0:00:35
435000 -- (-964.887) (-959.361) (-961.596) [-963.314] * (-962.131) [-958.624] (-959.765) (-960.239) -- 0:00:35
Average standard deviation of split frequencies: 0.012637
435500 -- (-958.507) [-959.560] (-961.979) (-958.292) * (-963.404) (-962.876) (-958.656) [-962.765] -- 0:00:34
436000 -- (-964.627) (-961.836) (-958.726) [-958.938] * (-960.495) [-959.443] (-961.377) (-960.821) -- 0:00:34
436500 -- (-963.547) (-960.834) (-961.988) [-960.213] * (-964.029) (-959.291) (-958.418) [-960.382] -- 0:00:34
437000 -- (-965.420) (-959.130) (-962.650) [-960.420] * (-961.849) [-960.874] (-961.720) (-961.220) -- 0:00:34
437500 -- (-962.553) [-960.046] (-958.374) (-960.762) * (-961.011) [-958.953] (-960.549) (-960.126) -- 0:00:34
438000 -- [-961.787] (-960.017) (-958.253) (-959.508) * [-961.623] (-965.310) (-962.515) (-959.097) -- 0:00:34
438500 -- (-959.082) [-961.656] (-958.613) (-960.141) * (-959.091) [-959.286] (-959.809) (-962.075) -- 0:00:34
439000 -- [-960.254] (-961.692) (-960.791) (-962.963) * [-959.262] (-959.547) (-967.531) (-959.447) -- 0:00:34
439500 -- (-959.517) (-962.373) (-959.916) [-962.019] * (-959.630) (-961.947) (-958.943) [-959.982] -- 0:00:34
440000 -- (-960.807) (-961.285) [-959.624] (-962.317) * (-961.974) (-959.408) (-958.312) [-960.640] -- 0:00:34
Average standard deviation of split frequencies: 0.012636
440500 -- (-960.008) [-959.223] (-961.067) (-963.696) * [-962.105] (-958.926) (-959.061) (-960.084) -- 0:00:34
441000 -- (-958.631) (-958.604) [-959.714] (-964.395) * (-958.646) [-961.549] (-958.456) (-965.995) -- 0:00:34
441500 -- (-962.819) [-960.433] (-961.010) (-962.306) * [-958.525] (-962.904) (-963.515) (-959.711) -- 0:00:35
442000 -- (-960.596) (-959.441) (-959.984) [-959.187] * [-964.252] (-963.152) (-959.103) (-959.255) -- 0:00:35
442500 -- [-961.083] (-958.804) (-962.537) (-959.062) * (-961.988) (-964.184) (-961.230) [-959.028] -- 0:00:35
443000 -- (-962.684) [-962.408] (-959.846) (-959.813) * (-962.031) (-964.978) [-962.111] (-963.693) -- 0:00:35
443500 -- (-961.210) (-964.520) (-959.861) [-960.343] * (-961.711) (-961.441) (-962.646) [-958.578] -- 0:00:35
444000 -- (-960.727) (-960.573) (-959.742) [-960.318] * (-963.692) (-960.591) (-960.330) [-961.321] -- 0:00:35
444500 -- [-961.028] (-960.688) (-958.668) (-963.238) * (-960.308) [-959.258] (-962.038) (-961.863) -- 0:00:34
445000 -- (-961.595) (-960.063) (-960.873) [-959.858] * (-959.079) (-960.312) (-961.897) [-960.359] -- 0:00:34
Average standard deviation of split frequencies: 0.012023
445500 -- (-962.557) (-962.493) [-961.283] (-960.977) * (-963.726) [-962.864] (-961.269) (-960.700) -- 0:00:34
446000 -- (-963.563) [-963.893] (-959.357) (-959.734) * (-964.362) [-962.529] (-960.050) (-964.641) -- 0:00:34
446500 -- (-961.954) (-961.216) [-959.308] (-959.434) * (-961.268) [-959.872] (-961.881) (-965.240) -- 0:00:34
447000 -- (-961.485) (-960.051) [-961.410] (-958.771) * (-963.303) (-958.816) [-960.090] (-959.914) -- 0:00:34
447500 -- [-963.948] (-961.968) (-958.652) (-959.986) * [-960.479] (-961.140) (-958.901) (-960.363) -- 0:00:34
448000 -- [-964.381] (-960.520) (-958.793) (-963.215) * [-959.950] (-959.531) (-961.789) (-959.522) -- 0:00:34
448500 -- (-963.701) (-962.788) (-959.710) [-962.393] * (-960.074) [-960.868] (-960.627) (-960.027) -- 0:00:34
449000 -- [-960.889] (-960.802) (-960.373) (-961.377) * (-959.001) (-959.159) [-958.918] (-958.255) -- 0:00:34
449500 -- (-959.528) [-962.830] (-959.018) (-965.541) * (-960.376) (-961.094) [-958.762] (-958.354) -- 0:00:34
450000 -- (-959.917) (-959.150) (-961.961) [-963.219] * (-963.394) [-959.793] (-961.221) (-958.382) -- 0:00:34
Average standard deviation of split frequencies: 0.010952
450500 -- (-960.219) (-958.925) [-958.616] (-963.595) * (-960.463) [-959.564] (-963.326) (-959.498) -- 0:00:34
451000 -- (-964.035) (-958.925) (-959.906) [-960.790] * (-966.261) (-962.586) [-960.661] (-961.763) -- 0:00:34
451500 -- [-965.247] (-958.945) (-961.108) (-961.079) * (-970.413) (-959.030) (-960.289) [-960.138] -- 0:00:34
452000 -- (-962.760) (-961.703) (-961.562) [-960.172] * (-958.322) [-959.034] (-962.091) (-964.349) -- 0:00:33
452500 -- (-962.316) (-960.791) (-963.626) [-961.496] * [-959.016] (-962.304) (-959.555) (-965.303) -- 0:00:33
453000 -- (-962.303) [-959.240] (-958.759) (-961.283) * (-960.279) (-961.327) [-963.843] (-960.090) -- 0:00:33
453500 -- (-960.008) [-960.115] (-959.518) (-959.890) * [-960.731] (-958.513) (-960.950) (-961.168) -- 0:00:33
454000 -- (-962.204) [-960.994] (-960.265) (-962.061) * (-962.663) [-958.457] (-960.735) (-960.197) -- 0:00:33
454500 -- (-963.593) [-964.934] (-959.425) (-959.630) * (-961.096) [-959.526] (-960.519) (-960.592) -- 0:00:33
455000 -- (-960.807) (-960.287) (-961.086) [-959.887] * [-965.171] (-960.118) (-960.146) (-960.295) -- 0:00:33
Average standard deviation of split frequencies: 0.011113
455500 -- (-960.734) [-963.222] (-963.276) (-958.789) * (-959.492) (-963.901) [-958.979] (-959.838) -- 0:00:33
456000 -- (-961.584) (-961.704) (-961.793) [-958.906] * (-966.947) (-962.460) [-961.175] (-962.010) -- 0:00:33
456500 -- (-958.999) [-960.510] (-960.053) (-961.501) * (-960.197) (-962.954) (-960.692) [-959.328] -- 0:00:33
457000 -- (-959.685) (-964.726) [-958.400] (-962.688) * (-959.610) [-960.148] (-959.114) (-959.540) -- 0:00:33
457500 -- (-961.320) (-960.100) [-960.345] (-962.577) * (-960.675) (-961.558) [-959.670] (-960.048) -- 0:00:33
458000 -- (-960.439) (-960.731) [-961.546] (-959.731) * (-961.599) [-960.516] (-959.070) (-963.340) -- 0:00:34
458500 -- (-962.479) [-961.495] (-959.921) (-958.884) * (-962.123) (-958.341) [-958.960] (-963.080) -- 0:00:34
459000 -- (-961.153) (-959.761) (-961.257) [-961.267] * (-962.002) (-959.078) (-958.916) [-961.324] -- 0:00:34
459500 -- (-962.205) (-959.360) [-964.524] (-961.675) * (-966.531) (-960.350) (-960.037) [-959.910] -- 0:00:34
460000 -- (-959.873) (-959.387) (-964.069) [-959.574] * (-960.404) (-960.234) [-959.561] (-959.991) -- 0:00:34
Average standard deviation of split frequencies: 0.012484
460500 -- [-960.024] (-963.026) (-962.376) (-962.171) * (-959.696) (-963.842) (-965.025) [-959.190] -- 0:00:33
461000 -- [-958.823] (-962.984) (-959.972) (-959.544) * (-964.324) (-966.578) (-962.295) [-960.958] -- 0:00:33
461500 -- [-961.016] (-959.677) (-959.882) (-960.415) * (-959.890) (-961.452) (-960.590) [-960.161] -- 0:00:33
462000 -- [-962.129] (-961.244) (-962.279) (-960.948) * [-961.569] (-960.392) (-962.480) (-958.658) -- 0:00:33
462500 -- (-959.994) [-959.190] (-960.625) (-961.325) * (-961.465) (-960.440) (-966.355) [-961.182] -- 0:00:33
463000 -- [-964.063] (-960.228) (-961.017) (-959.687) * (-961.677) (-960.038) (-964.326) [-959.547] -- 0:00:33
463500 -- (-959.373) (-961.410) (-958.587) [-961.242] * (-959.546) (-963.875) [-962.801] (-958.909) -- 0:00:33
464000 -- (-960.054) (-960.435) [-958.722] (-960.264) * (-961.841) (-959.508) (-962.092) [-960.837] -- 0:00:33
464500 -- [-960.728] (-960.447) (-960.077) (-960.345) * (-963.922) (-961.374) [-958.675] (-964.986) -- 0:00:33
465000 -- [-960.721] (-961.591) (-959.840) (-960.513) * (-966.418) (-972.876) (-958.760) [-960.565] -- 0:00:33
Average standard deviation of split frequencies: 0.012544
465500 -- (-960.098) [-963.353] (-964.327) (-958.889) * (-965.134) (-960.039) [-959.015] (-961.019) -- 0:00:33
466000 -- (-959.138) (-960.229) [-961.010] (-960.132) * [-959.971] (-960.119) (-961.222) (-960.029) -- 0:00:33
466500 -- (-961.378) (-963.523) (-959.030) [-960.265] * (-960.873) (-963.313) (-960.973) [-960.269] -- 0:00:33
467000 -- (-962.027) (-961.498) [-960.001] (-959.517) * (-962.611) [-959.804] (-960.293) (-961.543) -- 0:00:33
467500 -- (-962.278) [-960.805] (-961.880) (-958.469) * (-963.747) (-962.198) [-962.766] (-963.424) -- 0:00:33
468000 -- (-962.971) (-963.618) [-965.021] (-958.384) * (-960.966) [-960.318] (-963.890) (-959.614) -- 0:00:32
468500 -- [-959.141] (-961.602) (-961.916) (-960.147) * (-962.064) (-961.610) (-963.448) [-959.863] -- 0:00:32
469000 -- (-962.174) [-963.384] (-962.609) (-959.563) * (-960.238) [-963.841] (-963.000) (-960.108) -- 0:00:32
469500 -- [-959.292] (-960.196) (-968.136) (-962.043) * [-959.285] (-959.787) (-962.950) (-961.238) -- 0:00:32
470000 -- (-959.388) (-961.462) (-962.460) [-960.335] * [-958.721] (-962.499) (-962.534) (-960.587) -- 0:00:32
Average standard deviation of split frequencies: 0.013287
470500 -- [-959.353] (-963.244) (-965.327) (-960.390) * (-961.278) (-961.113) (-960.349) [-960.587] -- 0:00:32
471000 -- [-959.404] (-961.824) (-960.235) (-960.676) * [-959.949] (-967.642) (-961.194) (-965.812) -- 0:00:32
471500 -- (-966.625) (-960.317) (-958.374) [-964.242] * (-959.942) (-964.765) [-961.100] (-962.234) -- 0:00:32
472000 -- (-959.743) [-960.547] (-962.651) (-962.528) * (-959.335) (-962.871) [-960.349] (-960.637) -- 0:00:32
472500 -- [-959.346] (-958.676) (-958.876) (-966.169) * (-960.719) (-960.540) (-961.621) [-960.069] -- 0:00:32
473000 -- (-961.465) (-958.373) [-958.379] (-964.775) * (-965.307) [-959.577] (-961.876) (-962.643) -- 0:00:32
473500 -- (-959.613) (-958.783) (-962.509) [-962.912] * (-963.131) (-960.126) (-962.130) [-960.846] -- 0:00:32
474000 -- (-961.057) (-963.409) (-959.254) [-959.739] * [-962.175] (-959.839) (-960.235) (-964.156) -- 0:00:32
474500 -- (-964.493) (-963.081) [-959.199] (-961.539) * [-959.047] (-961.187) (-960.076) (-959.247) -- 0:00:33
475000 -- (-961.923) (-960.416) (-959.175) [-959.529] * (-959.698) (-959.011) (-959.638) [-960.224] -- 0:00:33
Average standard deviation of split frequencies: 0.014063
475500 -- (-961.004) (-959.387) (-960.562) [-960.956] * (-959.268) (-959.055) (-964.435) [-960.157] -- 0:00:33
476000 -- (-959.917) (-959.440) [-960.313] (-960.278) * (-960.270) (-961.803) [-959.599] (-961.002) -- 0:00:33
476500 -- (-958.690) (-962.696) (-960.271) [-959.734] * (-964.518) (-958.176) (-959.831) [-958.356] -- 0:00:32
477000 -- (-960.993) (-962.047) [-961.173] (-958.930) * (-960.169) (-959.998) (-959.177) [-961.319] -- 0:00:32
477500 -- (-960.609) (-962.610) [-960.920] (-961.391) * (-959.868) [-961.297] (-961.749) (-959.434) -- 0:00:32
478000 -- (-964.327) (-960.520) [-960.166] (-959.405) * [-960.741] (-958.928) (-964.264) (-959.402) -- 0:00:32
478500 -- (-963.673) [-958.442] (-960.549) (-961.869) * (-965.021) (-960.868) [-964.850] (-958.184) -- 0:00:32
479000 -- (-960.055) [-960.758] (-958.713) (-960.365) * [-961.875] (-959.255) (-959.802) (-959.155) -- 0:00:32
479500 -- (-960.486) (-963.079) (-961.990) [-960.201] * (-963.244) (-959.834) (-960.554) [-959.365] -- 0:00:32
480000 -- (-961.074) (-958.867) [-962.023] (-959.457) * (-963.074) (-959.582) [-961.689] (-960.684) -- 0:00:32
Average standard deviation of split frequencies: 0.014123
480500 -- [-960.010] (-958.411) (-962.910) (-960.836) * [-959.636] (-958.738) (-965.473) (-958.906) -- 0:00:32
481000 -- (-961.298) [-958.375] (-963.389) (-960.408) * (-961.375) [-959.526] (-964.586) (-959.038) -- 0:00:32
481500 -- (-958.334) (-959.818) [-959.375] (-960.885) * (-961.740) (-961.324) (-958.235) [-960.625] -- 0:00:32
482000 -- [-961.533] (-959.191) (-959.430) (-963.498) * (-961.367) (-961.767) (-962.243) [-959.553] -- 0:00:32
482500 -- (-961.439) [-960.048] (-959.800) (-959.549) * (-959.510) [-962.826] (-962.541) (-959.152) -- 0:00:32
483000 -- (-960.047) (-963.194) [-960.538] (-962.001) * (-958.987) (-962.251) [-958.770] (-960.370) -- 0:00:32
483500 -- (-962.560) (-959.492) (-960.461) [-960.792] * [-960.256] (-960.289) (-960.733) (-961.540) -- 0:00:32
484000 -- (-960.557) (-959.549) [-959.258] (-961.092) * (-959.837) [-959.202] (-961.316) (-960.355) -- 0:00:31
484500 -- (-958.551) (-963.487) [-959.021] (-961.061) * (-959.781) [-960.237] (-959.237) (-963.692) -- 0:00:31
485000 -- (-959.111) (-965.045) (-961.242) [-962.531] * (-962.030) [-958.930] (-960.623) (-959.953) -- 0:00:31
Average standard deviation of split frequencies: 0.013701
485500 -- (-960.765) (-961.298) (-960.120) [-959.775] * (-960.124) (-962.121) [-960.531] (-959.246) -- 0:00:31
486000 -- (-959.598) (-958.917) [-960.322] (-961.257) * (-962.746) (-961.946) [-960.899] (-958.794) -- 0:00:31
486500 -- (-960.391) [-958.445] (-962.764) (-958.633) * [-959.345] (-960.329) (-960.923) (-958.774) -- 0:00:31
487000 -- (-959.629) (-961.207) [-962.050] (-960.464) * [-959.228] (-961.113) (-960.458) (-958.904) -- 0:00:31
487500 -- (-958.985) (-962.815) [-962.231] (-963.583) * (-958.855) [-959.587] (-961.460) (-958.981) -- 0:00:31
488000 -- (-962.989) (-964.556) [-965.213] (-966.008) * [-960.224] (-960.468) (-961.460) (-960.755) -- 0:00:31
488500 -- (-961.597) (-962.267) [-962.482] (-960.100) * (-963.319) (-959.626) [-960.548] (-961.643) -- 0:00:31
489000 -- (-961.094) (-960.203) [-962.572] (-959.610) * (-963.909) [-962.045] (-961.407) (-961.024) -- 0:00:31
489500 -- (-959.535) [-958.976] (-960.203) (-959.651) * (-960.685) (-961.312) [-960.066] (-960.084) -- 0:00:31
490000 -- (-962.261) (-960.988) [-961.095] (-962.845) * [-958.885] (-962.151) (-960.726) (-961.296) -- 0:00:31
Average standard deviation of split frequencies: 0.013751
490500 -- [-963.554] (-960.790) (-961.402) (-960.129) * (-961.356) (-965.102) (-959.380) [-961.011] -- 0:00:31
491000 -- [-962.188] (-964.255) (-960.607) (-959.645) * (-963.420) (-964.660) (-959.051) [-961.544] -- 0:00:32
491500 -- (-964.984) (-960.697) (-959.459) [-959.428] * (-965.553) [-960.359] (-960.786) (-963.518) -- 0:00:32
492000 -- (-958.722) [-962.247] (-960.786) (-960.193) * (-960.993) (-961.271) (-960.324) [-959.728] -- 0:00:32
492500 -- [-959.763] (-962.046) (-962.026) (-958.978) * (-960.993) [-965.137] (-963.745) (-961.099) -- 0:00:31
493000 -- (-960.313) [-961.834] (-960.056) (-962.369) * (-962.389) [-961.474] (-962.078) (-963.923) -- 0:00:31
493500 -- (-961.135) (-960.884) (-961.384) [-959.969] * (-960.741) [-964.102] (-961.695) (-960.363) -- 0:00:31
494000 -- [-962.841] (-960.516) (-962.985) (-959.756) * (-965.816) (-961.719) [-960.187] (-963.980) -- 0:00:31
494500 -- (-958.696) [-959.635] (-962.895) (-961.088) * (-958.614) [-960.767] (-960.814) (-961.429) -- 0:00:31
495000 -- [-963.581] (-959.005) (-964.549) (-959.312) * (-959.356) (-965.082) (-962.041) [-964.503] -- 0:00:31
Average standard deviation of split frequencies: 0.013813
495500 -- (-960.870) [-962.236] (-961.009) (-964.522) * (-962.411) (-959.790) (-963.497) [-961.373] -- 0:00:31
496000 -- [-958.401] (-961.350) (-960.332) (-963.136) * (-959.429) (-959.345) (-962.686) [-960.529] -- 0:00:31
496500 -- (-959.855) (-961.218) (-960.392) [-964.560] * (-959.073) [-959.454] (-961.667) (-960.432) -- 0:00:31
497000 -- (-962.438) [-959.816] (-961.269) (-959.384) * (-961.346) (-960.941) [-960.541] (-961.335) -- 0:00:31
497500 -- [-960.250] (-959.786) (-962.785) (-960.416) * (-961.621) (-961.042) (-960.342) [-959.300] -- 0:00:31
498000 -- [-960.983] (-962.888) (-961.562) (-958.995) * [-960.100] (-958.956) (-962.816) (-959.197) -- 0:00:31
498500 -- (-960.067) [-959.650] (-963.650) (-959.836) * (-960.083) (-958.898) (-961.467) [-959.625] -- 0:00:31
499000 -- (-960.978) (-959.710) (-960.487) [-958.534] * [-959.504] (-963.380) (-964.247) (-960.109) -- 0:00:31
499500 -- (-960.146) (-960.328) [-964.771] (-963.256) * (-960.004) (-959.774) [-964.324] (-959.425) -- 0:00:31
500000 -- (-962.291) (-959.024) [-961.586] (-962.149) * (-962.396) [-958.631] (-961.645) (-960.138) -- 0:00:31
Average standard deviation of split frequencies: 0.013182
500500 -- (-959.065) [-958.847] (-966.165) (-964.798) * (-960.069) [-958.895] (-961.254) (-958.883) -- 0:00:30
501000 -- (-960.546) (-962.028) (-965.947) [-966.357] * [-963.221] (-958.554) (-961.969) (-958.972) -- 0:00:30
501500 -- [-958.997] (-960.207) (-959.476) (-966.389) * (-962.536) [-959.526] (-960.619) (-959.560) -- 0:00:30
502000 -- (-959.622) (-959.406) (-959.985) [-963.563] * [-958.825] (-961.810) (-961.882) (-960.511) -- 0:00:30
502500 -- (-958.464) [-960.015] (-961.390) (-960.310) * (-958.851) (-961.748) [-959.160] (-960.843) -- 0:00:30
503000 -- (-960.032) (-959.419) (-959.916) [-961.396] * (-958.284) [-963.645] (-959.625) (-960.044) -- 0:00:30
503500 -- [-959.523] (-959.159) (-959.068) (-959.983) * (-959.414) (-965.526) (-961.840) [-959.872] -- 0:00:30
504000 -- (-959.359) [-959.419] (-959.661) (-959.425) * [-962.977] (-959.890) (-966.460) (-960.733) -- 0:00:30
504500 -- (-964.656) (-960.098) (-960.598) [-960.095] * (-962.177) (-961.135) (-961.185) [-960.036] -- 0:00:30
505000 -- (-960.074) [-959.667] (-961.443) (-960.759) * (-959.998) (-961.007) (-962.642) [-959.227] -- 0:00:30
Average standard deviation of split frequencies: 0.012693
505500 -- (-959.645) (-961.749) (-960.714) [-958.462] * (-962.790) (-960.073) (-962.945) [-958.621] -- 0:00:30
506000 -- [-958.845] (-962.386) (-964.917) (-959.203) * (-959.856) [-961.541] (-961.869) (-960.840) -- 0:00:30
506500 -- (-958.287) (-962.501) (-962.464) [-958.686] * (-959.986) (-959.976) [-959.858] (-959.743) -- 0:00:30
507000 -- [-960.147] (-962.662) (-962.047) (-959.852) * (-963.814) (-960.084) [-960.174] (-959.149) -- 0:00:30
507500 -- (-962.458) (-962.411) (-960.968) [-960.521] * (-961.400) (-959.348) [-961.148] (-959.848) -- 0:00:31
508000 -- (-961.169) [-958.941] (-960.972) (-959.305) * (-960.940) (-961.703) [-960.890] (-961.933) -- 0:00:30
508500 -- [-958.118] (-960.178) (-962.178) (-960.908) * (-959.534) (-962.578) [-959.755] (-961.256) -- 0:00:30
509000 -- (-959.406) [-960.828] (-962.993) (-959.819) * (-959.611) (-961.266) (-959.567) [-959.427] -- 0:00:30
509500 -- (-960.123) [-961.699] (-964.654) (-963.670) * (-960.660) (-961.138) [-961.883] (-959.054) -- 0:00:30
510000 -- (-958.922) (-959.996) (-960.505) [-959.756] * (-962.034) [-964.016] (-961.107) (-958.365) -- 0:00:30
Average standard deviation of split frequencies: 0.012174
510500 -- [-960.802] (-963.497) (-960.532) (-962.125) * (-961.621) [-959.713] (-961.060) (-958.384) -- 0:00:30
511000 -- (-963.510) (-958.881) [-961.882] (-962.052) * (-960.090) [-959.577] (-963.202) (-960.686) -- 0:00:30
511500 -- (-962.376) [-961.418] (-960.208) (-959.040) * (-962.267) [-960.965] (-961.204) (-960.029) -- 0:00:30
512000 -- (-960.385) (-958.242) (-961.075) [-963.759] * (-960.072) (-961.061) (-961.649) [-961.859] -- 0:00:30
512500 -- (-967.610) (-958.730) (-962.534) [-959.873] * (-963.102) [-960.508] (-962.321) (-963.103) -- 0:00:30
513000 -- (-967.097) (-961.011) [-959.803] (-960.017) * (-958.863) (-958.497) [-962.658] (-963.142) -- 0:00:30
513500 -- (-961.410) [-960.854] (-959.821) (-960.448) * (-959.072) [-961.012] (-959.749) (-966.262) -- 0:00:30
514000 -- (-960.526) (-960.735) (-960.107) [-962.867] * (-961.370) (-961.203) (-962.406) [-962.682] -- 0:00:30
514500 -- [-960.865] (-960.178) (-961.315) (-958.923) * [-964.044] (-962.800) (-966.288) (-959.061) -- 0:00:30
515000 -- (-959.427) [-959.160] (-965.263) (-959.577) * [-959.642] (-961.608) (-965.154) (-959.573) -- 0:00:30
Average standard deviation of split frequencies: 0.012105
515500 -- (-958.380) [-958.686] (-962.206) (-961.183) * (-960.509) (-961.621) (-959.376) [-959.580] -- 0:00:30
516000 -- (-958.745) [-958.291] (-960.134) (-960.315) * [-961.448] (-963.371) (-958.672) (-962.776) -- 0:00:30
516500 -- (-960.136) [-960.154] (-958.886) (-962.205) * (-960.612) [-960.407] (-961.940) (-960.538) -- 0:00:29
517000 -- [-958.655] (-959.031) (-959.358) (-961.060) * (-958.465) (-961.625) [-965.959] (-963.788) -- 0:00:29
517500 -- (-962.248) (-959.093) [-959.152] (-960.968) * (-960.799) [-962.193] (-961.690) (-959.124) -- 0:00:29
518000 -- [-959.431] (-958.966) (-958.568) (-960.324) * [-961.765] (-962.456) (-960.910) (-959.646) -- 0:00:29
518500 -- (-960.928) (-960.825) (-958.592) [-962.514] * (-960.949) [-962.027] (-960.583) (-959.024) -- 0:00:29
519000 -- (-958.627) (-961.844) [-959.006] (-959.851) * (-960.907) (-961.521) (-959.572) [-959.753] -- 0:00:29
519500 -- (-959.172) (-964.848) [-959.783] (-960.517) * (-958.845) (-959.918) [-959.860] (-960.912) -- 0:00:29
520000 -- (-964.233) (-958.573) (-964.396) [-959.140] * (-960.720) [-958.483] (-958.546) (-963.539) -- 0:00:29
Average standard deviation of split frequencies: 0.011996
520500 -- [-961.542] (-961.120) (-960.732) (-959.181) * (-960.453) (-959.593) [-958.621] (-962.262) -- 0:00:29
521000 -- [-960.945] (-960.456) (-961.334) (-958.946) * (-960.480) [-961.615] (-963.608) (-960.717) -- 0:00:29
521500 -- (-960.412) (-961.569) [-960.186] (-959.513) * [-961.294] (-964.534) (-963.779) (-962.423) -- 0:00:29
522000 -- (-959.954) (-962.778) (-961.926) [-959.656] * (-961.776) (-962.778) [-962.758] (-962.129) -- 0:00:29
522500 -- (-959.206) [-958.993] (-962.339) (-958.959) * (-960.565) (-963.261) (-959.131) [-960.842] -- 0:00:29
523000 -- (-961.651) (-959.072) [-960.157] (-958.450) * [-962.316] (-962.175) (-960.339) (-959.734) -- 0:00:29
523500 -- [-958.916] (-959.029) (-966.801) (-960.583) * (-960.882) (-960.197) (-960.511) [-960.071] -- 0:00:29
524000 -- [-960.291] (-960.594) (-960.960) (-962.561) * (-961.541) [-963.108] (-959.391) (-960.026) -- 0:00:29
524500 -- (-958.290) (-959.777) [-960.121] (-962.091) * [-961.603] (-960.182) (-959.697) (-962.460) -- 0:00:29
525000 -- (-963.302) (-959.554) [-963.102] (-960.795) * (-960.684) (-960.154) (-961.239) [-963.049] -- 0:00:29
Average standard deviation of split frequencies: 0.012267
525500 -- [-960.606] (-961.880) (-960.767) (-961.159) * (-959.939) (-961.516) (-959.353) [-962.336] -- 0:00:29
526000 -- (-960.618) (-965.308) [-959.027] (-959.150) * (-959.442) [-959.302] (-960.021) (-962.713) -- 0:00:29
526500 -- (-959.511) (-961.734) (-969.850) [-959.658] * (-959.188) (-959.307) [-960.458] (-960.759) -- 0:00:29
527000 -- (-959.024) (-958.717) (-963.044) [-959.563] * (-960.693) (-961.808) (-959.575) [-958.344] -- 0:00:29
527500 -- (-962.053) (-961.294) [-959.536] (-959.409) * (-962.951) (-960.191) (-961.046) [-959.683] -- 0:00:29
528000 -- (-962.455) (-958.710) [-958.152] (-960.607) * (-961.166) (-962.506) (-960.502) [-961.813] -- 0:00:29
528500 -- (-967.936) (-961.569) (-964.039) [-959.752] * (-962.103) (-960.993) [-959.568] (-965.838) -- 0:00:29
529000 -- (-961.676) (-959.153) (-961.136) [-960.608] * [-961.303] (-962.429) (-961.591) (-963.895) -- 0:00:29
529500 -- (-959.258) (-960.084) (-962.389) [-960.551] * [-960.984] (-960.663) (-960.396) (-960.060) -- 0:00:29
530000 -- (-959.981) [-959.223] (-961.780) (-958.627) * (-961.618) (-958.664) (-961.934) [-960.475] -- 0:00:29
Average standard deviation of split frequencies: 0.011493
530500 -- [-961.164] (-959.257) (-961.506) (-958.703) * [-960.205] (-959.462) (-962.782) (-960.735) -- 0:00:29
531000 -- (-961.555) [-960.635] (-960.163) (-959.932) * [-959.969] (-959.279) (-967.324) (-958.555) -- 0:00:29
531500 -- (-961.981) (-959.597) (-965.167) [-962.872] * (-960.349) (-963.456) [-959.078] (-961.996) -- 0:00:29
532000 -- (-962.233) (-962.005) [-959.950] (-963.967) * [-959.115] (-960.093) (-960.781) (-964.285) -- 0:00:29
532500 -- (-961.831) [-959.949] (-961.388) (-963.280) * [-959.595] (-960.351) (-959.647) (-961.823) -- 0:00:28
533000 -- (-961.239) [-959.686] (-962.023) (-963.544) * (-960.438) (-959.402) [-959.245] (-961.944) -- 0:00:28
533500 -- (-958.683) (-960.111) [-961.730] (-960.558) * [-961.974] (-961.994) (-959.440) (-963.836) -- 0:00:28
534000 -- [-959.993] (-959.777) (-958.439) (-958.761) * (-960.496) (-964.961) [-959.460] (-961.727) -- 0:00:28
534500 -- (-960.234) (-962.433) [-962.149] (-959.509) * (-961.695) (-960.329) [-962.398] (-962.329) -- 0:00:28
535000 -- (-959.738) (-963.978) [-960.589] (-959.203) * [-960.383] (-964.068) (-961.328) (-961.353) -- 0:00:28
Average standard deviation of split frequencies: 0.011488
535500 -- (-960.705) [-963.213] (-963.155) (-960.104) * [-963.263] (-962.624) (-959.347) (-960.609) -- 0:00:28
536000 -- [-960.363] (-962.585) (-961.228) (-959.664) * (-961.537) [-965.188] (-959.330) (-961.647) -- 0:00:28
536500 -- [-959.069] (-963.378) (-962.536) (-959.539) * [-960.988] (-960.630) (-961.292) (-963.986) -- 0:00:28
537000 -- (-959.038) (-963.360) (-958.979) [-960.215] * (-959.394) (-959.434) (-961.540) [-959.678] -- 0:00:28
537500 -- [-961.447] (-962.866) (-958.972) (-959.027) * (-959.433) (-959.280) (-960.648) [-960.438] -- 0:00:28
538000 -- (-963.210) [-959.503] (-964.312) (-960.600) * (-959.933) (-959.434) (-966.646) [-962.828] -- 0:00:28
538500 -- (-959.973) (-959.106) [-960.201] (-960.682) * [-960.320] (-959.927) (-967.050) (-959.595) -- 0:00:28
539000 -- (-958.895) [-959.323] (-959.321) (-961.988) * (-960.000) (-960.214) [-960.318] (-960.317) -- 0:00:28
539500 -- (-959.121) (-958.174) [-959.801] (-963.933) * (-964.004) (-961.755) (-960.599) [-959.269] -- 0:00:28
540000 -- (-958.622) [-959.751] (-960.251) (-960.181) * (-963.913) [-964.002] (-959.118) (-965.038) -- 0:00:28
Average standard deviation of split frequencies: 0.011062
540500 -- (-959.184) (-959.887) [-959.772] (-964.634) * [-959.401] (-961.919) (-962.402) (-960.860) -- 0:00:28
541000 -- (-963.944) (-961.465) [-958.897] (-960.919) * [-961.637] (-967.544) (-960.008) (-964.933) -- 0:00:28
541500 -- (-962.628) [-961.524] (-963.303) (-962.888) * (-959.690) [-960.785] (-958.246) (-963.062) -- 0:00:28
542000 -- [-960.415] (-967.348) (-964.111) (-960.751) * (-961.295) (-962.181) (-961.994) [-960.838] -- 0:00:28
542500 -- [-961.419] (-967.151) (-961.993) (-959.099) * (-961.302) [-961.777] (-964.617) (-959.371) -- 0:00:28
543000 -- (-959.700) (-962.388) [-961.166] (-961.358) * [-961.822] (-961.433) (-962.614) (-958.623) -- 0:00:28
543500 -- (-961.241) (-959.621) [-959.612] (-960.527) * [-961.399] (-964.141) (-962.123) (-965.002) -- 0:00:28
544000 -- (-959.734) (-958.799) [-959.679] (-961.409) * [-961.948] (-960.502) (-962.371) (-963.916) -- 0:00:28
544500 -- (-965.218) (-961.280) (-960.710) [-959.066] * [-962.694] (-961.009) (-962.743) (-958.574) -- 0:00:28
545000 -- (-958.824) [-961.253] (-961.266) (-960.633) * [-961.726] (-964.131) (-960.935) (-958.717) -- 0:00:28
Average standard deviation of split frequencies: 0.011656
545500 -- (-959.259) (-958.670) (-960.479) [-960.467] * (-961.452) (-959.587) [-962.580] (-960.256) -- 0:00:28
546000 -- (-960.551) (-959.393) [-960.633] (-962.342) * [-961.916] (-959.637) (-960.072) (-961.791) -- 0:00:28
546500 -- (-960.048) [-960.466] (-960.279) (-961.586) * (-961.573) [-962.370] (-960.814) (-961.530) -- 0:00:28
547000 -- (-962.694) (-959.344) (-961.749) [-963.238] * [-960.937] (-959.159) (-959.580) (-961.411) -- 0:00:28
547500 -- (-959.029) (-961.921) (-959.488) [-961.738] * (-960.063) (-961.426) [-958.971] (-959.952) -- 0:00:28
548000 -- (-958.928) [-965.357] (-959.893) (-962.475) * (-960.272) (-960.669) (-959.518) [-959.815] -- 0:00:28
548500 -- (-958.657) (-960.192) [-961.707] (-959.909) * (-959.260) (-961.645) [-962.709] (-960.392) -- 0:00:27
549000 -- (-958.657) (-960.872) (-960.332) [-959.081] * (-965.377) (-965.483) [-961.573] (-960.575) -- 0:00:27
549500 -- [-960.024] (-958.426) (-961.100) (-960.115) * [-959.422] (-960.228) (-959.496) (-960.364) -- 0:00:27
550000 -- [-958.612] (-958.837) (-960.311) (-959.927) * [-959.734] (-959.535) (-960.687) (-961.071) -- 0:00:27
Average standard deviation of split frequencies: 0.010754
550500 -- [-960.850] (-959.262) (-960.884) (-959.196) * (-962.713) [-959.719] (-962.452) (-958.989) -- 0:00:27
551000 -- [-959.617] (-960.802) (-958.714) (-959.351) * [-961.450] (-959.191) (-966.319) (-959.345) -- 0:00:27
551500 -- [-959.458] (-960.220) (-960.071) (-963.110) * [-959.712] (-963.876) (-959.539) (-959.623) -- 0:00:27
552000 -- [-960.717] (-962.329) (-961.586) (-960.908) * (-959.661) (-960.708) [-961.798] (-964.983) -- 0:00:27
552500 -- (-960.875) (-961.856) (-965.684) [-960.068] * (-958.951) (-959.576) (-960.645) [-962.928] -- 0:00:27
553000 -- (-963.390) [-959.488] (-959.725) (-963.666) * (-964.013) [-959.421] (-960.820) (-961.122) -- 0:00:27
553500 -- (-960.954) [-959.978] (-959.780) (-961.648) * (-959.730) [-959.863] (-960.621) (-960.981) -- 0:00:27
554000 -- (-962.256) [-958.776] (-960.065) (-958.717) * [-965.333] (-958.349) (-960.876) (-960.373) -- 0:00:27
554500 -- [-960.888] (-962.260) (-961.033) (-960.519) * (-963.046) [-958.327] (-958.889) (-960.280) -- 0:00:27
555000 -- (-960.058) (-960.868) [-959.762] (-962.221) * (-960.098) [-958.438] (-961.298) (-960.014) -- 0:00:27
Average standard deviation of split frequencies: 0.010386
555500 -- (-962.640) (-958.795) [-960.489] (-963.303) * [-959.702] (-959.420) (-959.711) (-959.374) -- 0:00:27
556000 -- (-959.955) (-959.002) (-960.086) [-962.721] * (-959.925) (-961.825) (-963.313) [-959.280] -- 0:00:27
556500 -- (-962.195) (-959.945) [-958.338] (-961.165) * [-958.292] (-961.812) (-963.826) (-959.353) -- 0:00:27
557000 -- (-959.845) (-961.463) [-961.807] (-962.396) * (-959.488) [-961.151] (-959.097) (-964.340) -- 0:00:27
557500 -- (-959.279) (-962.870) [-963.862] (-961.712) * (-960.045) (-963.563) [-959.311] (-960.195) -- 0:00:27
558000 -- (-961.898) (-961.126) (-963.634) [-960.847] * (-965.032) [-960.151] (-959.739) (-961.506) -- 0:00:27
558500 -- (-959.539) (-961.492) (-960.594) [-959.242] * (-960.904) [-960.669] (-962.304) (-960.589) -- 0:00:27
559000 -- [-960.163] (-960.188) (-958.500) (-960.379) * [-959.853] (-959.704) (-960.824) (-961.970) -- 0:00:27
559500 -- (-961.380) (-961.545) (-959.613) [-961.167] * (-959.602) [-962.253] (-962.659) (-960.393) -- 0:00:27
560000 -- (-961.566) [-963.770] (-961.910) (-963.281) * (-959.305) (-960.190) [-961.484] (-962.642) -- 0:00:27
Average standard deviation of split frequencies: 0.009984
560500 -- (-960.828) (-959.738) (-966.603) [-960.433] * (-962.528) (-961.610) [-960.988] (-958.415) -- 0:00:27
561000 -- (-959.666) (-958.675) (-961.762) [-960.522] * (-968.962) (-965.773) [-960.111] (-962.952) -- 0:00:27
561500 -- [-959.463] (-962.205) (-958.900) (-960.680) * [-965.362] (-961.283) (-960.763) (-960.486) -- 0:00:27
562000 -- (-959.710) (-965.697) (-963.363) [-960.809] * [-960.970] (-961.297) (-959.339) (-959.796) -- 0:00:27
562500 -- (-962.226) [-959.551] (-961.865) (-958.242) * (-961.376) (-960.814) (-963.452) [-960.210] -- 0:00:27
563000 -- (-962.576) [-959.621] (-963.649) (-960.886) * (-961.274) (-962.845) (-961.572) [-960.429] -- 0:00:27
563500 -- (-960.087) [-961.808] (-961.780) (-958.825) * (-961.444) (-969.275) (-961.577) [-958.396] -- 0:00:27
564000 -- (-959.155) (-959.520) [-959.241] (-962.647) * (-963.552) (-959.360) [-959.827] (-958.179) -- 0:00:27
564500 -- (-958.783) [-959.143] (-959.051) (-961.680) * [-966.083] (-960.750) (-961.066) (-958.805) -- 0:00:27
565000 -- (-960.601) (-958.228) [-959.237] (-960.958) * (-962.295) [-961.068] (-961.153) (-962.299) -- 0:00:26
Average standard deviation of split frequencies: 0.010567
565500 -- (-959.317) (-960.728) [-959.455] (-960.018) * (-962.938) [-958.766] (-961.036) (-958.980) -- 0:00:26
566000 -- [-959.317] (-958.510) (-961.211) (-961.187) * [-960.092] (-958.766) (-960.078) (-958.996) -- 0:00:26
566500 -- (-959.718) (-962.992) (-959.789) [-960.147] * [-960.289] (-960.172) (-961.005) (-959.142) -- 0:00:26
567000 -- (-959.304) (-962.861) [-959.438] (-961.041) * (-966.581) [-959.363] (-963.359) (-960.360) -- 0:00:26
567500 -- [-959.292] (-964.489) (-960.310) (-964.126) * (-964.792) [-958.459] (-964.222) (-967.788) -- 0:00:26
568000 -- (-961.931) (-962.257) [-960.648] (-960.785) * (-961.894) [-960.816] (-958.668) (-961.944) -- 0:00:26
568500 -- [-958.766] (-960.943) (-959.461) (-959.182) * (-963.931) (-962.499) [-959.665] (-961.381) -- 0:00:26
569000 -- (-961.313) (-959.936) [-959.530] (-959.297) * (-965.145) (-963.000) [-959.085] (-959.939) -- 0:00:26
569500 -- (-961.513) (-961.274) (-962.046) [-958.586] * (-960.045) (-960.713) (-958.474) [-959.416] -- 0:00:26
570000 -- (-959.721) (-961.029) [-960.261] (-961.218) * (-960.241) (-962.784) (-958.505) [-959.810] -- 0:00:26
Average standard deviation of split frequencies: 0.010636
570500 -- [-959.035] (-963.185) (-958.993) (-959.519) * [-962.717] (-960.771) (-960.320) (-961.566) -- 0:00:26
571000 -- (-961.720) (-960.548) [-959.001] (-961.445) * (-962.005) (-963.992) [-960.170] (-962.228) -- 0:00:26
571500 -- [-964.207] (-959.028) (-961.293) (-961.993) * (-959.922) (-961.120) (-962.639) [-963.568] -- 0:00:26
572000 -- (-963.648) [-961.354] (-962.311) (-961.553) * [-961.429] (-959.927) (-959.050) (-966.272) -- 0:00:26
572500 -- [-958.787] (-964.176) (-961.207) (-963.328) * (-959.806) [-959.108] (-961.848) (-964.029) -- 0:00:26
573000 -- (-960.153) (-961.737) (-958.597) [-961.639] * (-960.259) (-959.899) (-962.496) [-961.726] -- 0:00:26
573500 -- (-959.103) [-958.871] (-959.681) (-962.907) * (-964.780) [-961.826] (-967.084) (-959.670) -- 0:00:26
574000 -- (-962.593) (-958.865) [-960.104] (-959.552) * (-959.202) (-964.216) [-960.351] (-959.022) -- 0:00:26
574500 -- (-959.245) (-958.497) (-959.728) [-960.063] * [-964.926] (-962.356) (-959.501) (-958.988) -- 0:00:26
575000 -- (-960.002) [-958.502] (-963.743) (-961.108) * (-961.796) (-960.399) [-959.901] (-962.019) -- 0:00:26
Average standard deviation of split frequencies: 0.010486
575500 -- (-960.495) (-958.819) (-960.231) [-961.669] * (-961.061) [-959.421] (-961.009) (-963.190) -- 0:00:26
576000 -- (-960.160) (-960.037) [-959.235] (-963.688) * [-960.026] (-959.689) (-959.965) (-958.664) -- 0:00:26
576500 -- (-963.178) (-960.641) [-960.508] (-960.079) * (-961.502) (-959.616) [-959.861] (-959.863) -- 0:00:26
577000 -- (-959.788) (-959.386) (-960.360) [-960.092] * (-961.936) [-960.627] (-958.735) (-958.742) -- 0:00:26
577500 -- [-961.712] (-958.888) (-962.964) (-959.293) * (-963.215) (-964.578) [-961.643] (-960.913) -- 0:00:26
578000 -- (-958.723) [-959.234] (-969.513) (-961.396) * (-964.287) [-960.514] (-959.835) (-961.503) -- 0:00:26
578500 -- [-958.889] (-959.903) (-964.914) (-958.943) * [-963.494] (-959.864) (-958.686) (-965.849) -- 0:00:26
579000 -- [-962.559] (-961.292) (-959.686) (-962.546) * (-964.573) (-965.346) [-958.805] (-958.418) -- 0:00:26
579500 -- [-961.181] (-959.807) (-958.910) (-960.809) * [-963.384] (-960.133) (-959.200) (-959.506) -- 0:00:26
580000 -- (-961.859) (-962.269) (-959.852) [-958.915] * (-962.703) [-959.385] (-961.863) (-960.247) -- 0:00:26
Average standard deviation of split frequencies: 0.009285
580500 -- (-960.123) [-959.112] (-958.740) (-962.090) * (-962.965) (-959.351) [-962.918] (-959.291) -- 0:00:26
581000 -- (-963.354) (-959.185) [-959.156] (-962.789) * (-962.612) [-958.585] (-961.440) (-963.840) -- 0:00:25
581500 -- (-960.511) (-960.492) [-959.494] (-962.166) * (-959.317) [-959.720] (-959.788) (-959.653) -- 0:00:25
582000 -- (-960.144) (-959.829) [-960.123] (-959.241) * (-958.402) (-962.276) (-961.805) [-963.602] -- 0:00:25
582500 -- (-963.367) (-961.726) (-960.759) [-959.067] * (-958.326) (-961.544) (-961.305) [-961.910] -- 0:00:25
583000 -- [-959.004] (-958.536) (-959.059) (-959.189) * [-959.510] (-962.399) (-962.848) (-959.939) -- 0:00:25
583500 -- (-960.412) (-958.907) (-958.648) [-959.573] * (-959.218) (-960.356) (-960.992) [-959.458] -- 0:00:25
584000 -- (-965.250) [-959.415] (-958.829) (-960.779) * (-959.640) (-960.575) (-963.245) [-958.454] -- 0:00:25
584500 -- (-961.084) (-960.498) (-960.835) [-959.595] * (-960.487) [-959.779] (-959.113) (-962.393) -- 0:00:25
585000 -- (-962.395) (-959.040) [-959.877] (-960.317) * (-958.470) [-965.000] (-959.538) (-960.504) -- 0:00:25
Average standard deviation of split frequencies: 0.009653
585500 -- (-958.681) (-960.105) [-960.979] (-960.742) * (-958.651) [-960.783] (-962.621) (-961.116) -- 0:00:25
586000 -- (-960.709) (-960.379) [-961.154] (-959.039) * [-959.778] (-959.502) (-960.655) (-960.180) -- 0:00:25
586500 -- (-959.510) [-959.190] (-961.059) (-959.695) * (-961.103) (-963.149) (-959.956) [-959.643] -- 0:00:25
587000 -- (-958.655) (-959.066) [-958.633] (-960.529) * [-959.286] (-963.270) (-958.880) (-960.369) -- 0:00:25
587500 -- (-959.281) (-959.265) (-959.273) [-960.632] * [-960.617] (-960.484) (-958.841) (-960.485) -- 0:00:25
588000 -- (-960.682) (-962.838) [-962.796] (-961.127) * [-959.240] (-961.189) (-959.291) (-964.060) -- 0:00:25
588500 -- (-963.892) [-960.135] (-968.096) (-961.057) * (-960.551) (-960.209) [-958.486] (-961.228) -- 0:00:25
589000 -- (-962.997) [-960.048] (-963.334) (-959.313) * (-960.760) (-960.504) [-959.392] (-963.325) -- 0:00:25
589500 -- [-960.686] (-959.790) (-961.619) (-959.011) * [-963.541] (-960.602) (-959.210) (-961.984) -- 0:00:25
590000 -- (-961.649) [-960.481] (-962.683) (-963.708) * (-960.321) (-961.343) [-960.404] (-960.199) -- 0:00:25
Average standard deviation of split frequencies: 0.010187
590500 -- [-959.692] (-961.551) (-960.532) (-960.825) * [-958.934] (-959.720) (-962.958) (-959.197) -- 0:00:25
591000 -- (-961.384) [-960.566] (-960.778) (-959.406) * (-960.324) (-961.652) [-961.732] (-960.283) -- 0:00:25
591500 -- (-960.178) (-959.303) [-961.023] (-963.808) * (-962.470) (-964.376) (-964.808) [-961.811] -- 0:00:25
592000 -- (-959.936) (-958.214) (-959.484) [-960.985] * (-963.488) (-963.496) (-959.912) [-960.658] -- 0:00:25
592500 -- [-958.854] (-958.986) (-959.387) (-964.371) * [-960.460] (-959.376) (-959.976) (-958.990) -- 0:00:25
593000 -- (-963.646) [-958.371] (-959.255) (-961.196) * (-961.044) [-961.324] (-966.220) (-960.366) -- 0:00:25
593500 -- (-962.270) (-958.979) [-958.966] (-959.727) * (-960.160) (-966.951) [-964.388] (-959.666) -- 0:00:25
594000 -- (-959.237) [-961.429] (-958.340) (-958.187) * [-960.163] (-960.314) (-961.405) (-963.556) -- 0:00:25
594500 -- (-960.771) (-961.461) [-960.442] (-962.622) * (-959.394) (-959.810) (-966.367) [-960.084] -- 0:00:25
595000 -- [-963.740] (-967.217) (-960.215) (-959.361) * [-959.698] (-959.937) (-959.461) (-958.924) -- 0:00:25
Average standard deviation of split frequencies: 0.010183
595500 -- (-962.119) (-959.088) [-959.997] (-959.822) * (-958.750) (-959.300) (-962.561) [-959.022] -- 0:00:25
596000 -- [-959.506] (-958.799) (-958.707) (-967.398) * (-959.395) (-961.624) (-961.260) [-960.715] -- 0:00:25
596500 -- [-963.535] (-959.078) (-959.294) (-959.893) * (-961.400) (-959.906) [-960.018] (-958.886) -- 0:00:25
597000 -- (-964.954) [-963.477] (-960.626) (-959.110) * (-961.400) [-959.889] (-961.957) (-958.694) -- 0:00:24
597500 -- (-961.294) [-963.221] (-960.422) (-959.214) * [-960.462] (-959.209) (-962.671) (-959.155) -- 0:00:24
598000 -- (-961.570) (-965.537) (-959.515) [-961.301] * (-960.534) (-960.179) [-960.066] (-960.087) -- 0:00:24
598500 -- (-963.091) [-959.029] (-961.034) (-961.871) * (-960.011) (-962.624) [-962.262] (-959.438) -- 0:00:24
599000 -- (-959.353) (-960.500) (-960.838) [-959.499] * [-959.022] (-960.135) (-959.502) (-959.776) -- 0:00:24
599500 -- (-961.328) (-960.443) (-960.732) [-961.149] * (-963.614) (-959.660) (-958.767) [-962.271] -- 0:00:24
600000 -- (-959.760) (-959.819) [-959.933] (-962.154) * (-962.883) (-961.556) (-959.804) [-961.455] -- 0:00:24
Average standard deviation of split frequencies: 0.010055
600500 -- [-961.072] (-963.722) (-961.347) (-958.805) * (-964.240) (-962.008) (-961.730) [-960.513] -- 0:00:24
601000 -- (-960.008) [-961.871] (-960.837) (-960.811) * (-962.378) [-962.476] (-959.635) (-962.964) -- 0:00:24
601500 -- (-959.664) (-965.110) [-960.692] (-964.067) * (-962.657) [-964.870] (-962.532) (-962.781) -- 0:00:24
602000 -- (-958.800) (-959.447) (-961.853) [-959.295] * (-960.619) (-963.675) [-960.757] (-961.368) -- 0:00:24
602500 -- [-959.830] (-959.243) (-961.562) (-961.777) * (-958.367) [-960.102] (-963.637) (-960.487) -- 0:00:24
603000 -- (-959.645) [-965.272] (-961.793) (-958.854) * (-960.854) (-960.475) (-963.102) [-961.379] -- 0:00:24
603500 -- (-960.344) (-961.603) [-960.328] (-964.129) * (-962.476) (-960.469) [-959.899] (-959.841) -- 0:00:24
604000 -- (-963.754) (-959.881) [-960.704] (-962.763) * [-961.838] (-961.714) (-963.033) (-958.846) -- 0:00:24
604500 -- (-963.629) (-959.821) [-960.231] (-959.931) * [-960.378] (-961.368) (-960.102) (-960.478) -- 0:00:24
605000 -- (-960.758) (-959.536) [-959.491] (-958.740) * [-958.998] (-960.794) (-962.619) (-961.443) -- 0:00:24
Average standard deviation of split frequencies: 0.010064
605500 -- (-963.112) (-962.579) [-959.337] (-958.936) * (-960.388) [-962.669] (-961.946) (-960.952) -- 0:00:24
606000 -- [-961.269] (-960.405) (-959.241) (-959.977) * (-959.368) [-959.968] (-961.149) (-959.551) -- 0:00:24
606500 -- (-961.852) (-963.099) [-959.718] (-961.973) * (-960.770) (-960.999) (-963.217) [-960.467] -- 0:00:24
607000 -- (-960.514) (-959.500) [-964.844] (-959.941) * (-959.004) (-962.970) (-959.483) [-962.300] -- 0:00:24
607500 -- (-961.293) (-962.181) [-960.291] (-963.155) * [-960.974] (-962.571) (-962.952) (-962.208) -- 0:00:24
608000 -- (-962.787) (-960.153) [-960.869] (-962.899) * [-960.679] (-960.858) (-961.135) (-964.334) -- 0:00:24
608500 -- (-961.062) (-960.873) (-960.841) [-963.573] * (-960.412) (-961.531) [-959.250] (-960.119) -- 0:00:24
609000 -- (-959.576) (-962.046) (-962.375) [-962.443] * [-960.010] (-960.098) (-959.604) (-958.378) -- 0:00:24
609500 -- (-960.543) (-959.882) (-958.704) [-961.510] * [-962.276] (-959.968) (-959.616) (-963.943) -- 0:00:24
610000 -- (-961.821) (-960.019) (-961.436) [-960.566] * (-962.894) (-962.152) (-960.485) [-961.667] -- 0:00:24
Average standard deviation of split frequencies: 0.010373
610500 -- (-964.301) (-959.673) [-960.271] (-959.546) * [-961.338] (-963.222) (-960.332) (-961.667) -- 0:00:24
611000 -- (-961.788) (-960.273) [-958.931] (-964.825) * [-959.064] (-962.455) (-958.787) (-962.513) -- 0:00:24
611500 -- [-968.209] (-958.622) (-960.129) (-959.616) * (-959.367) (-958.819) [-960.545] (-959.702) -- 0:00:24
612000 -- (-963.182) (-959.793) (-960.558) [-965.969] * [-960.937] (-961.504) (-960.115) (-958.116) -- 0:00:24
612500 -- (-963.141) [-961.986] (-960.605) (-963.557) * (-959.460) (-963.076) (-962.050) [-958.354] -- 0:00:24
613000 -- [-962.773] (-968.347) (-959.233) (-960.780) * (-958.491) (-963.291) (-960.988) [-958.479] -- 0:00:23
613500 -- (-965.165) [-959.674] (-960.351) (-959.354) * (-959.473) [-960.678] (-961.989) (-959.025) -- 0:00:23
614000 -- (-963.062) (-960.714) [-960.741] (-959.746) * [-959.664] (-962.444) (-958.957) (-960.393) -- 0:00:23
614500 -- (-960.507) (-961.140) (-961.805) [-961.720] * (-962.208) (-960.383) [-958.936] (-962.859) -- 0:00:23
615000 -- (-960.276) (-960.223) [-966.736] (-966.952) * (-963.003) [-960.530] (-959.430) (-962.103) -- 0:00:23
Average standard deviation of split frequencies: 0.010140
615500 -- (-963.851) [-959.466] (-962.894) (-963.258) * (-961.303) (-959.393) (-959.616) [-959.554] -- 0:00:23
616000 -- (-961.400) (-959.965) (-961.045) [-959.762] * (-959.985) (-960.209) (-958.625) [-962.986] -- 0:00:23
616500 -- (-962.731) [-960.503] (-962.499) (-958.608) * (-960.140) (-959.343) (-958.752) [-960.392] -- 0:00:23
617000 -- (-961.865) [-959.504] (-961.475) (-958.735) * (-959.293) (-960.806) (-960.119) [-961.323] -- 0:00:23
617500 -- (-963.694) (-959.448) [-962.273] (-959.745) * (-959.649) (-959.081) [-961.766] (-961.512) -- 0:00:23
618000 -- [-965.251] (-961.392) (-960.703) (-960.120) * (-959.755) [-960.254] (-961.266) (-959.960) -- 0:00:23
618500 -- (-959.172) (-960.999) [-962.302] (-960.500) * (-963.186) [-960.746] (-961.838) (-959.749) -- 0:00:23
619000 -- (-959.398) (-963.255) (-962.963) [-961.876] * (-960.229) (-962.762) [-960.826] (-959.538) -- 0:00:23
619500 -- (-964.402) [-961.633] (-963.546) (-960.752) * (-961.445) (-959.165) (-959.368) [-958.984] -- 0:00:23
620000 -- [-959.922] (-959.349) (-962.111) (-961.700) * (-963.423) [-960.483] (-960.690) (-960.738) -- 0:00:23
Average standard deviation of split frequencies: 0.009874
620500 -- (-960.999) [-959.754] (-961.527) (-962.311) * (-959.331) [-960.125] (-960.042) (-959.886) -- 0:00:23
621000 -- (-960.267) [-960.883] (-965.069) (-960.870) * (-960.021) [-960.210] (-962.264) (-959.364) -- 0:00:23
621500 -- (-962.960) (-959.683) [-963.779] (-962.387) * [-959.071] (-959.269) (-960.011) (-960.504) -- 0:00:23
622000 -- (-959.157) (-958.896) (-961.493) [-959.494] * [-961.757] (-963.575) (-958.765) (-959.166) -- 0:00:23
622500 -- (-959.206) (-960.702) (-964.389) [-959.270] * [-959.253] (-962.088) (-964.371) (-962.266) -- 0:00:23
623000 -- (-965.750) (-961.637) [-959.031] (-959.564) * (-959.285) [-960.077] (-964.484) (-961.449) -- 0:00:23
623500 -- (-965.938) (-960.270) (-962.182) [-963.135] * (-959.019) (-964.511) (-960.081) [-959.858] -- 0:00:23
624000 -- [-960.329] (-964.539) (-969.819) (-960.799) * [-962.668] (-960.231) (-961.847) (-962.728) -- 0:00:23
624500 -- [-961.504] (-961.765) (-960.581) (-961.131) * (-967.688) (-958.941) (-961.677) [-959.137] -- 0:00:23
625000 -- [-959.599] (-959.684) (-960.617) (-959.945) * (-970.328) [-959.767] (-961.113) (-962.831) -- 0:00:23
Average standard deviation of split frequencies: 0.009978
625500 -- (-958.930) [-958.731] (-958.522) (-963.261) * [-960.084] (-964.387) (-959.382) (-963.494) -- 0:00:23
626000 -- [-959.436] (-960.027) (-960.482) (-958.920) * (-959.332) [-964.576] (-959.996) (-962.865) -- 0:00:23
626500 -- (-959.249) (-958.736) (-958.688) [-958.266] * (-965.298) (-964.418) [-959.983] (-958.950) -- 0:00:23
627000 -- (-959.945) [-959.320] (-958.664) (-958.934) * (-958.748) (-960.825) [-960.776] (-960.139) -- 0:00:23
627500 -- (-963.063) [-962.943] (-958.979) (-958.834) * [-959.816] (-961.344) (-960.702) (-960.826) -- 0:00:23
628000 -- (-962.067) (-963.037) (-959.153) [-958.937] * (-962.355) (-961.377) [-960.361] (-960.272) -- 0:00:23
628500 -- (-959.494) (-963.887) [-958.332] (-960.451) * (-962.635) (-958.845) [-960.775] (-960.013) -- 0:00:23
629000 -- [-959.289] (-962.922) (-964.108) (-966.341) * (-966.198) (-961.455) (-963.228) [-961.456] -- 0:00:23
629500 -- (-961.307) (-960.651) (-961.156) [-960.280] * (-961.310) (-960.665) [-960.464] (-959.969) -- 0:00:22
630000 -- [-961.210] (-965.483) (-959.496) (-960.463) * [-964.019] (-959.469) (-960.166) (-965.302) -- 0:00:22
Average standard deviation of split frequencies: 0.009764
630500 -- (-963.439) (-963.615) [-959.471] (-960.356) * (-960.811) (-959.293) (-959.286) [-965.875] -- 0:00:22
631000 -- (-960.877) [-961.477] (-962.038) (-961.720) * [-961.145] (-962.373) (-963.818) (-960.998) -- 0:00:22
631500 -- (-960.617) (-959.689) [-959.854] (-961.250) * [-962.409] (-960.313) (-959.375) (-965.199) -- 0:00:22
632000 -- [-958.908] (-958.539) (-958.505) (-958.523) * (-962.755) (-960.083) (-960.257) [-961.002] -- 0:00:22
632500 -- (-959.501) [-958.877] (-962.883) (-959.750) * (-960.909) [-960.771] (-958.799) (-963.779) -- 0:00:22
633000 -- [-958.779] (-960.187) (-961.236) (-959.353) * (-959.703) (-958.882) [-962.837] (-963.276) -- 0:00:22
633500 -- (-960.924) [-959.489] (-958.519) (-959.858) * [-958.794] (-961.261) (-960.000) (-962.734) -- 0:00:22
634000 -- (-963.761) (-958.181) (-958.742) [-964.566] * (-960.681) (-959.373) [-960.883] (-960.590) -- 0:00:22
634500 -- (-962.153) (-959.198) (-959.197) [-959.887] * (-961.496) (-960.169) [-959.336] (-958.372) -- 0:00:22
635000 -- [-960.347] (-964.465) (-960.933) (-963.662) * (-963.931) [-960.198] (-959.727) (-958.445) -- 0:00:22
Average standard deviation of split frequencies: 0.009682
635500 -- (-960.146) (-963.233) (-962.416) [-962.030] * (-959.058) (-971.509) (-960.615) [-959.974] -- 0:00:22
636000 -- (-960.157) (-963.407) (-958.963) [-960.327] * (-960.235) [-962.233] (-959.498) (-958.531) -- 0:00:22
636500 -- (-965.797) (-964.913) (-960.016) [-959.966] * (-960.086) (-959.985) [-959.987] (-959.742) -- 0:00:22
637000 -- [-961.673] (-968.638) (-960.726) (-960.395) * (-961.123) [-959.900] (-959.324) (-958.714) -- 0:00:22
637500 -- (-961.493) (-963.449) [-958.260] (-960.572) * (-961.081) (-960.486) [-959.386] (-958.752) -- 0:00:22
638000 -- (-961.080) (-962.180) (-962.680) [-960.996] * [-961.447] (-960.508) (-960.729) (-959.868) -- 0:00:22
638500 -- (-958.620) (-961.413) [-960.972] (-958.995) * (-960.737) [-960.286] (-961.699) (-959.603) -- 0:00:22
639000 -- (-960.660) (-959.399) [-964.618] (-959.961) * (-967.665) (-959.950) (-959.658) [-959.948] -- 0:00:22
639500 -- (-961.906) [-958.326] (-960.387) (-960.793) * [-959.513] (-964.877) (-959.950) (-959.716) -- 0:00:22
640000 -- (-961.325) [-959.358] (-960.751) (-958.340) * [-960.982] (-968.994) (-958.876) (-964.652) -- 0:00:22
Average standard deviation of split frequencies: 0.009427
640500 -- (-960.037) (-958.698) (-961.897) [-959.620] * (-961.900) (-961.546) [-960.481] (-961.354) -- 0:00:22
641000 -- (-961.161) (-961.500) (-958.800) [-958.452] * (-964.050) [-958.725] (-961.752) (-958.921) -- 0:00:22
641500 -- (-961.282) (-962.457) (-960.173) [-960.406] * (-960.317) (-964.005) [-962.284] (-959.596) -- 0:00:22
642000 -- (-963.640) [-958.815] (-959.309) (-960.351) * (-961.002) [-959.289] (-962.484) (-959.911) -- 0:00:22
642500 -- (-961.498) (-960.124) (-967.675) [-961.084] * (-959.690) [-960.313] (-960.317) (-960.742) -- 0:00:22
643000 -- [-959.591] (-961.007) (-963.713) (-961.249) * (-960.982) (-962.157) (-962.307) [-960.821] -- 0:00:22
643500 -- (-959.021) (-961.194) [-960.068] (-961.473) * (-960.535) (-960.395) [-960.932] (-959.190) -- 0:00:22
644000 -- [-959.303] (-963.045) (-959.442) (-964.423) * (-959.021) (-960.503) (-958.870) [-960.976] -- 0:00:22
644500 -- [-960.986] (-959.554) (-958.560) (-959.994) * (-963.201) (-959.168) [-961.411] (-964.854) -- 0:00:22
645000 -- (-959.931) (-961.277) (-960.918) [-961.135] * (-963.873) [-960.729] (-960.617) (-959.748) -- 0:00:22
Average standard deviation of split frequencies: 0.008757
645500 -- (-959.179) (-959.827) (-959.825) [-961.194] * (-961.078) (-962.862) [-962.228] (-961.891) -- 0:00:21
646000 -- (-961.367) [-959.254] (-967.086) (-964.840) * [-958.959] (-962.303) (-962.789) (-959.735) -- 0:00:21
646500 -- [-959.701] (-961.766) (-962.291) (-962.242) * (-958.454) (-960.425) [-959.568] (-960.511) -- 0:00:21
647000 -- (-961.244) [-958.363] (-962.628) (-961.131) * (-958.661) [-960.902] (-960.088) (-966.621) -- 0:00:21
647500 -- [-961.118] (-958.806) (-965.403) (-960.627) * (-968.522) (-959.412) (-960.174) [-961.468] -- 0:00:21
648000 -- (-964.110) (-960.220) (-961.175) [-960.145] * (-961.907) (-960.573) (-965.412) [-961.832] -- 0:00:21
648500 -- (-964.227) [-964.916] (-960.425) (-960.475) * (-970.705) (-960.876) (-964.671) [-961.601] -- 0:00:21
649000 -- (-959.845) (-960.515) (-961.014) [-961.507] * (-961.361) (-960.648) (-962.837) [-959.763] -- 0:00:21
649500 -- (-967.558) (-958.811) (-959.542) [-960.635] * (-961.517) (-960.508) (-959.481) [-961.598] -- 0:00:21
650000 -- (-962.981) (-959.111) (-959.028) [-960.845] * [-965.486] (-958.943) (-959.220) (-959.987) -- 0:00:21
Average standard deviation of split frequencies: 0.008468
650500 -- (-964.188) (-958.609) [-959.032] (-959.141) * [-960.179] (-960.171) (-962.201) (-958.212) -- 0:00:21
651000 -- (-964.813) [-960.805] (-958.857) (-960.670) * (-961.888) (-959.590) (-958.927) [-958.186] -- 0:00:21
651500 -- [-961.734] (-962.733) (-960.093) (-959.090) * (-963.560) (-959.805) (-962.984) [-960.947] -- 0:00:21
652000 -- (-960.058) [-960.538] (-961.866) (-959.569) * (-961.342) [-960.012] (-963.031) (-960.458) -- 0:00:21
652500 -- [-961.642] (-962.799) (-966.604) (-961.443) * (-958.936) [-960.507] (-964.840) (-961.131) -- 0:00:21
653000 -- (-960.360) [-959.211] (-965.975) (-960.148) * (-961.730) (-959.784) [-959.467] (-960.810) -- 0:00:21
653500 -- (-961.434) [-959.832] (-959.313) (-963.983) * (-960.831) [-958.489] (-959.242) (-959.758) -- 0:00:21
654000 -- (-963.927) [-960.093] (-960.947) (-959.933) * [-960.205] (-959.382) (-960.177) (-959.054) -- 0:00:21
654500 -- (-959.247) (-958.673) [-966.237] (-959.416) * [-959.638] (-961.551) (-961.253) (-959.732) -- 0:00:21
655000 -- [-961.720] (-960.602) (-961.098) (-962.045) * [-960.687] (-964.775) (-961.958) (-959.459) -- 0:00:21
Average standard deviation of split frequencies: 0.008129
655500 -- (-963.653) (-961.533) [-961.250] (-961.045) * (-960.383) [-962.173] (-959.353) (-960.060) -- 0:00:21
656000 -- [-961.646] (-966.077) (-959.804) (-963.800) * [-960.025] (-964.089) (-960.850) (-958.967) -- 0:00:21
656500 -- (-966.224) [-958.411] (-961.450) (-960.953) * (-959.778) (-959.389) [-959.025] (-960.652) -- 0:00:21
657000 -- (-959.386) (-960.296) [-960.027] (-961.491) * (-961.766) (-959.321) (-958.772) [-959.695] -- 0:00:21
657500 -- [-958.887] (-960.947) (-959.219) (-963.000) * [-958.885] (-961.655) (-961.330) (-961.862) -- 0:00:21
658000 -- (-958.288) [-958.996] (-960.002) (-966.069) * [-959.056] (-959.838) (-961.094) (-962.595) -- 0:00:21
658500 -- [-959.481] (-958.989) (-959.767) (-964.601) * (-959.525) (-962.528) [-962.067] (-958.256) -- 0:00:21
659000 -- (-960.511) [-960.800] (-961.520) (-960.237) * [-963.224] (-963.882) (-959.950) (-958.213) -- 0:00:21
659500 -- (-962.208) (-961.238) [-958.457] (-959.891) * (-963.080) (-962.962) (-960.381) [-961.462] -- 0:00:21
660000 -- (-964.621) (-960.727) [-960.301] (-962.063) * [-964.789] (-959.406) (-960.154) (-964.915) -- 0:00:21
Average standard deviation of split frequencies: 0.008250
660500 -- (-962.047) (-963.741) (-961.732) [-961.006] * [-962.752] (-959.902) (-960.686) (-962.061) -- 0:00:21
661000 -- (-959.859) (-960.151) [-960.774] (-959.316) * (-964.188) (-959.748) [-961.870] (-961.521) -- 0:00:21
661500 -- (-961.613) [-961.145] (-960.427) (-966.878) * (-961.369) [-960.932] (-964.635) (-967.467) -- 0:00:20
662000 -- (-964.906) (-959.548) (-958.650) [-958.973] * (-958.864) [-959.987] (-964.267) (-965.042) -- 0:00:20
662500 -- (-958.965) (-959.271) [-958.858] (-959.337) * [-960.392] (-964.809) (-964.979) (-960.643) -- 0:00:20
663000 -- (-965.303) (-965.746) [-959.301] (-962.187) * (-960.974) [-960.857] (-964.537) (-960.420) -- 0:00:20
663500 -- [-958.773] (-959.634) (-959.111) (-959.332) * (-961.276) [-961.864] (-961.115) (-960.998) -- 0:00:20
664000 -- (-959.700) (-960.416) [-959.449] (-960.429) * (-959.700) [-962.063] (-959.444) (-960.531) -- 0:00:20
664500 -- (-965.683) (-960.109) (-961.003) [-960.067] * (-958.738) (-961.588) (-959.914) [-959.204] -- 0:00:20
665000 -- (-960.125) (-959.313) (-960.332) [-960.797] * [-961.519] (-960.464) (-959.775) (-961.106) -- 0:00:20
Average standard deviation of split frequencies: 0.008715
665500 -- [-959.336] (-959.195) (-958.961) (-961.709) * (-961.351) (-959.418) (-958.958) [-962.765] -- 0:00:20
666000 -- [-959.504] (-961.420) (-958.703) (-960.787) * [-958.813] (-958.189) (-958.826) (-960.555) -- 0:00:20
666500 -- (-967.276) (-960.498) [-964.508] (-959.241) * (-959.449) (-961.426) (-960.666) [-959.137] -- 0:00:20
667000 -- (-959.215) (-961.785) (-959.361) [-958.749] * [-959.047] (-960.283) (-960.718) (-961.264) -- 0:00:20
667500 -- (-959.021) (-961.666) [-958.382] (-961.636) * (-960.413) (-961.140) [-958.584] (-960.771) -- 0:00:20
668000 -- (-959.552) [-962.170] (-961.599) (-961.238) * [-959.711] (-962.551) (-963.280) (-960.546) -- 0:00:20
668500 -- (-959.032) (-963.272) [-960.664] (-959.207) * (-959.238) (-961.331) (-963.996) [-961.143] -- 0:00:20
669000 -- [-958.569] (-959.366) (-961.316) (-960.030) * (-959.942) (-963.574) [-961.542] (-961.326) -- 0:00:20
669500 -- (-962.948) [-959.704] (-961.294) (-961.151) * [-959.698] (-963.131) (-961.218) (-958.225) -- 0:00:20
670000 -- (-960.870) [-963.343] (-959.424) (-963.988) * [-959.536] (-961.764) (-960.692) (-960.010) -- 0:00:20
Average standard deviation of split frequencies: 0.008303
670500 -- (-960.818) (-967.212) [-959.332] (-964.617) * [-961.777] (-958.585) (-962.124) (-960.494) -- 0:00:20
671000 -- [-959.696] (-959.027) (-959.333) (-961.658) * [-959.093] (-959.464) (-960.951) (-959.019) -- 0:00:20
671500 -- (-960.934) (-961.948) [-961.358] (-960.854) * (-959.643) (-959.257) [-959.168] (-959.277) -- 0:00:20
672000 -- (-963.159) (-966.694) [-960.217] (-962.780) * [-959.944] (-959.668) (-958.897) (-958.642) -- 0:00:20
672500 -- (-961.391) [-959.951] (-959.214) (-959.582) * (-960.687) (-963.447) (-959.471) [-958.942] -- 0:00:20
673000 -- (-959.734) (-960.391) (-962.888) [-959.937] * (-961.441) (-966.323) (-959.025) [-959.356] -- 0:00:20
673500 -- (-959.472) (-959.970) (-961.803) [-961.874] * (-962.076) (-958.374) [-958.528] (-963.390) -- 0:00:20
674000 -- [-963.942] (-958.687) (-959.483) (-963.036) * (-959.878) [-962.082] (-958.803) (-961.696) -- 0:00:20
674500 -- (-961.427) [-962.589] (-959.209) (-959.939) * [-960.791] (-961.113) (-959.958) (-959.549) -- 0:00:20
675000 -- (-959.517) (-964.387) (-958.172) [-958.319] * (-960.821) (-962.791) [-960.286] (-964.360) -- 0:00:20
Average standard deviation of split frequencies: 0.007932
675500 -- (-961.113) (-964.496) [-960.269] (-960.833) * (-961.875) [-959.070] (-961.015) (-963.188) -- 0:00:20
676000 -- [-960.752] (-967.974) (-966.117) (-960.803) * (-962.124) [-960.437] (-962.553) (-966.395) -- 0:00:20
676500 -- (-960.826) (-960.711) (-960.126) [-963.312] * (-960.514) (-963.913) [-960.900] (-959.712) -- 0:00:20
677000 -- (-960.276) (-963.116) [-961.884] (-961.531) * (-960.451) [-960.622] (-958.434) (-962.370) -- 0:00:20
677500 -- [-960.114] (-966.739) (-960.822) (-964.684) * [-958.972] (-960.393) (-959.420) (-959.112) -- 0:00:19
678000 -- (-960.815) [-963.881] (-958.730) (-960.092) * (-962.223) (-959.777) (-959.872) [-958.294] -- 0:00:19
678500 -- (-959.769) (-963.402) (-959.259) [-961.667] * (-958.895) [-961.700] (-958.916) (-959.490) -- 0:00:19
679000 -- (-961.857) (-962.063) (-961.525) [-961.291] * (-960.151) [-961.450] (-962.941) (-959.437) -- 0:00:19
679500 -- (-960.410) (-961.003) (-961.479) [-962.073] * (-962.484) (-958.908) (-958.843) [-958.542] -- 0:00:19
680000 -- (-961.368) (-961.245) [-961.551] (-959.260) * (-961.194) (-958.683) [-959.782] (-959.632) -- 0:00:19
Average standard deviation of split frequencies: 0.008094
680500 -- [-959.678] (-960.884) (-959.303) (-960.221) * (-961.065) (-962.556) [-962.324] (-960.060) -- 0:00:19
681000 -- (-959.427) (-964.676) [-958.843] (-959.460) * (-959.158) (-959.460) [-961.726] (-958.756) -- 0:00:19
681500 -- (-960.908) (-963.588) (-961.802) [-960.423] * [-961.056] (-960.055) (-962.260) (-959.439) -- 0:00:19
682000 -- (-961.565) (-959.819) [-961.706] (-961.464) * (-958.918) (-959.433) (-962.753) [-961.159] -- 0:00:19
682500 -- (-960.528) (-959.615) [-959.089] (-960.655) * [-961.315] (-960.952) (-959.687) (-960.263) -- 0:00:19
683000 -- (-964.185) (-958.594) (-958.591) [-959.356] * [-959.388] (-969.128) (-959.336) (-960.265) -- 0:00:19
683500 -- (-960.973) (-964.385) [-960.839] (-958.736) * [-959.825] (-961.267) (-958.706) (-961.714) -- 0:00:19
684000 -- (-959.075) [-959.407] (-962.062) (-959.608) * (-961.376) (-962.686) (-958.729) [-959.419] -- 0:00:19
684500 -- (-962.486) (-967.027) (-961.833) [-958.913] * (-959.968) (-961.901) (-959.288) [-959.803] -- 0:00:19
685000 -- (-961.846) (-965.762) (-959.550) [-960.880] * [-960.598] (-962.920) (-959.015) (-961.170) -- 0:00:19
Average standard deviation of split frequencies: 0.008031
685500 -- [-960.148] (-963.634) (-960.248) (-962.763) * [-961.149] (-960.185) (-960.412) (-962.899) -- 0:00:19
686000 -- (-960.771) (-964.024) [-963.362] (-959.966) * (-960.475) (-961.530) (-962.252) [-962.369] -- 0:00:19
686500 -- (-959.095) (-962.100) [-960.255] (-961.535) * [-959.266] (-960.877) (-959.985) (-962.848) -- 0:00:19
687000 -- [-959.400] (-960.239) (-960.236) (-958.326) * (-962.393) [-960.517] (-959.031) (-962.677) -- 0:00:19
687500 -- (-959.667) (-959.750) [-959.878] (-959.598) * (-958.943) [-959.181] (-961.641) (-962.356) -- 0:00:19
688000 -- (-959.270) (-961.064) (-958.913) [-960.328] * (-961.271) (-960.821) [-960.017] (-962.469) -- 0:00:19
688500 -- [-959.051] (-961.971) (-960.921) (-961.185) * (-960.995) (-962.798) [-960.348] (-960.368) -- 0:00:19
689000 -- [-959.208] (-959.623) (-963.317) (-959.720) * (-962.152) (-961.552) (-960.120) [-960.761] -- 0:00:19
689500 -- (-959.467) (-959.516) [-962.601] (-959.438) * (-962.250) (-963.055) [-961.186] (-960.015) -- 0:00:19
690000 -- (-961.774) (-960.417) (-969.744) [-961.284] * (-963.344) (-959.551) (-960.249) [-958.751] -- 0:00:19
Average standard deviation of split frequencies: 0.007593
690500 -- (-960.123) [-960.757] (-967.422) (-959.024) * (-962.557) [-959.283] (-959.409) (-962.996) -- 0:00:19
691000 -- [-959.690] (-958.313) (-960.409) (-959.919) * (-961.461) (-963.118) (-963.933) [-958.810] -- 0:00:19
691500 -- [-962.851] (-959.633) (-959.279) (-962.065) * (-961.998) (-962.674) [-960.156] (-964.295) -- 0:00:19
692000 -- (-962.461) [-962.316] (-959.362) (-963.879) * (-964.694) [-959.800] (-960.670) (-961.491) -- 0:00:19
692500 -- [-960.594] (-963.664) (-958.703) (-961.141) * (-960.302) (-962.148) (-958.694) [-961.288] -- 0:00:19
693000 -- (-966.326) (-959.909) (-959.749) [-961.239] * [-961.318] (-961.906) (-958.942) (-959.175) -- 0:00:19
693500 -- (-962.904) [-959.111] (-959.023) (-961.137) * (-959.921) (-960.470) (-958.412) [-958.909] -- 0:00:19
694000 -- (-967.566) (-958.592) (-959.068) [-960.157] * (-960.495) (-958.535) (-958.915) [-959.839] -- 0:00:18
694500 -- (-961.640) [-961.474] (-961.503) (-960.522) * (-962.272) [-960.182] (-958.971) (-958.516) -- 0:00:18
695000 -- (-962.484) (-960.325) [-962.885] (-963.939) * [-959.332] (-959.085) (-959.924) (-963.157) -- 0:00:18
Average standard deviation of split frequencies: 0.007196
695500 -- (-959.794) [-959.577] (-961.013) (-961.007) * [-959.639] (-960.725) (-960.495) (-958.947) -- 0:00:18
696000 -- (-960.674) (-963.642) [-958.121] (-959.301) * (-959.218) (-959.715) (-959.169) [-958.342] -- 0:00:18
696500 -- (-959.463) [-960.745] (-959.664) (-959.301) * (-959.470) [-959.797] (-960.767) (-959.426) -- 0:00:18
697000 -- (-960.628) (-960.958) (-960.343) [-961.762] * (-960.083) [-959.851] (-961.733) (-961.176) -- 0:00:18
697500 -- [-959.885] (-960.866) (-960.173) (-959.963) * [-959.477] (-961.601) (-959.170) (-965.539) -- 0:00:18
698000 -- (-959.332) (-960.439) [-960.953] (-960.382) * (-960.847) [-960.798] (-958.654) (-965.344) -- 0:00:18
698500 -- [-959.451] (-962.645) (-961.426) (-958.988) * [-961.176] (-960.605) (-958.956) (-960.597) -- 0:00:18
699000 -- (-959.986) [-964.231] (-960.113) (-962.428) * (-961.993) (-960.947) (-958.960) [-961.262] -- 0:00:18
699500 -- (-959.416) (-960.578) (-966.598) [-959.475] * (-960.186) [-959.841] (-958.899) (-959.652) -- 0:00:18
700000 -- (-964.232) (-958.726) [-961.144] (-959.377) * [-959.070] (-963.108) (-960.224) (-959.219) -- 0:00:18
Average standard deviation of split frequencies: 0.006728
700500 -- (-963.772) (-959.419) (-960.451) [-959.891] * (-959.041) (-959.754) (-964.522) [-959.998] -- 0:00:18
701000 -- (-960.714) (-958.811) (-961.470) [-959.962] * (-959.281) [-959.635] (-958.819) (-962.200) -- 0:00:18
701500 -- (-959.603) (-958.290) [-961.273] (-960.724) * (-961.390) (-961.313) (-958.839) [-959.338] -- 0:00:18
702000 -- (-959.254) (-958.343) (-958.641) [-961.038] * (-963.221) [-961.171] (-959.908) (-958.986) -- 0:00:18
702500 -- (-961.701) (-963.632) (-963.312) [-959.665] * [-961.307] (-959.949) (-961.403) (-959.887) -- 0:00:18
703000 -- (-959.203) (-960.867) [-961.885] (-962.840) * (-964.681) (-960.884) [-959.069] (-960.805) -- 0:00:18
703500 -- (-960.296) (-960.447) (-961.153) [-962.099] * (-962.094) [-960.782] (-959.661) (-959.104) -- 0:00:18
704000 -- (-960.957) (-961.982) (-965.272) [-962.707] * (-960.844) (-962.911) [-960.661] (-959.728) -- 0:00:18
704500 -- (-961.011) (-959.178) (-962.492) [-961.215] * (-967.775) [-958.853] (-960.425) (-959.211) -- 0:00:18
705000 -- (-959.228) [-962.443] (-964.466) (-960.128) * (-962.681) (-959.102) [-961.157] (-960.942) -- 0:00:18
Average standard deviation of split frequencies: 0.006635
705500 -- [-960.705] (-960.332) (-961.027) (-963.803) * (-959.617) [-960.459] (-958.988) (-959.133) -- 0:00:18
706000 -- (-962.826) (-964.752) [-959.947] (-964.337) * (-966.301) (-960.720) (-959.652) [-961.325] -- 0:00:18
706500 -- (-961.715) (-960.263) [-960.927] (-958.917) * (-961.079) (-960.660) (-960.347) [-961.964] -- 0:00:18
707000 -- (-961.952) [-959.909] (-959.895) (-959.495) * (-960.311) (-968.114) [-960.633] (-959.973) -- 0:00:18
707500 -- (-961.133) [-958.355] (-960.460) (-965.856) * (-960.512) (-963.430) [-963.799] (-959.457) -- 0:00:18
708000 -- (-961.813) (-958.220) [-958.771] (-960.597) * (-959.298) [-961.344] (-959.477) (-963.771) -- 0:00:18
708500 -- (-959.659) (-958.203) [-959.641] (-963.203) * (-959.833) (-958.398) [-958.952] (-960.408) -- 0:00:18
709000 -- (-962.864) (-966.164) (-958.520) [-959.594] * (-962.892) (-960.923) [-959.437] (-959.041) -- 0:00:18
709500 -- (-960.687) [-960.186] (-960.077) (-958.735) * [-959.165] (-965.319) (-960.605) (-961.505) -- 0:00:18
710000 -- [-960.210] (-958.885) (-960.704) (-958.983) * (-959.918) (-963.383) (-959.193) [-962.328] -- 0:00:17
Average standard deviation of split frequencies: 0.006509
710500 -- (-961.643) (-958.647) [-960.680] (-960.485) * (-961.862) (-960.031) [-959.080] (-960.235) -- 0:00:17
711000 -- (-960.920) [-960.178] (-959.458) (-958.692) * (-960.938) (-958.243) (-963.986) [-959.052] -- 0:00:17
711500 -- [-959.226] (-962.617) (-960.572) (-960.962) * [-965.481] (-960.343) (-960.260) (-960.980) -- 0:00:17
712000 -- (-959.100) [-962.182] (-966.999) (-961.100) * (-960.100) (-961.371) (-964.839) [-961.604] -- 0:00:17
712500 -- (-960.223) (-964.570) (-960.199) [-959.448] * (-962.156) [-958.591] (-960.603) (-960.900) -- 0:00:17
713000 -- (-960.663) (-969.541) (-964.768) [-958.771] * (-959.445) (-959.507) [-958.991] (-959.502) -- 0:00:17
713500 -- (-959.738) (-965.306) [-959.324] (-959.050) * (-960.713) (-959.198) [-958.892] (-960.064) -- 0:00:17
714000 -- (-959.000) (-963.188) (-959.782) [-960.364] * [-961.266] (-958.625) (-959.434) (-960.565) -- 0:00:17
714500 -- (-958.906) (-962.459) [-961.990] (-962.433) * (-961.564) [-960.801] (-961.655) (-966.247) -- 0:00:17
715000 -- [-965.842] (-959.772) (-960.019) (-961.255) * (-960.953) (-960.173) [-960.055] (-962.802) -- 0:00:17
Average standard deviation of split frequencies: 0.006954
715500 -- (-966.698) (-962.097) (-960.804) [-959.984] * (-962.922) (-963.818) [-961.809] (-960.562) -- 0:00:17
716000 -- [-963.972] (-958.745) (-961.215) (-960.605) * (-959.071) (-963.326) [-959.905] (-963.553) -- 0:00:17
716500 -- (-963.146) (-960.403) [-961.868] (-959.349) * (-958.385) [-960.011] (-962.458) (-962.140) -- 0:00:17
717000 -- (-962.215) (-962.282) [-962.094] (-960.830) * [-958.561] (-958.915) (-959.958) (-959.165) -- 0:00:17
717500 -- (-963.009) [-961.689] (-961.572) (-963.084) * [-958.521] (-959.975) (-958.254) (-960.333) -- 0:00:17
718000 -- (-962.468) (-965.596) [-959.889] (-960.954) * (-962.897) (-962.368) (-958.724) [-961.507] -- 0:00:17
718500 -- (-962.649) [-959.544] (-960.070) (-958.985) * (-959.725) (-961.397) [-960.489] (-960.209) -- 0:00:17
719000 -- [-960.801] (-959.018) (-959.789) (-959.664) * (-961.234) (-959.332) [-961.749] (-963.638) -- 0:00:17
719500 -- (-958.920) [-960.093] (-960.193) (-959.300) * (-961.605) (-960.132) (-963.055) [-960.598] -- 0:00:17
720000 -- (-961.130) [-962.726] (-962.369) (-963.010) * [-960.220] (-961.333) (-959.867) (-959.559) -- 0:00:17
Average standard deviation of split frequencies: 0.007154
720500 -- (-960.003) (-962.064) (-958.602) [-959.074] * (-963.899) (-959.827) [-968.189] (-959.092) -- 0:00:17
721000 -- (-961.879) [-960.102] (-960.497) (-958.587) * [-964.313] (-964.610) (-959.712) (-960.070) -- 0:00:17
721500 -- (-959.879) [-959.013] (-958.451) (-959.020) * (-960.285) (-959.969) [-960.512] (-959.080) -- 0:00:17
722000 -- (-959.880) [-960.606] (-962.157) (-965.227) * (-960.739) (-962.114) [-960.380] (-960.445) -- 0:00:17
722500 -- [-959.296] (-959.103) (-961.347) (-964.943) * (-959.864) (-962.363) (-959.136) [-959.517] -- 0:00:17
723000 -- [-958.461] (-959.100) (-958.866) (-967.024) * (-960.732) [-961.214] (-958.847) (-960.948) -- 0:00:17
723500 -- (-959.515) (-958.600) [-958.596] (-966.738) * (-961.886) (-958.858) (-960.121) [-966.830] -- 0:00:17
724000 -- (-959.957) (-958.948) (-959.355) [-960.258] * (-960.869) (-959.384) (-962.290) [-959.526] -- 0:00:17
724500 -- [-960.939] (-959.172) (-961.388) (-961.959) * [-960.202] (-961.381) (-959.222) (-960.001) -- 0:00:17
725000 -- (-959.589) (-960.202) (-963.704) [-959.270] * (-962.598) [-960.727] (-959.124) (-960.119) -- 0:00:17
Average standard deviation of split frequencies: 0.006980
725500 -- [-959.128] (-959.912) (-961.694) (-965.225) * [-959.117] (-964.432) (-961.855) (-960.868) -- 0:00:17
726000 -- (-961.438) (-966.124) [-959.743] (-963.862) * (-959.970) [-961.086] (-960.385) (-961.101) -- 0:00:16
726500 -- (-960.428) [-962.076] (-961.702) (-958.773) * [-961.639] (-962.639) (-959.959) (-959.767) -- 0:00:16
727000 -- (-961.878) [-959.462] (-961.054) (-958.479) * (-959.047) (-960.469) [-959.809] (-961.798) -- 0:00:16
727500 -- [-962.378] (-959.842) (-960.086) (-958.501) * (-959.258) [-960.262] (-960.631) (-960.558) -- 0:00:16
728000 -- [-961.702] (-961.188) (-959.521) (-959.115) * [-961.247] (-962.553) (-959.580) (-959.414) -- 0:00:16
728500 -- [-959.052] (-959.129) (-958.627) (-960.443) * [-962.439] (-966.844) (-961.298) (-965.084) -- 0:00:16
729000 -- (-961.665) (-960.198) (-960.803) [-963.613] * [-959.116] (-958.620) (-961.135) (-963.446) -- 0:00:16
729500 -- (-962.173) (-958.804) (-964.305) [-961.531] * [-958.341] (-959.322) (-962.787) (-960.464) -- 0:00:16
730000 -- (-960.421) [-959.815] (-962.008) (-960.144) * (-959.109) (-960.226) [-959.776] (-960.211) -- 0:00:16
Average standard deviation of split frequencies: 0.007419
730500 -- (-961.916) [-960.912] (-959.717) (-966.032) * [-959.994] (-959.000) (-960.202) (-964.923) -- 0:00:16
731000 -- [-960.675] (-962.057) (-961.349) (-964.711) * (-960.822) [-962.738] (-958.663) (-964.076) -- 0:00:16
731500 -- (-961.775) (-960.063) (-964.684) [-963.288] * (-959.409) (-961.423) (-960.060) [-961.197] -- 0:00:16
732000 -- [-960.753] (-958.540) (-958.802) (-960.206) * (-961.309) (-960.912) (-960.975) [-958.319] -- 0:00:16
732500 -- [-959.107] (-958.540) (-959.932) (-958.561) * [-961.383] (-960.107) (-962.111) (-959.418) -- 0:00:16
733000 -- (-959.563) (-959.209) (-962.349) [-959.124] * [-959.536] (-958.250) (-964.092) (-961.634) -- 0:00:16
733500 -- (-961.020) (-961.751) (-960.935) [-958.691] * (-959.091) [-960.034] (-961.894) (-965.066) -- 0:00:16
734000 -- (-960.795) (-960.334) (-960.771) [-959.538] * (-965.208) (-959.449) (-959.559) [-959.627] -- 0:00:16
734500 -- [-959.042] (-960.046) (-963.953) (-961.774) * (-963.283) (-960.558) (-959.313) [-961.266] -- 0:00:16
735000 -- (-959.437) [-958.567] (-963.322) (-961.574) * (-958.935) [-960.085] (-959.427) (-960.095) -- 0:00:16
Average standard deviation of split frequencies: 0.006845
735500 -- (-958.903) (-963.869) (-964.881) [-960.120] * [-959.357] (-960.678) (-960.300) (-961.368) -- 0:00:16
736000 -- (-960.154) (-965.204) (-959.951) [-959.111] * (-962.813) (-962.050) [-959.929] (-961.915) -- 0:00:16
736500 -- (-963.646) (-959.201) [-960.505] (-962.911) * (-959.855) [-961.601] (-963.321) (-960.747) -- 0:00:16
737000 -- (-961.443) (-959.985) (-961.087) [-960.702] * (-958.869) (-960.617) [-961.647] (-958.914) -- 0:00:16
737500 -- [-958.748] (-960.368) (-961.697) (-969.147) * (-959.472) (-959.994) [-961.454] (-960.864) -- 0:00:16
738000 -- (-960.013) (-958.724) (-960.526) [-959.289] * (-966.837) (-959.997) [-960.411] (-967.793) -- 0:00:16
738500 -- (-960.498) (-964.472) (-962.146) [-959.140] * (-964.028) [-959.787] (-960.240) (-966.367) -- 0:00:16
739000 -- [-958.858] (-965.280) (-959.697) (-964.029) * [-964.483] (-961.697) (-961.475) (-963.232) -- 0:00:16
739500 -- [-959.330] (-965.290) (-958.172) (-963.321) * [-958.393] (-963.547) (-959.913) (-959.983) -- 0:00:16
740000 -- (-965.929) (-964.545) (-958.748) [-959.868] * (-959.811) [-959.849] (-962.055) (-961.880) -- 0:00:16
Average standard deviation of split frequencies: 0.007200
740500 -- (-961.805) (-962.686) (-958.644) [-959.569] * [-961.710] (-960.589) (-962.109) (-960.079) -- 0:00:16
741000 -- [-959.499] (-961.509) (-959.408) (-962.566) * (-962.433) [-960.433] (-963.174) (-965.120) -- 0:00:16
741500 -- (-958.781) (-963.428) [-959.685] (-964.418) * (-960.110) (-959.177) (-961.773) [-961.207] -- 0:00:16
742000 -- (-960.134) (-963.170) (-958.942) [-959.353] * [-959.517] (-959.526) (-960.567) (-961.655) -- 0:00:15
742500 -- (-959.411) (-960.774) [-959.307] (-959.139) * (-959.432) (-960.369) [-959.789] (-959.792) -- 0:00:15
743000 -- [-958.351] (-959.594) (-959.642) (-965.491) * (-961.532) [-961.525] (-965.027) (-959.585) -- 0:00:15
743500 -- (-960.231) [-960.458] (-958.851) (-961.373) * (-960.798) (-963.484) (-966.631) [-958.623] -- 0:00:15
744000 -- (-958.625) (-964.068) [-963.565] (-960.364) * [-960.735] (-963.216) (-973.171) (-962.224) -- 0:00:15
744500 -- [-960.300] (-966.161) (-959.289) (-961.147) * (-960.800) (-963.439) [-964.113] (-964.591) -- 0:00:15
745000 -- [-960.286] (-958.934) (-961.001) (-959.226) * (-959.977) (-959.348) (-965.473) [-959.898] -- 0:00:15
Average standard deviation of split frequencies: 0.007543
745500 -- (-958.486) (-964.616) [-959.480] (-959.110) * [-965.047] (-958.762) (-961.277) (-962.188) -- 0:00:15
746000 -- [-958.473] (-960.179) (-960.925) (-961.890) * [-967.281] (-961.301) (-962.494) (-959.444) -- 0:00:15
746500 -- (-958.476) (-959.825) [-959.353] (-960.561) * (-961.448) [-959.727] (-960.430) (-959.280) -- 0:00:15
747000 -- (-959.286) [-958.858] (-958.386) (-961.897) * (-961.988) [-960.197] (-961.211) (-959.569) -- 0:00:15
747500 -- (-959.381) (-959.829) [-959.856] (-962.704) * [-958.947] (-959.489) (-961.105) (-959.500) -- 0:00:15
748000 -- [-963.965] (-961.582) (-960.242) (-962.846) * (-964.806) (-960.269) [-966.170] (-960.066) -- 0:00:15
748500 -- (-959.939) [-963.048] (-959.708) (-963.948) * (-960.089) (-962.248) [-960.222] (-959.909) -- 0:00:15
749000 -- (-958.970) (-961.574) [-959.306] (-960.338) * (-959.022) [-958.814] (-958.628) (-960.288) -- 0:00:15
749500 -- (-961.247) [-959.717] (-960.056) (-960.329) * (-961.576) (-959.998) [-963.719] (-960.381) -- 0:00:15
750000 -- (-960.291) [-959.456] (-961.185) (-967.235) * (-962.127) (-965.756) (-964.229) [-962.455] -- 0:00:15
Average standard deviation of split frequencies: 0.007497
750500 -- (-960.083) (-959.345) (-963.190) [-963.178] * (-960.019) [-961.497] (-959.692) (-962.930) -- 0:00:15
751000 -- (-962.911) [-959.288] (-960.721) (-962.240) * (-961.502) (-969.312) (-959.810) [-960.178] -- 0:00:15
751500 -- [-963.382] (-959.465) (-961.717) (-961.671) * (-961.913) (-961.880) (-960.027) [-959.364] -- 0:00:15
752000 -- (-965.434) (-959.852) (-962.496) [-958.745] * (-962.626) [-958.561] (-964.899) (-961.079) -- 0:00:15
752500 -- (-960.421) (-958.693) [-959.858] (-962.417) * [-962.552] (-958.800) (-958.940) (-959.617) -- 0:00:15
753000 -- (-959.309) (-959.761) (-961.125) [-960.566] * [-959.050] (-960.272) (-960.198) (-958.680) -- 0:00:15
753500 -- (-960.620) (-959.431) [-958.579] (-958.933) * (-958.774) [-958.793] (-960.477) (-960.027) -- 0:00:15
754000 -- (-962.235) (-960.281) (-960.079) [-959.587] * (-965.489) (-958.562) (-962.150) [-959.532] -- 0:00:15
754500 -- (-962.933) (-963.995) [-958.971] (-963.169) * (-959.601) [-958.578] (-960.496) (-959.140) -- 0:00:15
755000 -- (-958.889) (-961.813) [-958.247] (-962.201) * (-960.467) (-959.058) [-960.284] (-960.001) -- 0:00:15
Average standard deviation of split frequencies: 0.007940
755500 -- [-960.797] (-960.683) (-960.950) (-960.625) * [-959.764] (-958.781) (-960.252) (-964.292) -- 0:00:15
756000 -- (-961.665) (-959.771) (-958.623) [-964.124] * (-963.583) (-959.114) [-960.159] (-959.862) -- 0:00:15
756500 -- (-958.562) (-959.641) [-960.140] (-963.321) * (-966.847) [-963.517] (-960.830) (-961.676) -- 0:00:15
757000 -- (-965.136) (-959.505) [-958.948] (-962.226) * [-960.034] (-961.183) (-960.929) (-958.783) -- 0:00:15
757500 -- (-961.008) [-960.926] (-959.036) (-958.872) * [-959.056] (-959.339) (-960.284) (-960.973) -- 0:00:15
758000 -- (-959.332) (-960.310) (-960.584) [-962.515] * [-958.362] (-961.963) (-961.181) (-963.424) -- 0:00:15
758500 -- (-959.113) (-960.191) [-963.073] (-960.168) * (-959.372) [-961.836] (-959.279) (-964.959) -- 0:00:14
759000 -- [-960.849] (-961.293) (-961.066) (-961.948) * (-962.810) (-961.432) (-958.968) [-960.629] -- 0:00:14
759500 -- (-960.336) [-961.494] (-960.519) (-960.501) * (-964.065) (-962.361) [-959.187] (-959.428) -- 0:00:14
760000 -- (-958.696) (-960.070) [-958.891] (-964.441) * (-962.672) [-960.497] (-960.112) (-958.968) -- 0:00:14
Average standard deviation of split frequencies: 0.007809
760500 -- (-961.307) (-961.109) (-959.111) [-959.425] * [-959.824] (-958.941) (-959.377) (-958.464) -- 0:00:14
761000 -- (-959.729) [-958.627] (-960.835) (-964.425) * (-961.968) (-960.349) [-960.016] (-959.431) -- 0:00:14
761500 -- (-962.267) (-960.187) (-959.305) [-964.547] * (-960.524) (-961.832) (-959.282) [-959.755] -- 0:00:14
762000 -- [-959.443] (-960.876) (-958.848) (-959.809) * (-959.248) (-959.228) (-959.240) [-959.506] -- 0:00:14
762500 -- (-960.172) (-961.199) (-961.409) [-959.608] * (-962.587) (-960.661) [-958.970] (-960.017) -- 0:00:14
763000 -- (-961.099) (-961.852) [-961.404] (-959.808) * (-961.106) (-960.947) (-962.016) [-959.741] -- 0:00:14
763500 -- (-961.276) [-960.746] (-961.905) (-960.500) * [-960.706] (-960.068) (-960.211) (-959.637) -- 0:00:14
764000 -- (-960.431) (-960.484) [-963.083] (-960.335) * (-958.758) (-959.889) [-962.802] (-958.593) -- 0:00:14
764500 -- [-959.836] (-961.506) (-959.412) (-964.205) * (-959.288) (-960.079) (-959.934) [-958.693] -- 0:00:14
765000 -- (-959.141) [-959.644] (-959.577) (-962.419) * (-960.794) (-960.618) [-960.378] (-960.368) -- 0:00:14
Average standard deviation of split frequencies: 0.007959
765500 -- (-958.507) (-961.635) [-961.132] (-964.391) * (-958.789) (-960.328) (-958.956) [-961.067] -- 0:00:14
766000 -- (-960.348) (-960.337) (-958.690) [-958.988] * (-959.669) (-959.905) (-958.896) [-961.624] -- 0:00:14
766500 -- [-959.217] (-959.330) (-960.730) (-960.698) * (-961.041) [-959.090] (-958.789) (-961.064) -- 0:00:14
767000 -- (-959.079) (-961.009) (-958.409) [-963.200] * [-960.367] (-959.076) (-958.347) (-960.857) -- 0:00:14
767500 -- [-959.364] (-959.090) (-959.096) (-960.078) * (-959.324) (-964.244) (-958.351) [-958.795] -- 0:00:14
768000 -- (-959.249) [-962.963] (-961.667) (-960.910) * (-959.337) [-958.842] (-964.292) (-960.984) -- 0:00:14
768500 -- (-962.427) [-961.023] (-959.189) (-958.967) * (-959.493) (-960.286) (-961.653) [-959.228] -- 0:00:14
769000 -- (-960.628) (-959.931) [-967.694] (-959.202) * (-961.091) [-962.124] (-960.052) (-960.669) -- 0:00:14
769500 -- (-960.340) [-960.231] (-961.692) (-960.216) * (-959.020) (-958.703) (-961.152) [-960.049] -- 0:00:14
770000 -- (-961.184) (-958.451) (-962.202) [-961.464] * (-960.585) [-960.232] (-965.636) (-960.498) -- 0:00:14
Average standard deviation of split frequencies: 0.007952
770500 -- (-959.592) (-958.451) (-960.180) [-962.837] * (-960.373) (-958.952) (-960.377) [-960.084] -- 0:00:13
771000 -- (-960.220) (-963.399) (-961.732) [-958.901] * (-960.537) (-961.408) [-961.344] (-962.249) -- 0:00:14
771500 -- (-960.354) (-964.427) (-963.277) [-958.569] * (-964.780) [-959.493] (-959.605) (-959.940) -- 0:00:14
772000 -- (-963.214) (-960.559) (-960.641) [-958.368] * (-964.102) (-959.353) (-961.941) [-962.018] -- 0:00:14
772500 -- [-961.608] (-960.551) (-962.157) (-959.060) * (-958.652) [-960.431] (-962.377) (-964.832) -- 0:00:14
773000 -- [-961.875] (-960.722) (-962.106) (-959.565) * [-962.055] (-962.395) (-959.428) (-962.762) -- 0:00:14
773500 -- [-958.199] (-960.374) (-960.543) (-959.433) * (-960.233) (-961.421) (-960.670) [-962.146] -- 0:00:14
774000 -- [-960.709] (-958.553) (-960.555) (-961.329) * (-959.887) (-964.501) (-961.777) [-960.826] -- 0:00:14
774500 -- (-960.431) (-960.073) (-960.067) [-959.235] * [-959.306] (-960.921) (-960.250) (-963.207) -- 0:00:13
775000 -- (-965.697) (-959.365) (-959.998) [-960.173] * (-959.837) (-960.716) [-960.754] (-963.142) -- 0:00:13
Average standard deviation of split frequencies: 0.007614
775500 -- (-960.309) [-960.906] (-963.759) (-960.982) * (-959.915) [-958.903] (-958.249) (-966.927) -- 0:00:13
776000 -- [-960.825] (-958.738) (-959.604) (-959.767) * (-960.589) (-963.888) [-961.241] (-965.512) -- 0:00:13
776500 -- (-959.109) (-959.023) (-960.105) [-959.744] * [-960.057] (-960.518) (-960.129) (-963.720) -- 0:00:13
777000 -- (-959.600) [-960.271] (-959.627) (-962.309) * (-961.826) (-960.097) (-958.650) [-959.529] -- 0:00:13
777500 -- (-959.936) [-960.245] (-959.434) (-968.225) * (-966.610) [-959.847] (-958.904) (-960.490) -- 0:00:13
778000 -- (-958.649) (-959.634) (-960.205) [-961.214] * (-959.770) (-962.372) [-960.346] (-959.717) -- 0:00:13
778500 -- (-959.635) (-961.184) [-960.588] (-959.266) * [-959.401] (-965.288) (-959.399) (-960.547) -- 0:00:13
779000 -- (-961.389) [-962.103] (-963.621) (-959.252) * [-958.703] (-959.486) (-959.293) (-961.644) -- 0:00:13
779500 -- (-959.212) (-961.477) [-960.716] (-961.078) * (-959.301) (-961.895) (-963.244) [-959.666] -- 0:00:13
780000 -- (-958.853) (-959.027) [-960.120] (-960.416) * (-961.347) (-961.673) [-958.473] (-959.422) -- 0:00:13
Average standard deviation of split frequencies: 0.007327
780500 -- (-961.158) [-960.514] (-958.671) (-959.387) * (-960.958) (-961.244) [-958.257] (-960.574) -- 0:00:13
781000 -- (-959.097) [-960.034] (-962.749) (-960.166) * (-959.840) [-960.056] (-960.446) (-962.929) -- 0:00:13
781500 -- (-959.757) [-958.718] (-959.829) (-959.325) * (-959.936) (-958.879) [-959.878] (-960.874) -- 0:00:13
782000 -- (-962.177) (-961.383) [-959.120] (-960.021) * (-958.834) (-959.576) [-962.395] (-959.348) -- 0:00:13
782500 -- (-961.982) (-962.262) [-959.498] (-961.433) * (-962.716) [-960.063] (-959.851) (-960.824) -- 0:00:13
783000 -- (-962.563) [-959.105] (-960.983) (-964.008) * (-962.017) [-959.711] (-961.265) (-960.686) -- 0:00:13
783500 -- [-961.155] (-959.823) (-962.262) (-961.891) * (-961.208) (-960.247) [-959.133] (-959.624) -- 0:00:13
784000 -- (-959.747) (-962.730) (-961.889) [-960.434] * [-962.962] (-964.442) (-961.640) (-959.759) -- 0:00:13
784500 -- [-959.195] (-962.962) (-963.613) (-960.178) * (-959.777) (-962.949) (-965.538) [-960.311] -- 0:00:13
785000 -- [-962.008] (-959.302) (-962.135) (-960.289) * [-959.851] (-960.811) (-959.185) (-960.423) -- 0:00:13
Average standard deviation of split frequencies: 0.007047
785500 -- (-963.045) [-960.495] (-961.250) (-960.190) * [-960.718] (-959.642) (-959.740) (-959.294) -- 0:00:13
786000 -- [-962.111] (-959.233) (-966.909) (-963.475) * [-958.947] (-959.462) (-964.584) (-958.429) -- 0:00:13
786500 -- [-959.483] (-961.457) (-963.648) (-963.514) * (-962.634) (-959.738) [-960.482] (-959.985) -- 0:00:13
787000 -- (-961.562) (-963.980) (-961.176) [-961.684] * (-961.296) [-959.233] (-960.961) (-959.068) -- 0:00:12
787500 -- (-958.863) (-959.102) [-959.355] (-959.204) * (-959.299) (-959.344) [-961.664] (-959.479) -- 0:00:13
788000 -- (-959.188) (-959.115) (-959.406) [-960.964] * (-960.341) [-959.813] (-962.264) (-961.726) -- 0:00:13
788500 -- [-964.480] (-960.224) (-962.004) (-961.322) * (-959.742) (-959.599) (-961.798) [-959.904] -- 0:00:13
789000 -- (-960.978) [-961.119] (-961.883) (-960.319) * (-960.852) [-961.882] (-960.335) (-964.719) -- 0:00:13
789500 -- (-958.833) (-961.919) (-961.540) [-963.106] * (-963.381) [-959.907] (-962.855) (-960.871) -- 0:00:13
790000 -- [-959.261] (-963.760) (-961.405) (-964.402) * [-965.546] (-963.825) (-959.812) (-958.385) -- 0:00:13
Average standard deviation of split frequencies: 0.007234
790500 -- (-963.153) (-959.487) [-958.811] (-962.953) * [-959.337] (-961.918) (-959.097) (-958.682) -- 0:00:12
791000 -- (-958.873) [-961.489] (-960.153) (-963.714) * [-958.330] (-963.437) (-960.220) (-959.350) -- 0:00:12
791500 -- (-958.689) [-962.755] (-959.179) (-960.604) * (-958.359) (-964.101) [-958.287] (-960.004) -- 0:00:12
792000 -- (-958.856) [-962.957] (-960.726) (-959.143) * (-963.002) (-965.811) (-958.870) [-959.143] -- 0:00:12
792500 -- [-958.951] (-959.883) (-960.508) (-965.986) * (-968.467) (-960.320) (-959.892) [-960.244] -- 0:00:12
793000 -- [-960.855] (-959.460) (-958.797) (-961.132) * (-959.983) [-960.610] (-960.932) (-962.197) -- 0:00:12
793500 -- (-965.106) (-959.822) [-959.429] (-961.457) * (-959.261) (-962.435) (-965.760) [-961.547] -- 0:00:12
794000 -- (-961.600) (-960.290) [-961.053] (-961.880) * (-959.569) [-962.460] (-961.715) (-960.809) -- 0:00:12
794500 -- (-961.873) (-961.059) [-959.759] (-962.402) * (-961.704) (-961.231) (-961.690) [-959.342] -- 0:00:12
795000 -- (-961.141) [-960.424] (-959.765) (-960.406) * [-961.484] (-959.690) (-963.615) (-959.188) -- 0:00:12
Average standard deviation of split frequencies: 0.006922
795500 -- (-959.176) [-960.624] (-960.684) (-961.378) * (-964.458) (-958.947) (-961.868) [-958.829] -- 0:00:12
796000 -- (-967.027) [-960.117] (-962.402) (-966.164) * (-959.273) (-958.629) [-960.539] (-962.266) -- 0:00:12
796500 -- (-962.476) (-960.800) (-959.953) [-959.170] * (-961.174) (-959.476) [-960.086] (-964.147) -- 0:00:12
797000 -- (-960.010) (-961.684) [-960.398] (-958.733) * [-959.182] (-961.225) (-962.962) (-963.854) -- 0:00:12
797500 -- (-960.207) (-960.275) [-960.951] (-958.694) * [-959.264] (-959.143) (-963.574) (-964.281) -- 0:00:12
798000 -- (-959.241) (-959.291) [-960.017] (-960.398) * (-961.087) (-959.408) (-958.756) [-961.638] -- 0:00:12
798500 -- [-961.156] (-958.802) (-962.437) (-958.689) * (-960.243) (-960.816) [-959.281] (-958.944) -- 0:00:12
799000 -- [-960.003] (-961.122) (-963.147) (-961.249) * [-962.834] (-963.933) (-959.716) (-959.421) -- 0:00:12
799500 -- (-960.234) (-960.384) (-960.480) [-965.906] * (-961.277) (-961.000) [-959.708] (-959.794) -- 0:00:12
800000 -- (-958.362) [-962.641] (-960.424) (-959.884) * (-959.890) [-960.480] (-959.034) (-961.703) -- 0:00:12
Average standard deviation of split frequencies: 0.007396
800500 -- (-959.820) (-960.385) [-961.374] (-959.300) * [-959.585] (-960.681) (-961.777) (-961.355) -- 0:00:12
801000 -- [-961.000] (-958.788) (-961.211) (-962.635) * (-964.006) (-965.754) [-963.406] (-962.695) -- 0:00:12
801500 -- (-962.187) (-960.603) (-966.084) [-958.795] * (-960.076) (-961.480) (-961.126) [-960.510] -- 0:00:12
802000 -- (-961.035) (-961.071) (-962.143) [-962.188] * (-959.240) [-959.698] (-959.712) (-959.052) -- 0:00:12
802500 -- (-962.240) (-962.576) [-958.956] (-959.250) * (-962.637) [-960.918] (-959.571) (-958.562) -- 0:00:12
803000 -- (-959.735) (-961.970) [-964.743] (-958.380) * (-962.155) [-960.710] (-959.209) (-959.229) -- 0:00:12
803500 -- [-961.014] (-961.742) (-958.615) (-962.376) * (-959.289) (-961.672) [-961.376] (-958.626) -- 0:00:12
804000 -- [-962.621] (-959.482) (-959.589) (-960.932) * [-959.432] (-961.097) (-958.862) (-959.152) -- 0:00:12
804500 -- (-964.370) (-959.740) (-958.378) [-966.449] * [-960.503] (-960.049) (-960.699) (-965.826) -- 0:00:12
805000 -- (-960.648) (-961.350) (-958.852) [-958.671] * (-960.282) (-963.512) (-961.134) [-960.681] -- 0:00:12
Average standard deviation of split frequencies: 0.007640
805500 -- [-960.174] (-960.525) (-961.329) (-961.768) * (-963.901) [-962.513] (-960.755) (-964.915) -- 0:00:12
806000 -- (-960.985) [-962.552] (-958.935) (-962.802) * (-961.172) (-964.250) (-962.489) [-963.407] -- 0:00:12
806500 -- (-958.791) (-959.337) (-961.494) [-964.559] * (-962.051) (-966.697) [-961.308] (-961.024) -- 0:00:11
807000 -- (-958.390) (-960.201) (-959.046) [-961.664] * (-960.219) (-965.694) [-959.455] (-959.884) -- 0:00:11
807500 -- (-960.011) (-961.021) (-963.280) [-963.697] * (-964.055) (-969.361) [-958.717] (-958.479) -- 0:00:11
808000 -- [-964.323] (-965.035) (-964.164) (-958.915) * (-962.163) [-964.477] (-959.926) (-959.429) -- 0:00:11
808500 -- [-961.293] (-963.731) (-960.826) (-958.910) * (-963.283) (-961.895) [-962.036] (-958.373) -- 0:00:11
809000 -- (-963.183) (-962.326) [-960.066] (-960.291) * (-959.870) (-959.203) [-958.581] (-959.999) -- 0:00:11
809500 -- [-960.527] (-962.170) (-960.216) (-958.927) * (-960.034) (-959.930) [-959.646] (-961.063) -- 0:00:11
810000 -- (-960.810) (-962.352) (-958.411) [-960.561] * [-959.397] (-963.421) (-959.291) (-961.327) -- 0:00:11
Average standard deviation of split frequencies: 0.007560
810500 -- (-959.844) [-961.224] (-959.403) (-959.050) * (-959.427) (-960.393) (-961.349) [-960.368] -- 0:00:11
811000 -- (-960.443) [-963.563] (-958.675) (-960.134) * [-961.069] (-965.864) (-959.992) (-959.164) -- 0:00:11
811500 -- (-958.978) (-964.062) [-959.510] (-963.010) * (-964.484) (-965.971) (-959.814) [-958.719] -- 0:00:11
812000 -- (-960.358) (-961.434) [-961.958] (-959.082) * (-961.354) (-960.511) [-962.341] (-958.742) -- 0:00:11
812500 -- (-960.416) (-960.018) (-959.200) [-958.778] * [-959.435] (-961.547) (-961.148) (-958.890) -- 0:00:11
813000 -- (-959.598) (-963.200) [-958.785] (-961.967) * (-962.658) (-959.962) (-959.833) [-961.198] -- 0:00:11
813500 -- (-960.129) [-959.843] (-961.159) (-960.635) * [-959.754] (-961.044) (-961.772) (-963.581) -- 0:00:11
814000 -- [-959.977] (-963.234) (-959.701) (-966.111) * (-962.709) (-962.265) (-962.251) [-962.821] -- 0:00:11
814500 -- [-961.164] (-963.973) (-959.361) (-959.795) * (-962.820) (-961.022) (-961.430) [-958.558] -- 0:00:11
815000 -- (-964.261) [-960.410] (-961.306) (-959.708) * (-960.911) [-960.244] (-960.730) (-958.897) -- 0:00:11
Average standard deviation of split frequencies: 0.007871
815500 -- (-963.331) [-963.634] (-963.194) (-960.604) * (-963.322) (-963.458) [-960.140] (-960.646) -- 0:00:11
816000 -- (-963.318) [-963.736] (-961.584) (-960.289) * (-965.078) (-962.770) (-959.642) [-960.478] -- 0:00:11
816500 -- (-962.220) [-962.265] (-960.974) (-967.079) * [-960.850] (-959.882) (-962.536) (-961.741) -- 0:00:11
817000 -- [-962.651] (-961.663) (-960.103) (-961.197) * (-959.297) [-959.849] (-960.259) (-961.683) -- 0:00:11
817500 -- (-959.924) (-962.577) (-958.626) [-960.466] * (-959.172) [-959.856] (-959.346) (-959.716) -- 0:00:11
818000 -- [-961.947] (-959.732) (-959.248) (-959.760) * [-961.376] (-961.415) (-960.129) (-959.276) -- 0:00:11
818500 -- (-958.370) (-962.058) (-962.236) [-959.221] * (-961.843) (-961.966) (-959.297) [-959.933] -- 0:00:11
819000 -- (-958.256) (-966.243) (-960.962) [-961.521] * (-960.016) (-961.957) [-962.404] (-959.069) -- 0:00:11
819500 -- (-959.792) [-961.530] (-961.907) (-960.245) * [-959.174] (-960.345) (-959.750) (-964.367) -- 0:00:11
820000 -- (-960.033) (-962.938) (-958.711) [-960.693] * [-960.486] (-960.375) (-963.818) (-958.630) -- 0:00:11
Average standard deviation of split frequencies: 0.008185
820500 -- [-960.326] (-959.594) (-958.972) (-960.900) * (-963.778) [-963.047] (-960.961) (-959.329) -- 0:00:11
821000 -- [-958.524] (-961.846) (-960.424) (-962.264) * (-962.288) [-958.986] (-961.132) (-958.698) -- 0:00:11
821500 -- (-959.694) [-958.668] (-962.276) (-966.586) * [-959.610] (-958.410) (-959.387) (-958.704) -- 0:00:11
822000 -- (-959.635) [-960.258] (-959.987) (-959.600) * (-962.105) (-961.135) [-959.407] (-959.417) -- 0:00:11
822500 -- (-962.750) (-959.134) (-960.187) [-960.352] * (-959.671) (-962.104) [-961.474] (-965.588) -- 0:00:11
823000 -- (-962.513) (-959.972) (-960.327) [-963.773] * [-960.188] (-963.863) (-963.433) (-962.242) -- 0:00:10
823500 -- (-960.134) (-963.464) [-959.497] (-959.746) * (-962.303) (-963.002) [-959.655] (-962.455) -- 0:00:10
824000 -- (-959.312) (-962.438) [-959.420] (-963.788) * (-960.281) (-960.069) (-959.742) [-960.315] -- 0:00:10
824500 -- (-961.564) (-962.504) [-959.526] (-961.229) * (-963.751) (-960.329) [-959.272] (-959.405) -- 0:00:10
825000 -- (-961.773) (-958.246) [-963.411] (-960.701) * (-960.219) (-960.134) (-959.663) [-960.319] -- 0:00:10
Average standard deviation of split frequencies: 0.008525
825500 -- (-960.220) (-960.020) (-962.926) [-960.985] * (-959.764) [-961.011] (-960.414) (-960.195) -- 0:00:10
826000 -- (-960.547) (-958.963) [-960.425] (-959.754) * [-961.637] (-960.451) (-959.857) (-959.436) -- 0:00:10
826500 -- (-960.375) (-961.405) (-960.139) [-961.096] * (-963.239) [-962.242] (-963.331) (-963.205) -- 0:00:10
827000 -- (-961.797) [-960.099] (-959.751) (-963.883) * (-959.606) [-962.451] (-960.744) (-961.151) -- 0:00:10
827500 -- [-961.992] (-961.209) (-960.048) (-958.779) * (-960.137) [-962.052] (-959.559) (-962.040) -- 0:00:10
828000 -- (-960.559) (-961.314) [-960.813] (-959.076) * [-960.896] (-961.379) (-961.414) (-959.661) -- 0:00:10
828500 -- (-961.681) [-961.836] (-963.793) (-959.098) * (-961.187) [-959.506] (-960.053) (-960.754) -- 0:00:10
829000 -- (-962.523) (-961.848) (-958.690) [-960.760] * (-959.795) (-961.078) (-961.665) [-960.823] -- 0:00:10
829500 -- (-958.597) (-960.742) (-963.955) [-960.669] * [-960.881] (-961.517) (-959.244) (-963.253) -- 0:00:10
830000 -- [-962.108] (-960.875) (-960.013) (-963.104) * (-961.251) (-960.268) (-961.415) [-961.538] -- 0:00:10
Average standard deviation of split frequencies: 0.008406
830500 -- (-961.100) [-961.126] (-959.175) (-964.834) * (-961.299) (-963.142) (-961.361) [-964.223] -- 0:00:10
831000 -- [-959.183] (-959.919) (-960.115) (-961.410) * (-959.219) [-960.396] (-963.296) (-962.257) -- 0:00:10
831500 -- [-963.552] (-958.386) (-963.847) (-958.445) * (-962.361) (-963.680) [-958.577] (-961.602) -- 0:00:10
832000 -- (-962.083) [-958.641] (-962.303) (-959.745) * (-961.154) (-960.965) [-962.123] (-962.354) -- 0:00:10
832500 -- (-959.409) (-961.792) [-960.244] (-960.800) * (-961.467) (-960.008) (-960.971) [-958.875] -- 0:00:10
833000 -- (-961.771) (-961.322) [-959.000] (-960.310) * (-959.125) (-961.580) [-963.952] (-958.975) -- 0:00:10
833500 -- (-959.942) (-961.161) (-966.149) [-962.952] * (-960.211) (-961.701) [-962.862] (-962.205) -- 0:00:10
834000 -- (-958.792) [-959.840] (-961.000) (-959.931) * (-960.326) (-959.491) (-965.195) [-962.856] -- 0:00:10
834500 -- (-959.789) (-962.909) (-961.843) [-960.428] * (-961.978) (-959.393) (-960.383) [-961.857] -- 0:00:10
835000 -- (-959.409) (-960.693) [-964.363] (-960.324) * (-959.825) (-961.316) (-960.976) [-959.069] -- 0:00:10
Average standard deviation of split frequencies: 0.008106
835500 -- (-959.302) [-961.354] (-960.909) (-960.350) * (-960.699) [-959.788] (-960.450) (-960.452) -- 0:00:10
836000 -- (-958.914) (-961.661) (-959.882) [-959.734] * (-960.338) (-961.574) [-960.050] (-962.130) -- 0:00:10
836500 -- (-959.553) (-964.170) (-962.428) [-959.616] * (-962.065) [-961.811] (-960.157) (-960.577) -- 0:00:10
837000 -- (-959.205) (-965.067) (-960.416) [-958.420] * (-963.297) (-961.140) [-959.827] (-962.080) -- 0:00:10
837500 -- (-959.913) [-962.215] (-964.557) (-958.477) * [-959.675] (-958.063) (-958.475) (-959.283) -- 0:00:10
838000 -- (-961.283) (-959.080) (-962.667) [-958.781] * [-959.323] (-959.485) (-959.246) (-962.675) -- 0:00:10
838500 -- [-963.501] (-959.929) (-959.846) (-961.471) * (-962.151) (-960.201) (-960.333) [-959.194] -- 0:00:10
839000 -- (-961.483) (-963.041) [-959.209] (-959.529) * (-960.608) [-958.462] (-961.079) (-963.197) -- 0:00:09
839500 -- (-959.577) (-958.962) [-960.886] (-959.211) * [-958.728] (-958.862) (-959.107) (-959.040) -- 0:00:09
840000 -- (-962.140) (-959.691) [-958.919] (-966.898) * (-959.631) (-960.483) [-959.235] (-958.560) -- 0:00:09
Average standard deviation of split frequencies: 0.007815
840500 -- [-961.275] (-958.831) (-958.864) (-961.337) * (-960.236) (-960.139) [-962.038] (-958.773) -- 0:00:09
841000 -- (-962.540) (-959.251) [-958.631] (-960.564) * [-960.180] (-961.266) (-965.709) (-959.467) -- 0:00:09
841500 -- [-966.149] (-958.944) (-961.625) (-958.861) * (-962.812) (-961.520) (-963.182) [-960.257] -- 0:00:09
842000 -- (-960.374) (-958.466) (-960.483) [-960.623] * (-961.859) (-959.389) [-959.423] (-963.881) -- 0:00:09
842500 -- (-960.369) (-958.974) (-959.419) [-960.062] * (-958.623) [-959.385] (-963.100) (-960.580) -- 0:00:09
843000 -- (-960.562) [-963.285] (-960.948) (-959.850) * [-959.211] (-959.863) (-961.249) (-962.260) -- 0:00:09
843500 -- (-960.552) (-959.682) [-963.258] (-962.533) * (-967.141) (-964.128) [-960.123] (-961.377) -- 0:00:09
844000 -- (-958.740) [-961.285] (-964.916) (-959.248) * (-963.133) (-961.389) [-959.774] (-960.037) -- 0:00:09
844500 -- [-959.711] (-961.867) (-962.260) (-959.566) * (-961.189) [-960.467] (-958.890) (-960.195) -- 0:00:09
845000 -- (-963.202) (-959.591) (-959.606) [-965.959] * (-962.991) [-959.779] (-959.677) (-959.261) -- 0:00:09
Average standard deviation of split frequencies: 0.008194
845500 -- (-959.015) (-958.937) [-959.218] (-962.715) * (-962.493) [-960.598] (-961.035) (-960.392) -- 0:00:09
846000 -- (-961.691) (-959.791) [-961.266] (-960.351) * (-962.209) [-960.503] (-959.102) (-963.686) -- 0:00:09
846500 -- [-958.522] (-958.988) (-962.023) (-960.030) * [-959.806] (-960.542) (-961.981) (-961.253) -- 0:00:09
847000 -- (-958.508) (-959.290) (-960.797) [-961.072] * (-960.476) (-964.021) [-960.629] (-961.056) -- 0:00:09
847500 -- (-959.028) [-961.229] (-960.165) (-960.776) * (-958.376) [-963.529] (-959.302) (-961.207) -- 0:00:09
848000 -- [-960.377] (-959.025) (-962.718) (-962.235) * (-959.942) (-965.494) (-959.303) [-959.166] -- 0:00:09
848500 -- [-959.451] (-959.493) (-959.759) (-962.440) * (-963.251) [-958.684] (-959.318) (-959.248) -- 0:00:09
849000 -- (-959.250) [-959.751] (-960.844) (-960.653) * (-962.866) (-959.626) [-960.058] (-959.847) -- 0:00:09
849500 -- (-960.964) (-960.403) (-962.019) [-960.385] * (-959.895) (-964.103) [-960.513] (-959.463) -- 0:00:09
850000 -- [-961.269] (-965.118) (-961.135) (-960.118) * (-964.730) (-961.524) [-959.695] (-958.911) -- 0:00:09
Average standard deviation of split frequencies: 0.007921
850500 -- (-958.789) [-962.116] (-961.582) (-962.554) * [-959.186] (-961.092) (-961.581) (-961.137) -- 0:00:09
851000 -- (-960.879) (-958.126) (-960.424) [-959.867] * [-959.650] (-961.942) (-962.800) (-968.457) -- 0:00:09
851500 -- [-959.455] (-960.997) (-960.913) (-961.060) * (-963.618) (-960.784) [-961.917] (-964.315) -- 0:00:09
852000 -- [-959.530] (-959.676) (-960.402) (-960.350) * (-961.000) (-961.067) [-959.808] (-960.969) -- 0:00:09
852500 -- (-960.405) (-959.855) (-963.862) [-959.021] * (-958.795) (-959.510) [-960.999] (-961.284) -- 0:00:09
853000 -- (-965.099) (-958.810) [-960.324] (-958.516) * (-960.787) (-960.810) [-965.870] (-962.575) -- 0:00:09
853500 -- (-961.354) (-958.597) [-959.033] (-960.352) * (-961.095) (-963.848) [-959.223] (-959.315) -- 0:00:09
854000 -- [-963.338] (-959.668) (-961.713) (-962.153) * (-959.897) (-961.953) (-959.223) [-960.995] -- 0:00:09
854500 -- (-962.860) (-962.393) [-958.591] (-963.542) * [-959.874] (-958.810) (-963.665) (-961.234) -- 0:00:09
855000 -- (-960.038) (-959.923) [-959.250] (-959.214) * (-960.074) [-959.430] (-960.864) (-962.375) -- 0:00:08
Average standard deviation of split frequencies: 0.008001
855500 -- (-959.418) [-960.289] (-959.309) (-959.466) * (-961.021) (-960.867) (-960.118) [-960.317] -- 0:00:08
856000 -- [-961.393] (-960.251) (-960.817) (-959.769) * (-962.231) [-958.566] (-961.190) (-960.572) -- 0:00:08
856500 -- (-959.872) (-959.916) [-960.314] (-959.367) * (-960.893) (-958.708) (-962.032) [-962.381] -- 0:00:08
857000 -- [-959.316] (-960.106) (-963.818) (-960.906) * (-960.592) (-958.746) (-959.470) [-961.079] -- 0:00:08
857500 -- (-960.019) (-963.336) (-960.557) [-961.706] * (-960.041) [-958.877] (-958.909) (-959.891) -- 0:00:08
858000 -- (-960.867) [-964.937] (-960.193) (-963.532) * (-961.404) [-959.618] (-961.174) (-960.906) -- 0:00:08
858500 -- (-963.038) (-961.545) (-958.221) [-964.843] * (-960.500) [-961.258] (-961.688) (-959.622) -- 0:00:08
859000 -- (-959.118) (-958.651) (-960.818) [-963.393] * [-960.719] (-961.421) (-960.841) (-966.104) -- 0:00:08
859500 -- [-962.887] (-961.377) (-961.275) (-959.492) * [-959.052] (-959.057) (-961.097) (-963.519) -- 0:00:08
860000 -- (-961.155) (-962.510) [-959.069] (-958.963) * [-963.723] (-959.718) (-962.325) (-967.694) -- 0:00:08
Average standard deviation of split frequencies: 0.008216
860500 -- [-958.722] (-961.372) (-959.927) (-958.586) * [-961.500] (-961.673) (-962.537) (-969.783) -- 0:00:08
861000 -- (-959.488) [-959.063] (-960.223) (-960.204) * (-959.959) (-960.812) (-963.331) [-961.014] -- 0:00:08
861500 -- (-959.847) (-959.599) [-960.971] (-959.443) * (-958.706) [-960.909] (-963.511) (-959.283) -- 0:00:08
862000 -- [-959.357] (-962.186) (-962.159) (-964.930) * [-958.306] (-963.867) (-960.754) (-962.189) -- 0:00:08
862500 -- (-959.237) (-959.211) [-963.024] (-960.675) * (-960.460) (-963.256) (-960.599) [-960.138] -- 0:00:08
863000 -- (-962.594) [-960.145] (-962.896) (-961.998) * (-965.337) (-961.189) [-959.333] (-962.625) -- 0:00:08
863500 -- (-962.245) (-960.685) [-959.361] (-958.967) * [-961.143] (-959.448) (-958.456) (-963.293) -- 0:00:08
864000 -- (-961.447) [-959.117] (-960.530) (-959.912) * (-961.286) (-959.213) [-959.554] (-960.685) -- 0:00:08
864500 -- [-960.327] (-959.436) (-959.126) (-961.052) * (-959.184) (-959.559) [-960.958] (-958.459) -- 0:00:08
865000 -- (-959.179) [-962.344] (-964.860) (-959.525) * (-958.678) (-961.085) [-961.154] (-964.781) -- 0:00:08
Average standard deviation of split frequencies: 0.008261
865500 -- (-959.364) (-964.305) (-961.999) [-959.485] * (-959.465) (-959.033) (-960.775) [-958.547] -- 0:00:08
866000 -- (-958.586) (-960.041) [-962.280] (-958.602) * (-961.608) (-961.321) (-960.306) [-960.447] -- 0:00:08
866500 -- [-960.660] (-962.751) (-961.176) (-958.036) * (-960.602) [-962.399] (-959.270) (-961.045) -- 0:00:08
867000 -- [-960.309] (-961.557) (-959.702) (-961.394) * (-962.369) (-959.647) (-960.278) [-959.408] -- 0:00:08
867500 -- (-962.297) [-960.700] (-964.331) (-960.967) * (-963.141) (-960.244) (-961.234) [-961.083] -- 0:00:08
868000 -- (-960.606) [-961.611] (-961.826) (-959.963) * (-964.397) (-960.423) [-960.038] (-961.194) -- 0:00:08
868500 -- [-961.004] (-959.212) (-960.281) (-960.209) * (-960.533) (-960.511) [-959.500] (-960.292) -- 0:00:08
869000 -- (-960.355) [-959.826] (-960.459) (-961.043) * (-965.416) (-958.802) [-959.256] (-959.714) -- 0:00:08
869500 -- [-962.958] (-962.214) (-960.691) (-962.584) * (-961.919) (-958.962) [-963.462] (-961.567) -- 0:00:08
870000 -- (-963.727) (-960.368) [-960.615] (-958.812) * (-963.679) (-959.715) (-958.969) [-961.810] -- 0:00:08
Average standard deviation of split frequencies: 0.008281
870500 -- (-960.741) [-962.514] (-961.468) (-959.483) * (-960.566) [-960.045] (-959.390) (-964.285) -- 0:00:08
871000 -- (-962.538) (-962.359) [-963.174] (-964.578) * (-958.493) [-959.947] (-960.586) (-960.401) -- 0:00:07
871500 -- [-959.477] (-962.578) (-961.858) (-959.385) * (-965.113) [-961.754] (-961.131) (-961.945) -- 0:00:07
872000 -- (-961.131) (-961.193) (-961.619) [-958.590] * (-958.987) [-961.657] (-958.793) (-959.086) -- 0:00:07
872500 -- (-960.219) [-959.089] (-958.991) (-959.301) * (-961.705) (-960.418) (-960.264) [-959.920] -- 0:00:07
873000 -- (-960.422) [-960.436] (-959.062) (-961.954) * (-961.240) [-962.629] (-960.396) (-959.596) -- 0:00:07
873500 -- (-961.469) (-959.047) (-960.776) [-959.209] * (-959.751) (-962.713) (-961.659) [-960.240] -- 0:00:07
874000 -- (-961.844) [-960.120] (-962.129) (-959.003) * (-959.753) (-966.025) [-961.614] (-964.935) -- 0:00:07
874500 -- (-960.153) (-959.313) [-960.044] (-962.163) * [-961.493] (-966.041) (-958.320) (-960.479) -- 0:00:07
875000 -- (-964.315) [-959.277] (-959.366) (-960.882) * (-963.388) (-964.065) [-961.665] (-960.382) -- 0:00:07
Average standard deviation of split frequencies: 0.008199
875500 -- (-962.888) [-961.745] (-961.442) (-961.219) * (-964.851) (-964.222) (-959.246) [-960.337] -- 0:00:07
876000 -- (-961.619) (-963.748) [-960.941] (-959.076) * [-960.993] (-959.976) (-959.669) (-958.484) -- 0:00:07
876500 -- (-963.185) (-962.414) [-959.958] (-961.756) * (-959.592) (-962.317) [-959.006] (-958.413) -- 0:00:07
877000 -- (-963.212) (-959.360) [-961.003] (-959.872) * [-959.512] (-960.304) (-960.500) (-959.881) -- 0:00:07
877500 -- (-959.059) [-963.345] (-962.711) (-960.936) * (-961.057) [-958.594] (-958.413) (-960.713) -- 0:00:07
878000 -- (-959.685) [-961.163] (-963.986) (-960.023) * (-965.380) (-958.528) (-962.998) [-958.268] -- 0:00:07
878500 -- (-958.921) [-962.993] (-966.595) (-964.018) * (-960.953) [-959.086] (-962.198) (-958.599) -- 0:00:07
879000 -- [-960.073] (-964.616) (-963.228) (-961.191) * (-958.669) (-959.221) (-959.266) [-961.069] -- 0:00:07
879500 -- (-961.937) [-959.650] (-963.466) (-964.490) * [-958.299] (-965.266) (-959.745) (-963.600) -- 0:00:07
880000 -- (-961.609) (-959.908) [-960.198] (-963.255) * [-958.715] (-959.187) (-960.017) (-961.412) -- 0:00:07
Average standard deviation of split frequencies: 0.008596
880500 -- (-959.818) [-959.118] (-961.140) (-961.942) * [-960.101] (-962.800) (-964.492) (-960.676) -- 0:00:07
881000 -- (-958.868) (-958.368) [-960.386] (-963.657) * (-966.676) (-960.299) (-961.114) [-959.327] -- 0:00:07
881500 -- [-962.909] (-958.522) (-962.562) (-959.678) * (-971.880) (-959.580) [-959.645] (-960.860) -- 0:00:07
882000 -- [-961.033] (-962.317) (-958.955) (-963.510) * (-966.214) (-958.588) [-959.832] (-958.747) -- 0:00:07
882500 -- (-960.065) (-961.457) (-966.149) [-961.723] * [-958.900] (-963.296) (-958.967) (-962.280) -- 0:00:07
883000 -- (-959.885) (-965.014) (-960.607) [-964.200] * (-960.926) (-962.648) (-959.692) [-960.628] -- 0:00:07
883500 -- (-972.121) [-962.890] (-959.366) (-961.172) * (-961.832) (-964.672) [-959.313] (-959.927) -- 0:00:07
884000 -- (-959.963) [-961.825] (-959.550) (-959.470) * (-963.273) [-960.136] (-961.359) (-959.629) -- 0:00:07
884500 -- (-959.849) [-958.582] (-960.825) (-961.606) * (-960.135) (-965.465) (-968.727) [-961.866] -- 0:00:07
885000 -- (-959.120) [-959.805] (-958.441) (-962.905) * (-961.117) (-959.113) (-963.305) [-959.187] -- 0:00:07
Average standard deviation of split frequencies: 0.008795
885500 -- (-964.354) (-959.153) [-959.693] (-959.524) * (-963.693) (-958.651) [-960.142] (-961.959) -- 0:00:07
886000 -- (-963.455) (-961.481) (-958.742) [-959.968] * (-959.118) (-958.468) [-962.488] (-960.045) -- 0:00:07
886500 -- (-962.156) (-960.951) (-958.929) [-963.601] * [-961.820] (-964.805) (-959.042) (-964.925) -- 0:00:07
887000 -- (-962.348) (-961.761) (-959.740) [-960.411] * (-963.685) (-962.017) (-959.262) [-960.953] -- 0:00:07
887500 -- (-962.880) (-961.126) (-963.395) [-959.279] * (-963.998) [-961.961] (-959.621) (-961.524) -- 0:00:06
888000 -- (-960.250) (-959.960) (-965.270) [-964.104] * [-961.324] (-963.165) (-959.301) (-963.740) -- 0:00:06
888500 -- (-959.377) (-962.472) (-964.247) [-960.466] * [-961.172] (-963.739) (-961.749) (-960.048) -- 0:00:06
889000 -- [-959.409] (-962.932) (-964.335) (-960.210) * (-965.709) (-963.371) (-965.200) [-959.806] -- 0:00:06
889500 -- [-959.409] (-960.280) (-962.090) (-964.124) * [-960.754] (-962.813) (-961.517) (-964.400) -- 0:00:06
890000 -- [-963.888] (-959.306) (-959.963) (-961.794) * (-960.313) (-962.817) [-958.235] (-965.053) -- 0:00:06
Average standard deviation of split frequencies: 0.008811
890500 -- (-960.923) (-959.091) (-960.314) [-961.198] * (-959.284) (-959.702) (-959.467) [-960.642] -- 0:00:06
891000 -- (-961.389) (-966.454) [-958.870] (-958.589) * [-962.066] (-963.921) (-959.835) (-960.826) -- 0:00:06
891500 -- (-958.591) [-965.838] (-960.680) (-958.698) * (-958.647) [-959.612] (-962.545) (-960.672) -- 0:00:06
892000 -- (-961.095) (-960.879) (-962.498) [-959.775] * (-964.783) (-960.629) [-960.842] (-961.806) -- 0:00:06
892500 -- (-959.278) [-959.628] (-958.645) (-960.554) * (-963.798) (-958.562) [-964.369] (-962.913) -- 0:00:06
893000 -- (-963.909) [-960.712] (-960.390) (-960.193) * (-960.914) (-960.658) (-960.938) [-966.082] -- 0:00:06
893500 -- (-961.224) (-961.199) (-961.252) [-961.695] * (-962.276) (-959.823) (-960.795) [-961.054] -- 0:00:06
894000 -- [-960.115] (-960.213) (-961.459) (-963.696) * (-959.172) [-960.283] (-960.929) (-961.898) -- 0:00:06
894500 -- (-961.530) [-959.911] (-960.466) (-959.508) * (-959.904) (-958.356) (-959.064) [-961.616] -- 0:00:06
895000 -- (-959.104) [-961.585] (-961.198) (-963.112) * (-960.338) [-959.137] (-959.437) (-962.683) -- 0:00:06
Average standard deviation of split frequencies: 0.008352
895500 -- (-959.314) [-960.771] (-961.596) (-961.995) * (-962.520) [-958.477] (-960.552) (-960.611) -- 0:00:06
896000 -- [-959.274] (-962.920) (-960.490) (-959.269) * (-962.230) (-958.725) (-959.052) [-959.814] -- 0:00:06
896500 -- (-960.146) (-960.843) (-961.285) [-962.205] * (-959.887) (-961.434) (-960.753) [-962.436] -- 0:00:06
897000 -- [-960.125] (-958.538) (-960.576) (-961.660) * (-960.404) (-958.503) (-958.569) [-962.340] -- 0:00:06
897500 -- (-962.392) [-958.905] (-959.269) (-960.938) * (-962.560) (-961.956) [-959.258] (-963.032) -- 0:00:06
898000 -- (-958.775) [-958.958] (-959.711) (-960.949) * (-963.544) (-961.214) (-960.481) [-961.130] -- 0:00:06
898500 -- (-960.005) (-963.282) [-962.149] (-960.629) * (-961.863) (-960.151) (-961.770) [-963.950] -- 0:00:06
899000 -- [-960.005] (-959.324) (-960.175) (-959.714) * (-961.458) (-960.159) (-959.461) [-959.491] -- 0:00:06
899500 -- (-959.458) (-961.381) (-959.125) [-958.914] * (-960.373) (-962.104) (-962.808) [-960.816] -- 0:00:06
900000 -- [-958.990] (-960.432) (-959.159) (-959.494) * (-960.324) [-960.361] (-960.077) (-959.311) -- 0:00:06
Average standard deviation of split frequencies: 0.009082
900500 -- [-960.158] (-958.337) (-960.684) (-964.158) * [-958.512] (-963.129) (-960.547) (-958.721) -- 0:00:06
901000 -- (-959.888) (-958.394) [-962.948] (-963.721) * (-959.292) (-960.799) (-960.843) [-960.962] -- 0:00:06
901500 -- (-961.422) [-961.745] (-964.198) (-962.048) * (-960.269) (-961.595) [-958.357] (-961.519) -- 0:00:06
902000 -- (-960.630) (-959.938) (-960.362) [-960.146] * (-962.547) (-960.797) (-958.517) [-961.993] -- 0:00:06
902500 -- [-964.325] (-959.102) (-960.429) (-959.862) * [-962.097] (-960.321) (-961.070) (-960.249) -- 0:00:06
903000 -- [-962.779] (-958.653) (-959.928) (-959.445) * [-960.115] (-961.781) (-965.680) (-958.931) -- 0:00:06
903500 -- [-959.796] (-959.093) (-962.566) (-963.613) * (-961.734) [-967.289] (-958.738) (-960.064) -- 0:00:05
904000 -- [-959.252] (-961.232) (-962.198) (-963.067) * (-958.480) (-960.020) [-959.164] (-960.396) -- 0:00:05
904500 -- (-958.543) (-959.223) (-962.862) [-963.113] * (-958.633) (-962.042) [-958.668] (-964.073) -- 0:00:05
905000 -- (-960.695) [-959.101] (-960.107) (-960.339) * (-961.890) (-964.086) (-958.963) [-961.430] -- 0:00:05
Average standard deviation of split frequencies: 0.009121
905500 -- (-962.007) (-958.292) (-959.191) [-959.205] * (-966.704) [-960.044] (-958.454) (-960.250) -- 0:00:05
906000 -- (-962.440) [-961.806] (-966.432) (-964.841) * [-959.921] (-959.371) (-958.686) (-959.761) -- 0:00:05
906500 -- [-962.263] (-959.097) (-965.009) (-960.917) * (-958.869) (-959.282) [-963.024] (-962.482) -- 0:00:05
907000 -- (-959.472) [-960.142] (-959.092) (-959.586) * [-959.055] (-966.622) (-961.479) (-960.011) -- 0:00:05
907500 -- (-961.581) (-959.869) [-958.933] (-959.495) * (-960.380) (-963.211) [-958.725] (-959.699) -- 0:00:05
908000 -- (-960.263) [-961.246] (-958.884) (-958.774) * (-965.182) (-962.116) [-958.393] (-958.949) -- 0:00:05
908500 -- [-961.151] (-961.220) (-962.579) (-958.956) * (-962.566) (-961.680) (-958.647) [-958.588] -- 0:00:05
909000 -- (-962.038) (-963.763) [-960.713] (-959.927) * (-958.778) (-959.265) (-959.277) [-962.466] -- 0:00:05
909500 -- [-962.009] (-958.965) (-959.740) (-961.939) * [-961.030] (-961.635) (-958.627) (-963.135) -- 0:00:05
910000 -- (-958.538) (-960.134) [-962.648] (-962.498) * [-959.300] (-963.651) (-959.544) (-964.235) -- 0:00:05
Average standard deviation of split frequencies: 0.009868
910500 -- (-958.793) (-960.259) (-960.296) [-959.535] * (-959.843) (-959.950) (-960.837) [-961.268] -- 0:00:05
911000 -- [-960.090] (-961.729) (-963.646) (-959.859) * (-959.039) (-959.953) [-960.919] (-960.437) -- 0:00:05
911500 -- [-958.340] (-959.258) (-965.628) (-963.073) * (-961.772) (-960.511) [-960.589] (-961.605) -- 0:00:05
912000 -- (-959.478) [-959.539] (-963.915) (-963.549) * [-959.183] (-959.870) (-958.661) (-961.799) -- 0:00:05
912500 -- (-960.159) (-961.768) (-959.453) [-958.857] * (-960.372) (-959.298) [-959.367] (-960.274) -- 0:00:05
913000 -- [-960.052] (-962.882) (-963.131) (-958.974) * (-960.365) (-962.454) (-959.006) [-959.638] -- 0:00:05
913500 -- (-966.014) (-960.795) [-960.805] (-959.151) * (-961.837) (-962.222) (-959.113) [-959.734] -- 0:00:05
914000 -- [-967.780] (-961.423) (-961.350) (-959.615) * (-961.119) [-961.938] (-958.908) (-964.578) -- 0:00:05
914500 -- (-966.297) [-960.630] (-960.052) (-963.564) * (-962.077) [-961.854] (-959.372) (-961.577) -- 0:00:05
915000 -- (-965.733) (-959.445) [-959.585] (-962.434) * (-958.743) [-964.180] (-961.397) (-961.073) -- 0:00:05
Average standard deviation of split frequencies: 0.009354
915500 -- (-960.250) (-961.389) (-959.590) [-962.881] * (-961.360) [-962.087] (-963.743) (-961.250) -- 0:00:05
916000 -- [-960.249] (-962.213) (-958.770) (-961.812) * (-963.103) (-962.003) [-959.563] (-960.710) -- 0:00:05
916500 -- (-960.067) [-964.732] (-959.770) (-962.705) * (-959.215) [-959.809] (-959.527) (-960.765) -- 0:00:05
917000 -- (-961.985) [-958.936] (-960.619) (-966.462) * (-959.309) (-958.826) [-963.114] (-963.112) -- 0:00:05
917500 -- (-959.667) (-959.255) [-961.027] (-963.966) * (-960.347) (-961.949) (-960.663) [-961.693] -- 0:00:05
918000 -- (-958.857) (-960.170) (-960.752) [-962.326] * (-960.458) [-960.581] (-960.937) (-962.836) -- 0:00:05
918500 -- (-960.861) (-963.540) (-962.261) [-958.753] * [-960.417] (-959.741) (-971.562) (-962.404) -- 0:00:05
919000 -- (-958.791) [-958.809] (-960.293) (-959.054) * (-958.851) (-965.515) [-959.455] (-962.414) -- 0:00:05
919500 -- (-958.800) (-961.666) [-959.041] (-960.758) * [-959.425] (-963.495) (-959.314) (-962.453) -- 0:00:04
920000 -- [-961.384] (-962.726) (-961.161) (-962.864) * (-959.037) [-959.142] (-958.883) (-961.316) -- 0:00:04
Average standard deviation of split frequencies: 0.009760
920500 -- [-960.533] (-963.377) (-961.123) (-962.653) * [-959.199] (-958.763) (-962.823) (-958.739) -- 0:00:04
921000 -- (-966.387) (-961.532) [-959.439] (-961.881) * [-958.263] (-961.924) (-960.413) (-958.791) -- 0:00:04
921500 -- (-960.084) (-962.603) [-963.205] (-960.917) * (-959.378) [-961.532] (-961.555) (-958.461) -- 0:00:04
922000 -- [-960.231] (-961.043) (-958.546) (-958.941) * [-962.218] (-960.045) (-960.561) (-961.561) -- 0:00:04
922500 -- (-959.866) (-961.669) (-959.914) [-958.961] * (-961.160) [-961.150] (-959.742) (-959.709) -- 0:00:04
923000 -- (-959.769) (-960.947) [-962.462] (-959.252) * [-961.644] (-959.295) (-959.102) (-959.144) -- 0:00:04
923500 -- (-963.706) (-959.670) (-958.689) [-960.262] * [-959.150] (-961.930) (-960.879) (-962.873) -- 0:00:04
924000 -- (-966.621) (-958.593) (-961.950) [-960.689] * (-960.621) (-960.133) (-962.924) [-959.532] -- 0:00:04
924500 -- (-970.259) (-959.371) [-961.731] (-960.399) * (-961.211) (-961.303) (-963.501) [-961.279] -- 0:00:04
925000 -- [-958.877] (-958.655) (-960.947) (-961.040) * (-959.612) (-961.440) (-960.039) [-965.171] -- 0:00:04
Average standard deviation of split frequencies: 0.009103
925500 -- (-959.631) (-960.466) (-959.075) [-959.489] * [-962.233] (-966.400) (-959.338) (-960.290) -- 0:00:04
926000 -- (-959.313) (-958.428) (-958.541) [-959.932] * [-959.294] (-965.544) (-961.947) (-959.413) -- 0:00:04
926500 -- (-960.116) (-959.357) [-962.341] (-960.700) * (-962.057) [-961.577] (-961.338) (-960.417) -- 0:00:04
927000 -- (-958.741) [-960.568] (-963.230) (-960.829) * (-959.635) [-959.941] (-961.894) (-963.305) -- 0:00:04
927500 -- (-959.099) [-960.369] (-962.400) (-962.469) * [-958.616] (-962.195) (-958.725) (-961.736) -- 0:00:04
928000 -- [-965.055] (-961.391) (-960.827) (-959.580) * (-961.422) (-963.895) [-959.422] (-959.160) -- 0:00:04
928500 -- (-961.097) (-962.945) (-961.171) [-958.098] * (-959.183) (-963.113) (-963.665) [-958.564] -- 0:00:04
929000 -- [-960.208] (-959.839) (-959.679) (-960.946) * [-958.273] (-965.255) (-959.981) (-960.761) -- 0:00:04
929500 -- (-961.130) (-959.843) (-960.936) [-960.867] * (-960.442) (-961.513) [-958.272] (-959.990) -- 0:00:04
930000 -- (-960.408) (-962.594) [-961.167] (-959.884) * [-959.015] (-961.279) (-959.043) (-960.537) -- 0:00:04
Average standard deviation of split frequencies: 0.009147
930500 -- (-964.263) [-959.275] (-961.532) (-961.544) * [-960.559] (-960.095) (-958.394) (-961.515) -- 0:00:04
931000 -- (-960.360) [-958.730] (-959.919) (-962.885) * (-959.874) [-958.434] (-959.324) (-963.690) -- 0:00:04
931500 -- [-958.974] (-960.253) (-961.254) (-960.024) * [-960.270] (-958.838) (-960.324) (-959.847) -- 0:00:04
932000 -- (-959.384) (-960.418) (-959.861) [-960.659] * [-959.156] (-959.480) (-960.806) (-959.317) -- 0:00:04
932500 -- (-961.774) (-961.623) [-959.492] (-964.625) * (-966.794) [-961.772] (-960.422) (-960.596) -- 0:00:04
933000 -- [-958.857] (-959.270) (-964.836) (-959.279) * (-965.713) (-966.045) [-960.223] (-961.615) -- 0:00:04
933500 -- (-958.845) [-960.907] (-962.505) (-958.633) * (-960.071) [-961.737] (-959.639) (-961.181) -- 0:00:04
934000 -- [-960.302] (-960.858) (-960.349) (-965.544) * (-959.660) (-963.040) [-958.916] (-961.012) -- 0:00:04
934500 -- (-961.130) [-960.534] (-960.748) (-964.433) * [-958.895] (-959.260) (-959.057) (-958.789) -- 0:00:03
935000 -- (-963.612) (-961.485) [-960.203] (-964.394) * (-964.266) [-962.142] (-959.567) (-962.746) -- 0:00:04
Average standard deviation of split frequencies: 0.008888
935500 -- (-961.555) (-959.664) [-960.775] (-962.908) * [-959.799] (-961.982) (-963.297) (-962.145) -- 0:00:03
936000 -- (-970.302) (-962.786) (-962.696) [-959.254] * (-958.745) [-959.848] (-960.612) (-959.881) -- 0:00:03
936500 -- (-959.268) [-962.519] (-961.772) (-962.946) * (-959.805) (-958.418) [-964.762] (-958.599) -- 0:00:03
937000 -- (-959.164) (-962.259) (-958.415) [-959.064] * (-960.196) [-961.988] (-963.017) (-961.234) -- 0:00:03
937500 -- (-961.336) [-962.488] (-958.404) (-958.553) * (-958.807) (-963.306) [-960.260] (-961.080) -- 0:00:03
938000 -- (-960.374) (-960.300) (-962.145) [-959.684] * (-958.592) (-960.987) [-960.458] (-961.091) -- 0:00:03
938500 -- (-961.560) (-963.790) [-959.519] (-961.771) * [-958.642] (-963.152) (-961.445) (-960.204) -- 0:00:03
939000 -- [-960.445] (-962.941) (-960.768) (-961.432) * (-961.761) [-959.255] (-958.327) (-961.671) -- 0:00:03
939500 -- [-959.596] (-964.610) (-963.450) (-962.861) * (-964.231) (-960.866) [-959.806] (-959.497) -- 0:00:03
940000 -- [-961.211] (-960.730) (-959.302) (-965.742) * (-961.953) (-960.102) [-960.711] (-961.314) -- 0:00:03
Average standard deviation of split frequencies: 0.008144
940500 -- (-964.922) (-958.533) [-958.596] (-960.942) * (-961.763) [-962.990] (-960.665) (-960.273) -- 0:00:03
941000 -- (-962.389) [-958.903] (-960.455) (-961.064) * [-961.381] (-959.886) (-960.350) (-961.913) -- 0:00:03
941500 -- (-960.414) (-962.854) [-961.011] (-961.599) * (-960.456) (-959.444) [-964.110] (-961.473) -- 0:00:03
942000 -- (-960.379) [-961.875] (-959.263) (-959.392) * (-961.915) (-959.233) [-963.480] (-960.319) -- 0:00:03
942500 -- (-960.122) [-959.387] (-963.056) (-960.759) * (-960.418) (-962.040) (-961.467) [-958.829] -- 0:00:03
943000 -- (-960.202) (-959.184) (-960.974) [-960.091] * (-963.610) (-958.673) [-963.404] (-961.748) -- 0:00:03
943500 -- (-963.369) (-959.790) [-963.053] (-961.397) * [-959.545] (-960.847) (-959.987) (-961.518) -- 0:00:03
944000 -- (-958.212) [-960.330] (-961.037) (-960.516) * [-958.293] (-961.170) (-959.966) (-962.436) -- 0:00:03
944500 -- (-961.243) (-960.655) (-961.030) [-960.849] * [-959.219] (-960.262) (-960.706) (-958.274) -- 0:00:03
945000 -- (-960.601) (-960.177) [-961.225] (-958.904) * (-959.168) (-958.927) (-960.426) [-961.073] -- 0:00:03
Average standard deviation of split frequencies: 0.008442
945500 -- [-961.663] (-960.700) (-960.914) (-958.867) * (-961.502) [-960.665] (-961.070) (-961.679) -- 0:00:03
946000 -- [-960.383] (-963.140) (-960.604) (-959.460) * (-958.477) (-959.134) (-961.446) [-959.031] -- 0:00:03
946500 -- (-959.661) (-960.071) (-962.641) [-961.085] * (-961.181) [-959.472] (-960.924) (-959.983) -- 0:00:03
947000 -- (-960.577) (-963.361) (-963.236) [-958.926] * (-964.854) (-960.866) (-960.821) [-960.885] -- 0:00:03
947500 -- [-964.726] (-959.940) (-965.128) (-960.338) * (-960.843) (-959.814) (-959.233) [-958.774] -- 0:00:03
948000 -- (-959.257) [-959.147] (-961.732) (-961.369) * (-960.711) (-959.857) [-959.943] (-962.056) -- 0:00:03
948500 -- (-958.687) (-959.249) [-959.753] (-966.819) * (-961.246) (-960.738) (-964.042) [-962.626] -- 0:00:03
949000 -- (-959.118) (-959.070) [-959.306] (-959.071) * (-962.096) (-959.699) (-967.972) [-964.119] -- 0:00:03
949500 -- (-964.331) (-963.441) (-958.771) [-959.108] * [-958.504] (-962.929) (-961.181) (-960.773) -- 0:00:03
950000 -- [-960.417] (-959.656) (-958.562) (-959.806) * (-964.293) (-960.991) [-961.061] (-959.783) -- 0:00:03
Average standard deviation of split frequencies: 0.007717
950500 -- (-958.961) [-959.876] (-958.678) (-962.494) * (-960.686) (-963.447) (-959.642) [-958.947] -- 0:00:03
951000 -- (-962.573) (-961.003) [-959.500] (-959.299) * (-963.880) (-962.191) [-960.987] (-963.903) -- 0:00:03
951500 -- [-959.787] (-964.429) (-959.180) (-961.925) * (-961.860) (-959.931) (-961.395) [-967.941] -- 0:00:03
952000 -- (-959.049) (-960.615) (-961.719) [-961.575] * [-961.372] (-959.298) (-960.628) (-958.498) -- 0:00:02
952500 -- (-960.229) (-959.544) (-959.273) [-960.170] * (-959.665) [-959.944] (-962.906) (-960.080) -- 0:00:02
953000 -- [-960.037] (-960.502) (-958.780) (-961.866) * [-958.873] (-960.421) (-965.820) (-959.993) -- 0:00:02
953500 -- (-959.033) (-960.525) [-958.207] (-964.228) * (-960.687) (-959.182) [-960.643] (-961.404) -- 0:00:02
954000 -- [-960.546] (-960.337) (-960.761) (-964.091) * (-959.547) (-959.327) [-962.083] (-960.824) -- 0:00:02
954500 -- [-960.361] (-960.020) (-958.617) (-960.425) * (-960.104) (-960.894) [-962.553] (-961.474) -- 0:00:02
955000 -- (-962.282) (-959.330) (-960.849) [-960.606] * (-960.941) [-961.244] (-961.861) (-960.527) -- 0:00:02
Average standard deviation of split frequencies: 0.007458
955500 -- (-960.217) (-961.232) [-960.432] (-959.330) * (-960.256) (-960.180) (-959.777) [-959.480] -- 0:00:02
956000 -- [-960.500] (-958.968) (-959.635) (-962.727) * (-959.546) [-959.247] (-960.651) (-959.943) -- 0:00:02
956500 -- [-959.264] (-961.153) (-959.862) (-960.479) * (-966.786) (-958.717) (-962.594) [-960.067] -- 0:00:02
957000 -- (-962.568) [-961.800] (-960.302) (-959.763) * (-961.356) [-959.680] (-962.667) (-961.135) -- 0:00:02
957500 -- (-962.086) (-959.195) [-961.678] (-959.665) * (-965.262) [-961.008] (-961.233) (-962.635) -- 0:00:02
958000 -- (-962.221) (-964.328) [-958.558] (-961.425) * [-959.351] (-958.918) (-961.664) (-960.547) -- 0:00:02
958500 -- (-964.025) (-964.234) [-961.359] (-961.346) * (-959.419) (-960.136) (-961.851) [-962.987] -- 0:00:02
959000 -- [-959.801] (-960.018) (-959.193) (-962.876) * (-960.264) (-959.754) (-961.085) [-959.722] -- 0:00:02
959500 -- (-959.810) [-960.802] (-960.156) (-962.266) * (-961.389) [-960.924] (-966.065) (-962.365) -- 0:00:02
960000 -- [-959.229] (-961.565) (-961.504) (-962.434) * (-962.162) (-959.472) [-958.579] (-961.697) -- 0:00:02
Average standard deviation of split frequencies: 0.007514
960500 -- [-959.883] (-958.893) (-960.314) (-958.737) * (-962.029) (-959.321) (-958.346) [-961.454] -- 0:00:02
961000 -- [-961.786] (-960.851) (-958.561) (-959.233) * (-972.004) [-959.196] (-961.570) (-962.020) -- 0:00:02
961500 -- (-961.490) [-959.116] (-963.309) (-959.433) * (-961.555) (-959.679) [-960.933] (-960.903) -- 0:00:02
962000 -- (-961.331) (-961.366) [-961.416] (-963.406) * (-959.192) [-960.451] (-959.411) (-962.776) -- 0:00:02
962500 -- (-959.177) [-960.790] (-959.777) (-959.956) * (-960.995) (-959.458) (-958.975) [-958.532] -- 0:00:02
963000 -- (-960.441) (-963.064) (-961.818) [-960.409] * [-961.410] (-960.844) (-958.960) (-960.999) -- 0:00:02
963500 -- [-962.104] (-960.759) (-960.124) (-960.691) * [-961.122] (-960.316) (-962.766) (-959.087) -- 0:00:02
964000 -- (-961.024) [-961.264] (-959.615) (-959.539) * (-961.375) (-961.203) [-961.194] (-959.528) -- 0:00:02
964500 -- (-961.774) (-965.225) (-959.322) [-958.670] * (-959.732) (-962.160) [-959.885] (-958.696) -- 0:00:02
965000 -- (-961.404) (-963.773) [-962.930] (-959.783) * [-961.222] (-959.695) (-959.276) (-963.497) -- 0:00:02
Average standard deviation of split frequencies: 0.007625
965500 -- (-958.828) [-961.644] (-964.159) (-960.802) * [-960.097] (-960.813) (-962.598) (-959.837) -- 0:00:02
966000 -- [-960.170] (-963.446) (-965.230) (-959.709) * (-961.366) (-965.497) (-961.464) [-958.764] -- 0:00:02
966500 -- (-961.473) [-961.403] (-960.026) (-959.233) * (-962.133) (-959.750) (-959.061) [-959.102] -- 0:00:02
967000 -- [-959.904] (-962.186) (-958.576) (-962.210) * (-962.156) (-960.708) (-961.981) [-958.859] -- 0:00:02
967500 -- (-959.049) (-960.027) (-959.356) [-960.337] * (-960.241) [-959.219] (-960.686) (-959.733) -- 0:00:01
968000 -- (-959.128) (-960.081) [-958.695] (-959.703) * (-959.384) (-959.046) (-958.672) [-961.345] -- 0:00:01
968500 -- (-960.120) (-962.615) [-959.978] (-960.507) * (-962.123) (-961.329) (-959.955) [-960.403] -- 0:00:01
969000 -- (-960.830) (-963.093) [-961.896] (-960.682) * (-960.991) (-960.410) (-961.211) [-964.638] -- 0:00:01
969500 -- [-960.925] (-960.104) (-962.601) (-959.640) * [-961.839] (-959.756) (-959.621) (-960.444) -- 0:00:01
970000 -- (-960.102) (-960.869) (-960.206) [-960.872] * (-961.244) (-961.429) (-960.222) [-959.133] -- 0:00:01
Average standard deviation of split frequencies: 0.007801
970500 -- (-958.691) (-959.765) (-961.912) [-959.464] * (-959.794) (-960.509) (-960.021) [-959.676] -- 0:00:01
971000 -- (-961.527) (-960.369) [-961.056] (-959.946) * [-960.166] (-958.798) (-959.956) (-960.615) -- 0:00:01
971500 -- (-958.537) [-959.761] (-959.832) (-963.248) * (-959.148) (-959.821) [-959.728] (-961.553) -- 0:00:01
972000 -- (-963.382) (-959.602) (-960.540) [-962.717] * [-961.300] (-963.025) (-959.070) (-960.906) -- 0:00:01
972500 -- (-962.056) [-962.872] (-959.523) (-967.016) * [-959.706] (-958.899) (-961.627) (-958.122) -- 0:00:01
973000 -- (-960.652) [-960.419] (-960.272) (-960.913) * (-963.468) (-958.248) [-960.968] (-958.531) -- 0:00:01
973500 -- (-960.491) (-961.060) [-958.730] (-962.322) * (-963.053) (-959.083) (-958.791) [-958.866] -- 0:00:01
974000 -- [-960.949] (-959.583) (-961.523) (-961.780) * (-961.987) (-959.302) (-961.684) [-958.323] -- 0:00:01
974500 -- (-961.654) (-958.801) [-963.325] (-960.510) * (-962.943) (-961.722) (-959.370) [-964.291] -- 0:00:01
975000 -- (-961.255) (-959.177) (-962.152) [-962.494] * (-961.356) (-961.402) [-960.592] (-965.436) -- 0:00:01
Average standard deviation of split frequencies: 0.007607
975500 -- (-968.789) (-961.403) (-961.962) [-962.580] * (-960.844) [-960.206] (-961.437) (-962.517) -- 0:00:01
976000 -- (-963.465) (-961.742) (-959.365) [-958.498] * (-959.580) (-959.640) [-960.619] (-960.709) -- 0:00:01
976500 -- (-959.076) [-960.547] (-959.500) (-960.180) * (-961.712) (-964.525) (-960.619) [-960.043] -- 0:00:01
977000 -- (-960.565) (-959.892) [-960.978] (-959.072) * (-962.213) (-961.716) (-966.081) [-958.995] -- 0:00:01
977500 -- [-960.008] (-964.724) (-960.494) (-960.278) * (-962.366) (-960.869) [-960.425] (-961.369) -- 0:00:01
978000 -- [-958.974] (-958.984) (-959.163) (-960.554) * (-959.518) (-959.712) (-960.181) [-959.104] -- 0:00:01
978500 -- [-960.313] (-960.222) (-958.737) (-958.983) * (-959.157) (-960.183) [-961.431] (-963.421) -- 0:00:01
979000 -- (-959.666) (-960.818) [-962.134] (-959.818) * (-961.165) [-960.561] (-960.969) (-961.721) -- 0:00:01
979500 -- (-959.331) [-962.104] (-960.622) (-962.106) * (-960.562) [-961.493] (-958.990) (-963.798) -- 0:00:01
980000 -- (-959.215) (-960.989) [-960.493] (-960.974) * (-959.536) (-959.283) [-958.936] (-963.544) -- 0:00:01
Average standard deviation of split frequencies: 0.007841
980500 -- (-959.638) (-961.153) (-964.037) [-960.953] * (-959.514) (-958.865) (-962.137) [-962.250] -- 0:00:01
981000 -- (-961.979) (-959.274) (-960.664) [-960.544] * (-959.823) [-958.812] (-961.441) (-960.173) -- 0:00:01
981500 -- (-958.756) (-959.701) [-959.548] (-958.728) * (-961.479) (-961.696) [-960.634] (-960.665) -- 0:00:01
982000 -- (-961.897) (-961.650) [-960.055] (-958.733) * (-962.490) (-960.039) [-963.295] (-960.131) -- 0:00:01
982500 -- [-959.724] (-960.827) (-960.966) (-961.089) * (-963.330) [-960.710] (-959.710) (-958.799) -- 0:00:01
983000 -- (-958.812) (-959.761) [-966.848] (-961.535) * (-961.260) [-960.125] (-959.657) (-959.469) -- 0:00:01
983500 -- [-960.019] (-961.641) (-962.802) (-963.206) * (-959.697) (-959.480) (-959.589) [-960.298] -- 0:00:01
984000 -- (-960.667) (-960.767) [-960.235] (-958.816) * (-959.454) (-959.801) (-958.459) [-959.447] -- 0:00:00
984500 -- [-959.254] (-962.594) (-961.204) (-960.655) * [-964.022] (-961.513) (-958.929) (-962.510) -- 0:00:00
985000 -- (-958.334) [-959.154] (-959.973) (-960.938) * (-970.717) [-960.242] (-961.030) (-958.785) -- 0:00:00
Average standard deviation of split frequencies: 0.008381
985500 -- (-961.089) (-958.124) [-958.933] (-963.279) * [-963.467] (-960.529) (-958.717) (-965.173) -- 0:00:00
986000 -- (-960.069) (-960.338) [-960.545] (-960.949) * (-960.970) (-959.333) [-961.833] (-962.487) -- 0:00:00
986500 -- (-961.069) (-958.989) (-959.770) [-959.564] * (-959.234) (-960.822) [-961.140] (-960.634) -- 0:00:00
987000 -- (-962.675) (-963.696) [-958.901] (-959.692) * (-964.738) (-962.304) (-963.567) [-959.191] -- 0:00:00
987500 -- (-959.951) (-959.261) (-958.800) [-960.131] * (-964.439) [-961.224] (-961.625) (-962.042) -- 0:00:00
988000 -- (-960.968) (-964.661) [-960.403] (-960.832) * (-961.427) [-960.491] (-963.474) (-961.968) -- 0:00:00
988500 -- (-959.621) [-959.205] (-960.493) (-961.163) * [-959.299] (-960.282) (-959.201) (-960.762) -- 0:00:00
989000 -- [-959.565] (-961.065) (-958.827) (-966.549) * (-959.557) (-962.751) [-960.741] (-960.283) -- 0:00:00
989500 -- [-963.361] (-958.958) (-959.087) (-965.855) * (-963.328) (-961.096) (-959.165) [-960.478] -- 0:00:00
990000 -- (-958.401) [-961.925] (-962.605) (-960.768) * [-959.932] (-963.009) (-959.041) (-961.951) -- 0:00:00
Average standard deviation of split frequencies: 0.007732
990500 -- (-962.351) [-959.524] (-959.276) (-961.030) * [-961.582] (-961.239) (-959.325) (-963.600) -- 0:00:00
991000 -- (-962.829) [-959.006] (-960.175) (-966.444) * (-959.973) (-962.223) (-960.385) [-960.807] -- 0:00:00
991500 -- [-960.456] (-959.327) (-961.118) (-958.854) * (-960.812) (-960.939) [-963.465] (-963.597) -- 0:00:00
992000 -- [-959.046] (-960.923) (-958.937) (-960.507) * (-962.066) [-959.136] (-960.433) (-961.612) -- 0:00:00
992500 -- [-958.545] (-958.998) (-960.189) (-960.716) * (-965.072) (-961.958) (-958.581) [-961.259] -- 0:00:00
993000 -- [-960.646] (-964.955) (-961.000) (-959.916) * [-960.621] (-960.173) (-960.822) (-959.793) -- 0:00:00
993500 -- [-962.370] (-959.395) (-963.147) (-960.187) * (-958.989) [-960.683] (-959.632) (-959.478) -- 0:00:00
994000 -- [-960.822] (-959.969) (-959.150) (-960.436) * (-959.413) [-958.386] (-960.917) (-959.670) -- 0:00:00
994500 -- (-960.357) (-959.138) (-958.688) [-962.949] * (-960.783) [-958.375] (-961.796) (-961.754) -- 0:00:00
995000 -- (-960.642) (-959.379) [-958.185] (-962.854) * (-959.922) [-959.515] (-960.304) (-961.358) -- 0:00:00
Average standard deviation of split frequencies: 0.007573
995500 -- (-962.057) [-959.025] (-959.079) (-960.079) * [-959.393] (-960.346) (-960.684) (-965.085) -- 0:00:00
996000 -- (-958.590) [-958.540] (-959.400) (-959.628) * (-958.186) [-963.599] (-960.513) (-958.785) -- 0:00:00
996500 -- (-959.689) (-963.228) (-960.020) [-960.386] * (-958.721) (-961.093) (-959.812) [-959.112] -- 0:00:00
997000 -- (-959.133) (-965.412) (-966.355) [-959.177] * (-959.769) (-963.499) [-961.131] (-958.639) -- 0:00:00
997500 -- (-959.495) (-960.864) [-962.578] (-959.623) * (-961.044) [-960.742] (-961.256) (-959.825) -- 0:00:00
998000 -- (-961.115) (-963.424) [-961.310] (-960.337) * [-960.064] (-959.222) (-961.766) (-959.981) -- 0:00:00
998500 -- [-960.755] (-965.599) (-964.271) (-960.814) * (-960.243) (-960.870) [-958.835] (-958.895) -- 0:00:00
999000 -- [-960.556] (-961.496) (-967.179) (-960.611) * [-960.178] (-961.389) (-958.466) (-960.811) -- 0:00:00
999500 -- [-963.543] (-963.895) (-959.489) (-960.632) * [-960.350] (-958.954) (-960.991) (-965.640) -- 0:00:00
1000000 -- (-960.073) (-959.457) [-959.490] (-962.358) * (-959.620) (-963.037) (-959.086) [-958.591] -- 0:00:00
Average standard deviation of split frequencies: 0.007479
Analysis completed in 1 mins 1 seconds
Analysis used 59.82 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -958.03
Likelihood of best state for "cold" chain of run 2 was -958.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.4 % ( 25 %) Dirichlet(Pi{all})
29.8 % ( 29 %) Slider(Pi{all})
78.6 % ( 56 %) Multiplier(Alpha{1,2})
78.3 % ( 46 %) Multiplier(Alpha{3})
21.8 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.6 % ( 39 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.4 % ( 15 %) Dirichlet(Pi{all})
30.3 % ( 18 %) Slider(Pi{all})
78.8 % ( 46 %) Multiplier(Alpha{1,2})
77.6 % ( 47 %) Multiplier(Alpha{3})
20.9 % ( 13 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166862 0.82 0.67
3 | 166974 166737 0.84
4 | 167200 166091 166136
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166681 0.82 0.67
3 | 167115 166508 0.84
4 | 166844 166534 166318
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -959.85
| 2 22 1 11 2 1 2 2 |
| 2 1 1 2 |
| 2 2 2 |
| * 12 2 * 2 1 1 2 * 1 2|
|* 22 1 1 2 2 1 1 112 2 212 2 2 1|
| 1 1 1 * 2 11 1 2 1 1 |
| * * 2 21222 2 112 1 1* 1 2 2 2 |
| 1 2 1 1 1 2 1 2 1 21 |
| 2 2 2 2 1 1 1 |
| 1 1 1 2 1 12 |
| 1 2 |
| 2 2 1 2 |
| 1 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -961.77
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -959.81 -962.95
2 -959.79 -962.80
--------------------------------------
TOTAL -959.80 -962.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886814 0.089835 0.372569 1.484912 0.850404 1311.18 1365.28 1.000
r(A<->C){all} 0.181000 0.023197 0.000059 0.490739 0.140454 91.91 143.18 1.006
r(A<->G){all} 0.171381 0.021104 0.000007 0.469425 0.132701 239.03 281.60 1.000
r(A<->T){all} 0.162604 0.018610 0.000091 0.435354 0.130305 125.70 163.28 1.005
r(C<->G){all} 0.168126 0.019947 0.000125 0.441893 0.129410 150.08 203.51 1.003
r(C<->T){all} 0.159770 0.019525 0.000012 0.443707 0.121128 132.20 218.94 1.000
r(G<->T){all} 0.157119 0.018060 0.000020 0.433644 0.120413 201.77 250.20 1.000
pi(A){all} 0.209931 0.000251 0.180279 0.242889 0.209687 1219.39 1330.38 1.000
pi(C){all} 0.280739 0.000294 0.246438 0.313759 0.280382 1268.20 1299.27 1.000
pi(G){all} 0.328884 0.000317 0.294117 0.362896 0.328518 1315.56 1408.28 1.000
pi(T){all} 0.180446 0.000203 0.153787 0.209039 0.180230 1080.18 1204.76 1.000
alpha{1,2} 0.419369 0.225127 0.000181 1.398486 0.250816 1026.29 1176.67 1.000
alpha{3} 0.449830 0.223991 0.000326 1.413658 0.289434 959.55 1171.41 1.001
pinvar{all} 0.997804 0.000007 0.992774 0.999999 0.998625 1304.50 1305.57 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*.***
9 -- ..****
10 -- .**.**
11 -- .*...*
12 -- ...*.*
13 -- .*.*..
14 -- .****.
15 -- ..*..*
16 -- ....**
17 -- .*..*.
18 -- .**...
19 -- ..**..
20 -- ...**.
21 -- .***.*
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.009893 0.147901 0.161892 2
8 446 0.148568 0.008480 0.142572 0.154564 2
9 445 0.148235 0.003298 0.145903 0.150566 2
10 444 0.147901 0.003769 0.145237 0.150566 2
11 435 0.144903 0.008009 0.139241 0.150566 2
12 432 0.143904 0.016959 0.131912 0.155896 2
13 427 0.142239 0.004240 0.139241 0.145237 2
14 423 0.140906 0.015546 0.129913 0.151899 2
15 423 0.140906 0.004240 0.137908 0.143904 2
16 420 0.139907 0.016017 0.128581 0.151233 2
17 418 0.139241 0.006595 0.134577 0.143904 2
18 418 0.139241 0.001884 0.137908 0.140573 2
19 410 0.136576 0.012248 0.127915 0.145237 2
20 409 0.136243 0.003298 0.133911 0.138574 2
21 408 0.135909 0.001884 0.134577 0.137242 2
22 297 0.098934 0.003298 0.096602 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101210 0.010382 0.000047 0.309674 0.068406 1.000 2
length{all}[2] 0.097706 0.009345 0.000037 0.285562 0.070650 1.001 2
length{all}[3] 0.100045 0.010269 0.000021 0.302550 0.069881 1.000 2
length{all}[4] 0.095417 0.009347 0.000008 0.286973 0.066734 1.000 2
length{all}[5] 0.095538 0.009407 0.000014 0.284399 0.066208 1.000 2
length{all}[6] 0.100532 0.010080 0.000038 0.296377 0.069931 1.000 2
length{all}[7] 0.105292 0.010640 0.000057 0.318727 0.075003 0.999 2
length{all}[8] 0.093945 0.008551 0.000386 0.289143 0.067227 1.008 2
length{all}[9] 0.094885 0.010010 0.000017 0.302144 0.064446 0.998 2
length{all}[10] 0.098043 0.010064 0.000544 0.289641 0.063035 0.998 2
length{all}[11] 0.098047 0.010724 0.000558 0.320701 0.062757 0.999 2
length{all}[12] 0.103021 0.010120 0.000420 0.311621 0.075098 0.998 2
length{all}[13] 0.095344 0.009444 0.000083 0.297449 0.061613 1.000 2
length{all}[14] 0.098458 0.009442 0.000201 0.265621 0.071284 0.998 2
length{all}[15] 0.087979 0.007034 0.000367 0.262231 0.061728 1.003 2
length{all}[16] 0.104618 0.010899 0.000059 0.299896 0.075574 0.998 2
length{all}[17] 0.098812 0.011481 0.000177 0.325767 0.065737 0.999 2
length{all}[18] 0.096910 0.008400 0.000089 0.295267 0.066040 1.000 2
length{all}[19] 0.103251 0.009963 0.000335 0.279631 0.077598 0.998 2
length{all}[20] 0.092962 0.009578 0.000100 0.289224 0.061812 1.006 2
length{all}[21] 0.097339 0.009477 0.000209 0.292218 0.067300 0.999 2
length{all}[22] 0.101033 0.010976 0.000220 0.257418 0.074144 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007479
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 705
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 235 / 235 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 235 / 235 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084051 0.048975 0.041995 0.104705 0.063303 0.068084 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1000.748808
Iterating by ming2
Initial: fx= 1000.748808
x= 0.08405 0.04897 0.04200 0.10470 0.06330 0.06808 0.30000 1.30000
1 h-m-p 0.0000 0.0002 560.3162 +++ 943.178224 m 0.0002 14 | 1/8
2 h-m-p 0.0008 0.0041 76.3939 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 515.0767 ++ 935.108575 m 0.0000 45 | 2/8
4 h-m-p 0.0003 0.0062 52.1300 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 460.7627 ++ 921.805475 m 0.0001 75 | 3/8
6 h-m-p 0.0006 0.0083 39.7145 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 399.6970 ++ 918.465070 m 0.0000 106 | 4/8
8 h-m-p 0.0002 0.0117 28.4846 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 326.1003 ++ 911.008117 m 0.0001 136 | 5/8
10 h-m-p 0.0009 0.0179 18.6859 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 230.8349 ++ 906.153467 m 0.0001 167 | 6/8
12 h-m-p 1.0473 8.0000 0.0000 ++ 906.153467 m 8.0000 178 | 6/8
13 h-m-p 0.1999 8.0000 0.0001 +++ 906.153467 m 8.0000 192 | 6/8
14 h-m-p 0.0160 8.0000 1.4956 ++C 906.153467 0 0.2560 207 | 6/8
15 h-m-p 1.6000 8.0000 0.0918 -------C 906.153467 0 0.0000 225 | 6/8
16 h-m-p 1.6000 8.0000 0.0000 Y 906.153467 0 1.6000 238 | 6/8
17 h-m-p 0.0160 8.0000 0.0032 ----Y 906.153467 0 0.0000 255 | 6/8
18 h-m-p 0.0182 8.0000 0.0000 Y 906.153467 0 0.0045 268 | 6/8
19 h-m-p 0.0247 8.0000 0.0000 -----C 906.153467 0 0.0000 286
Out..
lnL = -906.153467
287 lfun, 287 eigenQcodon, 1722 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086263 0.100793 0.019634 0.033394 0.077595 0.036794 0.470307 0.581738 0.555859
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.219572
np = 9
lnL0 = -987.276622
Iterating by ming2
Initial: fx= 987.276622
x= 0.08626 0.10079 0.01963 0.03339 0.07760 0.03679 0.47031 0.58174 0.55586
1 h-m-p 0.0000 0.0001 553.5039 ++ 960.731312 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 264.2985 ++ 944.941356 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 1614.3730 ++ 942.124297 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 4338.4152 ++ 914.056124 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 2441.7435 ++ 909.740936 m 0.0000 62 | 5/9
6 h-m-p 0.0001 0.0003 845.8444 ++ 906.735309 m 0.0003 74 | 5/9
7 h-m-p 0.0042 0.0208 48.2360 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 232.7264 ++ 906.153503 m 0.0000 108 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 906.153503 m 8.0000 123 | 6/9
10 h-m-p 0.0147 0.0737 0.0015 ------N 906.153503 0 0.0000 144 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 906.153503 m 8.0000 162 | 6/9
12 h-m-p 0.0004 0.0021 0.1135 ----Y 906.153503 0 0.0000 181 | 6/9
13 h-m-p 0.0045 2.2563 0.0001 ------------.. | 6/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 906.153503 m 8.0000 224 | 6/9
15 h-m-p 0.0052 2.6247 0.2680 +++++ 906.153471 m 2.6247 242 | 7/9
16 h-m-p 0.7509 3.7547 0.1304 ++ 906.153463 m 3.7547 257 | 8/9
17 h-m-p 0.3598 1.7989 0.4289 -----Y 906.153463 0 0.0001 276 | 8/9
18 h-m-p 0.5000 8.0000 0.0001 +Y 906.153463 0 3.6667 290 | 8/9
19 h-m-p 1.6000 8.0000 0.0000 Y 906.153463 0 1.6000 303
Out..
lnL = -906.153463
304 lfun, 912 eigenQcodon, 3648 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057592 0.011532 0.035258 0.033225 0.010580 0.059705 0.000100 1.472967 0.161893 0.428602 1.815795
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.209844
np = 11
lnL0 = -952.724171
Iterating by ming2
Initial: fx= 952.724171
x= 0.05759 0.01153 0.03526 0.03322 0.01058 0.05970 0.00011 1.47297 0.16189 0.42860 1.81579
1 h-m-p 0.0000 0.0000 532.6289 ++ 950.923334 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 135.3631 +++ 936.724006 m 0.0009 31 | 2/11
3 h-m-p 0.0000 0.0000 266.2301 ++ 935.817590 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0015 145.5169 ++++ 917.093121 m 0.0015 61 | 4/11
5 h-m-p 0.0000 0.0000 19928.6236 ++ 915.849827 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 3166.4512 ++ 912.398829 m 0.0000 89 | 6/11
7 h-m-p 0.0021 0.0106 7.2166 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 316.8526 ++ 906.584684 m 0.0001 127 | 7/11
9 h-m-p 0.0160 8.0000 2.0065 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 231.8006 ++ 906.153485 m 0.0000 166 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 906.153485 m 8.0000 183 | 7/11
12 h-m-p 0.0219 8.0000 0.0019 +++++ 906.153485 m 8.0000 203 | 7/11
13 h-m-p 0.0165 1.2426 0.9311 ++++ 906.153479 m 1.2426 223 | 7/11
14 h-m-p -0.0000 -0.0000 1.0288
h-m-p: -0.00000000e+00 -0.00000000e+00 1.02876893e+00 906.153479
.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 906.153479 m 8.0000 255 | 7/11
16 h-m-p 0.0250 8.0000 0.0105 +++++ 906.153477 m 8.0000 276 | 7/11
17 h-m-p 0.1579 2.0397 0.5307 ++ 906.153462 m 2.0397 294 | 8/11
18 h-m-p 1.6000 8.0000 0.1017 ++ 906.153460 m 8.0000 312 | 8/11
19 h-m-p 0.6906 8.0000 1.1776 Y 906.153459 0 1.3909 329 | 8/11
20 h-m-p 1.6000 8.0000 0.3722 Y 906.153459 0 0.7911 343 | 8/11
21 h-m-p 1.6000 8.0000 0.0050 Y 906.153459 0 2.8770 360 | 8/11
22 h-m-p 1.6000 8.0000 0.0035 C 906.153459 0 2.1147 377 | 8/11
23 h-m-p 1.6000 8.0000 0.0015 ++ 906.153459 m 8.0000 394 | 8/11
24 h-m-p 0.2160 8.0000 0.0539 ++Y 906.153459 0 2.3138 413 | 8/11
25 h-m-p 1.6000 8.0000 0.0021 ++ 906.153459 m 8.0000 430 | 8/11
26 h-m-p 0.0089 1.4848 1.9086 ----------Y 906.153459 0 0.0000 457 | 8/11
27 h-m-p 0.0073 3.6356 0.9496 +++C 906.153459 0 0.6444 474 | 8/11
28 h-m-p 1.6000 8.0000 0.0930 Y 906.153459 0 0.7554 491 | 8/11
29 h-m-p 1.6000 8.0000 0.0011 ++ 906.153459 m 8.0000 508 | 8/11
30 h-m-p 0.2216 8.0000 0.0408 ++Y 906.153459 0 2.3985 527 | 8/11
31 h-m-p 1.6000 8.0000 0.0029 ++ 906.153459 m 8.0000 544 | 8/11
32 h-m-p 0.0000 0.0002 599692.0112 Y 906.153457 0 0.0000 561 | 8/11
33 h-m-p 1.6000 8.0000 0.7514 C 906.153456 0 0.5109 575 | 8/11
34 h-m-p 1.6000 8.0000 0.0205 ++ 906.153456 m 8.0000 592 | 8/11
35 h-m-p 0.3606 8.0000 0.4542 +C 906.153456 0 2.0878 610 | 8/11
36 h-m-p 1.6000 8.0000 0.2444 ++ 906.153450 m 8.0000 627 | 8/11
37 h-m-p 0.5415 8.0000 3.6115 ++ 906.153435 m 8.0000 644 | 8/11
38 h-m-p 1.6000 8.0000 0.8149 ++ 906.153435 m 8.0000 658 | 8/11
39 h-m-p 1.5645 8.0000 4.1672 ++ 906.153435 m 8.0000 675 | 8/11
40 h-m-p 0.7951 3.9753 18.1954 -------------Y 906.153435 0 0.0000 702 | 8/11
41 h-m-p 0.0035 1.7350 41.7155 ------------.. | 8/11
42 h-m-p 0.0160 8.0000 0.0000 --------Y 906.153435 0 0.0000 748 | 8/11
43 h-m-p 0.0160 8.0000 0.0000 ------Y 906.153435 0 0.0000 771
Out..
lnL = -906.153435
772 lfun, 3088 eigenQcodon, 13896 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -906.148116 S = -906.147929 -0.000071
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:06
did 20 / 49 patterns 0:06
did 30 / 49 patterns 0:06
did 40 / 49 patterns 0:06
did 49 / 49 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026400 0.109272 0.050952 0.050507 0.075816 0.088892 0.000100 0.334377 1.296265
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 22.102273
np = 9
lnL0 = -993.230164
Iterating by ming2
Initial: fx= 993.230164
x= 0.02640 0.10927 0.05095 0.05051 0.07582 0.08889 0.00011 0.33438 1.29626
1 h-m-p 0.0000 0.0000 496.4898 ++ 992.879455 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0103 42.2165 +++++ 984.899872 m 0.0103 29 | 2/9
3 h-m-p 0.0001 0.0004 2302.7198 ++ 941.301286 m 0.0004 41 | 3/9
4 h-m-p 0.0000 0.0002 109.2031 ++ 938.458160 m 0.0002 53 | 3/9
5 h-m-p 0.0000 0.0000 2935.1758 ++ 937.473460 m 0.0000 65 | 4/9
6 h-m-p 0.0000 0.0000 390.9285 ++ 935.124569 m 0.0000 77 | 5/9
7 h-m-p 0.0001 0.0003 160.1814 ++ 921.314474 m 0.0003 89 | 6/9
8 h-m-p 0.0005 0.0024 27.6688 ++ 906.391146 m 0.0024 101 | 7/9
9 h-m-p 0.0000 0.0000 42.2994 ++ 906.153535 m 0.0000 113 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 906.153535 m 8.0000 125 | 7/9
11 h-m-p 0.0233 8.0000 0.0034 ----------Y 906.153535 0 0.0000 148 | 7/9
12 h-m-p 0.0070 3.4788 0.0078 +++++ 906.153482 m 3.4788 165 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 906.153482 0 1.6000 179 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 C 906.153482 0 0.0160 192
Out..
lnL = -906.153482
193 lfun, 2123 eigenQcodon, 11580 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079864 0.080294 0.056244 0.102962 0.074698 0.107944 0.000100 0.900000 0.958975 1.625822 1.643930
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.525689
np = 11
lnL0 = -1011.725446
Iterating by ming2
Initial: fx= 1011.725446
x= 0.07986 0.08029 0.05624 0.10296 0.07470 0.10794 0.00011 0.90000 0.95897 1.62582 1.64393
1 h-m-p 0.0000 0.0000 471.9749 ++ 1011.399375 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 563.9967 +++ 942.725596 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 10557.2717 ++ 922.574162 m 0.0000 45 | 3/11
4 h-m-p 0.0021 0.0107 28.4266 ++ 917.787500 m 0.0107 59 | 4/11
5 h-m-p 0.0000 0.0000 361.8624 ++ 917.572470 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0016 428.7882 ++++ 909.272998 m 0.0016 89 | 6/11
7 h-m-p 0.0000 0.0000 6456.5046 ++ 906.153505 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0021 ++ 906.153503 m 8.0000 117 | 7/11
9 h-m-p 0.0913 8.0000 0.1873 ++++ 906.153460 m 8.0000 137 | 7/11
10 h-m-p 1.6000 8.0000 0.0174 ++ 906.153460 m 8.0000 155 | 7/11
11 h-m-p 1.6000 8.0000 0.0059 C 906.153460 0 1.9409 173 | 7/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 906.153460 m 8.0000 191 | 7/11
13 h-m-p 0.0013 0.6711 1.1956 +++++ 906.153449 m 0.6711 212 | 8/11
14 h-m-p 0.8377 8.0000 0.8813 ++ 906.153438 m 8.0000 226 | 8/11
15 h-m-p 1.6000 8.0000 0.4544 ++ 906.153437 m 8.0000 243 | 8/11
16 h-m-p 0.9337 7.7300 3.8929 +
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
+ 906.153435 m 7.7300 260
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.555667e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
| 8/11
17 h-m-p 0.0000 0.0000 0.8355
h-m-p: 3.76146879e-17 1.88073439e-16 8.35512786e-01 906.153435
..
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17051) = 4.401817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17013) = 4.402172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
| 8/11
18 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
Y 906.153435 0 0.0160 288
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17051) = 4.401817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17013) = 4.402172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
| 8/11
19 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
N 906.153435 0 0.0000 313
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
Out..
lnL = -906.153435
314 lfun, 3768 eigenQcodon, 20724 P(t)
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -906.148356 S = -906.147946 -0.000180
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:14
did 20 / 49 patterns 0:15
did 30 / 49 patterns 0:15
did 40 / 49 patterns 0:15
did 49 / 49 patterns 0:15
QuantileBeta(0.15, 0.00500, 5.17032) = 4.401994e-161 2000 rounds
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=235
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
NC_002677_1_NP_302281_1_1153_rplA MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV
**************************************************
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
NC_002677_1_NP_302281_1_1153_rplA DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL
**************************************************
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
NC_002677_1_NP_302281_1_1153_rplA IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
**************************************************
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
NC_002677_1_NP_302281_1_1153_rplA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK
**************************************************
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
NC_002677_1_NP_302281_1_1153_rplA PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
***********************************
>NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG >NC_002677_1_NP_302281_1_1153_rplA ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG >NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG >NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG >NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG >NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 ATGAGCAAAAGCAGCAAGGCTTATCGCGCTGCCGCCGTGAAGGTGGACCG CACCAACCTTTACACTCCACTTCAGGCGGCCAAGCTCGCCAAAGAGACGT CGTCGACCAGGCAGGATGCGACCGTCGAGGTGGCGATACGGCTGGGTGTC GACTCGCGTAAAGCAGACCAAATGGTCCGTGGCACGGTTAACCTGCCACA CGGTACCGGTAAGACCGCTCGGGTCGCAGTGTTCGCCGTCGGCGAAAAAG CGGATGTTGCCGTAGCCGCGGGAGCTGATGTGGTTGGTAGCGACGATCTG ATCGAGAAGATTCAGGGCGGCTGGCTGGAGTTCGACGCCGCGGTCGCGAC ACCCGATCAGATGGCCAAGGTTGGTCGTATCGCTCGGGTGTTGGGTCCAC GTGGCTTGATGCCGAACCCCAAGACCGGCACCGTCACCCCCGATGTCGCC AAGGCCGTTGCTGACATCAAGGGCGGCAAGATCAACTTCCGGGTGGACAA ACAGGCTAATTTGCACTTTGTGATCGGCAAGGCATCGTTCGATGAGAAGC GGCTGGCGGAGAACTACGGCGCCGCGCTTGAGGAGGTGCTTCGGCTCAAG CCGTCGTCGTCGAAGGGCCGTTACCTGAAGAAGGTCACCGTGTCGACGAC TATGGGCCCTGGCATTCCGGTCGACCCGTCGATAACCCGGAATTTCACCG AGGAG
>NC_011896_1_WP_010908602_1_2030_MLBR_RS09630 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE >NC_002677_1_NP_302281_1_1153_rplA MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE >NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE >NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE >NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE >NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725 MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGV DSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDL IEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA KAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK PSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
#NEXUS
[ID: 0360240304]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908602_1_2030_MLBR_RS09630
NC_002677_1_NP_302281_1_1153_rplA
NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560
NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890
NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450
NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908602_1_2030_MLBR_RS09630,
2 NC_002677_1_NP_302281_1_1153_rplA,
3 NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560,
4 NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890,
5 NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450,
6 NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06840621,2:0.07065034,3:0.06988073,4:0.06673375,5:0.06620827,6:0.06993147);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06840621,2:0.07065034,3:0.06988073,4:0.06673375,5:0.06620827,6:0.06993147);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -959.81 -962.95
2 -959.79 -962.80
--------------------------------------
TOTAL -959.80 -962.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886814 0.089835 0.372569 1.484912 0.850404 1311.18 1365.28 1.000
r(A<->C){all} 0.181000 0.023197 0.000059 0.490739 0.140454 91.91 143.18 1.006
r(A<->G){all} 0.171381 0.021104 0.000007 0.469425 0.132701 239.03 281.60 1.000
r(A<->T){all} 0.162604 0.018610 0.000091 0.435354 0.130305 125.70 163.28 1.005
r(C<->G){all} 0.168126 0.019947 0.000125 0.441893 0.129410 150.08 203.51 1.003
r(C<->T){all} 0.159770 0.019525 0.000012 0.443707 0.121128 132.20 218.94 1.000
r(G<->T){all} 0.157119 0.018060 0.000020 0.433644 0.120413 201.77 250.20 1.000
pi(A){all} 0.209931 0.000251 0.180279 0.242889 0.209687 1219.39 1330.38 1.000
pi(C){all} 0.280739 0.000294 0.246438 0.313759 0.280382 1268.20 1299.27 1.000
pi(G){all} 0.328884 0.000317 0.294117 0.362896 0.328518 1315.56 1408.28 1.000
pi(T){all} 0.180446 0.000203 0.153787 0.209039 0.180230 1080.18 1204.76 1.000
alpha{1,2} 0.419369 0.225127 0.000181 1.398486 0.250816 1026.29 1176.67 1.000
alpha{3} 0.449830 0.223991 0.000326 1.413658 0.289434 959.55 1171.41 1.001
pinvar{all} 0.997804 0.000007 0.992774 0.999999 0.998625 1304.50 1305.57 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 235
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 5 5 5 5 5 5
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 6 6 6 6 6 6 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 11 11 11 11 11 11 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 3 3 3 3 3 3 | AAG 16 16 16 16 16 16 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 7 7 7 7 7 7 | Asp GAT 7 7 7 7 7 7 | Gly GGT 6 6 6 6 6 6
GTC 10 10 10 10 10 10 | GCC 12 12 12 12 12 12 | GAC 8 8 8 8 8 8 | GGC 13 13 13 13 13 13
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 10 10 10 10 10 10 | GCG 9 9 9 9 9 9 | GAG 10 10 10 10 10 10 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908602_1_2030_MLBR_RS09630
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
#2: NC_002677_1_NP_302281_1_1153_rplA
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
#3: NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
#4: NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
#5: NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
#6: NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 30 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 54 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 30
CTC 12 | CCC 18 | CAC 12 | CGC 12
CTA 0 | CCA 18 | Gln Q CAA 6 | CGA 0
CTG 36 | CCG 24 | CAG 30 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 0
ATC 30 | ACC 66 | AAC 30 | AGC 24
ATA 12 | ACA 6 | Lys K AAA 30 | Arg R AGA 0
Met M ATG 30 | ACG 18 | AAG 96 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 42 | Asp D GAT 42 | Gly G GGT 36
GTC 60 | GCC 72 | GAC 48 | GGC 78
GTA 6 | GCA 18 | Glu E GAA 6 | GGA 6
GTG 60 | GCG 54 | GAG 60 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09787 C:0.19149 A:0.27234 G:0.43830
position 2: T:0.25957 C:0.28936 A:0.28085 G:0.17021
position 3: T:0.18298 C:0.36170 A:0.07660 G:0.37872
Average T:0.18014 C:0.28085 A:0.20993 G:0.32908
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -906.153467 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.470307 1.643930
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908602_1_2030_MLBR_RS09630: 0.000004, NC_002677_1_NP_302281_1_1153_rplA: 0.000004, NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560: 0.000004, NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890: 0.000004, NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450: 0.000004, NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.47031
omega (dN/dS) = 1.64393
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
7..2 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
7..3 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
7..4 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
7..5 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
7..6 0.000 552.8 152.2 1.6439 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -906.153463 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.771816
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908602_1_2030_MLBR_RS09630: 0.000004, NC_002677_1_NP_302281_1_1153_rplA: 0.000004, NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560: 0.000004, NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890: 0.000004, NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450: 0.000004, NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.77182 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 558.9 146.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -906.153435 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000990 0.000063 1.000000 72.214273
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908602_1_2030_MLBR_RS09630: 0.000004, NC_002677_1_NP_302281_1_1153_rplA: 0.000004, NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560: 0.000004, NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890: 0.000004, NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450: 0.000004, NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00099 0.00006 0.99895
w: 1.00000 1.00000 72.21427
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
7..2 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
7..3 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
7..4 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
7..5 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
7..6 0.000 558.9 146.1 72.1392 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908602_1_2030_MLBR_RS09630)
Pr(w>1) post mean +- SE for w
1 M 0.999** 72.139
2 S 0.999** 72.139
3 K 0.999** 72.139
4 S 0.999** 72.139
5 S 0.999** 72.139
6 K 0.999** 72.139
7 A 0.999** 72.139
8 Y 0.999** 72.139
9 R 0.999** 72.139
10 A 0.999** 72.139
11 A 0.999** 72.139
12 A 0.999** 72.139
13 V 0.999** 72.139
14 K 0.999** 72.139
15 V 0.999** 72.139
16 D 0.999** 72.139
17 R 0.999** 72.139
18 T 0.999** 72.139
19 N 0.999** 72.139
20 L 0.999** 72.139
21 Y 0.999** 72.139
22 T 0.999** 72.139
23 P 0.999** 72.139
24 L 0.999** 72.139
25 Q 0.999** 72.139
26 A 0.999** 72.139
27 A 0.999** 72.139
28 K 0.999** 72.139
29 L 0.999** 72.139
30 A 0.999** 72.139
31 K 0.999** 72.139
32 E 0.999** 72.139
33 T 0.999** 72.139
34 S 0.999** 72.139
35 S 0.999** 72.139
36 T 0.999** 72.139
37 R 0.999** 72.139
38 Q 0.999** 72.139
39 D 0.999** 72.139
40 A 0.999** 72.139
41 T 0.999** 72.139
42 V 0.999** 72.139
43 E 0.999** 72.139
44 V 0.999** 72.139
45 A 0.999** 72.139
46 I 0.999** 72.139
47 R 0.999** 72.139
48 L 0.999** 72.139
49 G 0.999** 72.139
50 V 0.999** 72.139
51 D 0.999** 72.139
52 S 0.999** 72.139
53 R 0.999** 72.139
54 K 0.999** 72.139
55 A 0.999** 72.139
56 D 0.999** 72.139
57 Q 0.999** 72.139
58 M 0.999** 72.139
59 V 0.999** 72.139
60 R 0.999** 72.139
61 G 0.999** 72.139
62 T 0.999** 72.139
63 V 0.999** 72.139
64 N 0.999** 72.139
65 L 0.999** 72.139
66 P 0.999** 72.139
67 H 0.999** 72.139
68 G 0.999** 72.139
69 T 0.999** 72.139
70 G 0.999** 72.139
71 K 0.999** 72.139
72 T 0.999** 72.139
73 A 0.999** 72.139
74 R 0.999** 72.139
75 V 0.999** 72.139
76 A 0.999** 72.139
77 V 0.999** 72.139
78 F 0.999** 72.139
79 A 0.999** 72.139
80 V 0.999** 72.139
81 G 0.999** 72.139
82 E 0.999** 72.139
83 K 0.999** 72.139
84 A 0.999** 72.139
85 D 0.999** 72.139
86 V 0.999** 72.139
87 A 0.999** 72.139
88 V 0.999** 72.139
89 A 0.999** 72.139
90 A 0.999** 72.139
91 G 0.999** 72.139
92 A 0.999** 72.139
93 D 0.999** 72.139
94 V 0.999** 72.139
95 V 0.999** 72.139
96 G 0.999** 72.139
97 S 0.999** 72.139
98 D 0.999** 72.139
99 D 0.999** 72.139
100 L 0.999** 72.139
101 I 0.999** 72.139
102 E 0.999** 72.139
103 K 0.999** 72.139
104 I 0.999** 72.139
105 Q 0.999** 72.139
106 G 0.999** 72.139
107 G 0.999** 72.139
108 W 0.999** 72.139
109 L 0.999** 72.139
110 E 0.999** 72.139
111 F 0.999** 72.139
112 D 0.999** 72.139
113 A 0.999** 72.139
114 A 0.999** 72.139
115 V 0.999** 72.139
116 A 0.999** 72.139
117 T 0.999** 72.139
118 P 0.999** 72.139
119 D 0.999** 72.139
120 Q 0.999** 72.139
121 M 0.999** 72.139
122 A 0.999** 72.139
123 K 0.999** 72.139
124 V 0.999** 72.139
125 G 0.999** 72.139
126 R 0.999** 72.139
127 I 0.999** 72.139
128 A 0.999** 72.139
129 R 0.999** 72.139
130 V 0.999** 72.139
131 L 0.999** 72.139
132 G 0.999** 72.139
133 P 0.999** 72.139
134 R 0.999** 72.139
135 G 0.999** 72.139
136 L 0.999** 72.139
137 M 0.999** 72.139
138 P 0.999** 72.139
139 N 0.999** 72.139
140 P 0.999** 72.139
141 K 0.999** 72.139
142 T 0.999** 72.139
143 G 0.999** 72.139
144 T 0.999** 72.139
145 V 0.999** 72.139
146 T 0.999** 72.139
147 P 0.999** 72.139
148 D 0.999** 72.139
149 V 0.999** 72.139
150 A 0.999** 72.139
151 K 0.999** 72.139
152 A 0.999** 72.139
153 V 0.999** 72.139
154 A 0.999** 72.139
155 D 0.999** 72.139
156 I 0.999** 72.139
157 K 0.999** 72.139
158 G 0.999** 72.139
159 G 0.999** 72.139
160 K 0.999** 72.139
161 I 0.999** 72.139
162 N 0.999** 72.139
163 F 0.999** 72.139
164 R 0.999** 72.139
165 V 0.999** 72.139
166 D 0.999** 72.139
167 K 0.999** 72.139
168 Q 0.999** 72.139
169 A 0.999** 72.139
170 N 0.999** 72.139
171 L 0.999** 72.139
172 H 0.999** 72.139
173 F 0.999** 72.139
174 V 0.999** 72.139
175 I 0.999** 72.139
176 G 0.999** 72.139
177 K 0.999** 72.139
178 A 0.999** 72.139
179 S 0.999** 72.139
180 F 0.999** 72.139
181 D 0.999** 72.139
182 E 0.999** 72.139
183 K 0.999** 72.139
184 R 0.999** 72.139
185 L 0.999** 72.139
186 A 0.999** 72.139
187 E 0.999** 72.139
188 N 0.999** 72.139
189 Y 0.999** 72.139
190 G 0.999** 72.139
191 A 0.999** 72.139
192 A 0.999** 72.139
193 L 0.999** 72.139
194 E 0.999** 72.139
195 E 0.999** 72.139
196 V 0.999** 72.139
197 L 0.999** 72.139
198 R 0.999** 72.139
199 L 0.999** 72.139
200 K 0.999** 72.139
201 P 0.999** 72.139
202 S 0.999** 72.139
203 S 0.999** 72.139
204 S 0.999** 72.139
205 K 0.999** 72.139
206 G 0.999** 72.139
207 R 0.999** 72.139
208 Y 0.999** 72.139
209 L 0.999** 72.139
210 K 0.999** 72.139
211 K 0.999** 72.139
212 V 0.999** 72.139
213 T 0.999** 72.139
214 V 0.999** 72.139
215 S 0.999** 72.139
216 T 0.999** 72.139
217 T 0.999** 72.139
218 M 0.999** 72.139
219 G 0.999** 72.139
220 P 0.999** 72.139
221 G 0.999** 72.139
222 I 0.999** 72.139
223 P 0.999** 72.139
224 V 0.999** 72.139
225 D 0.999** 72.139
226 P 0.999** 72.139
227 S 0.999** 72.139
228 I 0.999** 72.139
229 T 0.999** 72.139
230 R 0.999** 72.139
231 N 0.999** 72.139
232 F 0.999** 72.139
233 T 0.999** 72.139
234 E 0.999** 72.139
235 E 0.999** 72.139
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908602_1_2030_MLBR_RS09630)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -906.153482 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005001 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908602_1_2030_MLBR_RS09630: 0.000004, NC_002677_1_NP_302281_1_1153_rplA: 0.000004, NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560: 0.000004, NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890: 0.000004, NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450: 0.000004, NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
7..2 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
7..3 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
7..4 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
7..5 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
7..6 0.000 558.9 146.1 0.5000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -906.153435 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 5.170317 42.830317
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908602_1_2030_MLBR_RS09630: 0.000004, NC_002677_1_NP_302281_1_1153_rplA: 0.000004, NZ_LVXE01000028_1_WP_010908602_1_1142_A3216_RS08560: 0.000004, NZ_LYPH01000031_1_WP_010908602_1_1224_A8144_RS05890: 0.000004, NZ_CP029543_1_WP_010908602_1_2054_DIJ64_RS10450: 0.000004, NZ_AP014567_1_WP_010908602_1_2109_JK2ML_RS10725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 5.17032
(p1 = 0.99999) w = 42.83032
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 42.83032
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
7..2 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
7..3 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
7..4 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
7..5 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
7..6 0.000 558.9 146.1 42.8299 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908602_1_2030_MLBR_RS09630)
Pr(w>1) post mean +- SE for w
1 M 1.000** 42.830
2 S 1.000** 42.830
3 K 1.000** 42.830
4 S 1.000** 42.830
5 S 1.000** 42.830
6 K 1.000** 42.830
7 A 1.000** 42.830
8 Y 1.000** 42.830
9 R 1.000** 42.830
10 A 1.000** 42.830
11 A 1.000** 42.830
12 A 1.000** 42.830
13 V 1.000** 42.830
14 K 1.000** 42.830
15 V 1.000** 42.830
16 D 1.000** 42.830
17 R 1.000** 42.830
18 T 1.000** 42.830
19 N 1.000** 42.830
20 L 1.000** 42.830
21 Y 1.000** 42.830
22 T 1.000** 42.830
23 P 1.000** 42.830
24 L 1.000** 42.830
25 Q 1.000** 42.830
26 A 1.000** 42.830
27 A 1.000** 42.830
28 K 1.000** 42.830
29 L 1.000** 42.830
30 A 1.000** 42.830
31 K 1.000** 42.830
32 E 1.000** 42.830
33 T 1.000** 42.830
34 S 1.000** 42.830
35 S 1.000** 42.830
36 T 1.000** 42.830
37 R 1.000** 42.830
38 Q 1.000** 42.830
39 D 1.000** 42.830
40 A 1.000** 42.830
41 T 1.000** 42.830
42 V 1.000** 42.830
43 E 1.000** 42.830
44 V 1.000** 42.830
45 A 1.000** 42.830
46 I 1.000** 42.830
47 R 1.000** 42.830
48 L 1.000** 42.830
49 G 1.000** 42.830
50 V 1.000** 42.830
51 D 1.000** 42.830
52 S 1.000** 42.830
53 R 1.000** 42.830
54 K 1.000** 42.830
55 A 1.000** 42.830
56 D 1.000** 42.830
57 Q 1.000** 42.830
58 M 1.000** 42.830
59 V 1.000** 42.830
60 R 1.000** 42.830
61 G 1.000** 42.830
62 T 1.000** 42.830
63 V 1.000** 42.830
64 N 1.000** 42.830
65 L 1.000** 42.830
66 P 1.000** 42.830
67 H 1.000** 42.830
68 G 1.000** 42.830
69 T 1.000** 42.830
70 G 1.000** 42.830
71 K 1.000** 42.830
72 T 1.000** 42.830
73 A 1.000** 42.830
74 R 1.000** 42.830
75 V 1.000** 42.830
76 A 1.000** 42.830
77 V 1.000** 42.830
78 F 1.000** 42.830
79 A 1.000** 42.830
80 V 1.000** 42.830
81 G 1.000** 42.830
82 E 1.000** 42.830
83 K 1.000** 42.830
84 A 1.000** 42.830
85 D 1.000** 42.830
86 V 1.000** 42.830
87 A 1.000** 42.830
88 V 1.000** 42.830
89 A 1.000** 42.830
90 A 1.000** 42.830
91 G 1.000** 42.830
92 A 1.000** 42.830
93 D 1.000** 42.830
94 V 1.000** 42.830
95 V 1.000** 42.830
96 G 1.000** 42.830
97 S 1.000** 42.830
98 D 1.000** 42.830
99 D 1.000** 42.830
100 L 1.000** 42.830
101 I 1.000** 42.830
102 E 1.000** 42.830
103 K 1.000** 42.830
104 I 1.000** 42.830
105 Q 1.000** 42.830
106 G 1.000** 42.830
107 G 1.000** 42.830
108 W 1.000** 42.830
109 L 1.000** 42.830
110 E 1.000** 42.830
111 F 1.000** 42.830
112 D 1.000** 42.830
113 A 1.000** 42.830
114 A 1.000** 42.830
115 V 1.000** 42.830
116 A 1.000** 42.830
117 T 1.000** 42.830
118 P 1.000** 42.830
119 D 1.000** 42.830
120 Q 1.000** 42.830
121 M 1.000** 42.830
122 A 1.000** 42.830
123 K 1.000** 42.830
124 V 1.000** 42.830
125 G 1.000** 42.830
126 R 1.000** 42.830
127 I 1.000** 42.830
128 A 1.000** 42.830
129 R 1.000** 42.830
130 V 1.000** 42.830
131 L 1.000** 42.830
132 G 1.000** 42.830
133 P 1.000** 42.830
134 R 1.000** 42.830
135 G 1.000** 42.830
136 L 1.000** 42.830
137 M 1.000** 42.830
138 P 1.000** 42.830
139 N 1.000** 42.830
140 P 1.000** 42.830
141 K 1.000** 42.830
142 T 1.000** 42.830
143 G 1.000** 42.830
144 T 1.000** 42.830
145 V 1.000** 42.830
146 T 1.000** 42.830
147 P 1.000** 42.830
148 D 1.000** 42.830
149 V 1.000** 42.830
150 A 1.000** 42.830
151 K 1.000** 42.830
152 A 1.000** 42.830
153 V 1.000** 42.830
154 A 1.000** 42.830
155 D 1.000** 42.830
156 I 1.000** 42.830
157 K 1.000** 42.830
158 G 1.000** 42.830
159 G 1.000** 42.830
160 K 1.000** 42.830
161 I 1.000** 42.830
162 N 1.000** 42.830
163 F 1.000** 42.830
164 R 1.000** 42.830
165 V 1.000** 42.830
166 D 1.000** 42.830
167 K 1.000** 42.830
168 Q 1.000** 42.830
169 A 1.000** 42.830
170 N 1.000** 42.830
171 L 1.000** 42.830
172 H 1.000** 42.830
173 F 1.000** 42.830
174 V 1.000** 42.830
175 I 1.000** 42.830
176 G 1.000** 42.830
177 K 1.000** 42.830
178 A 1.000** 42.830
179 S 1.000** 42.830
180 F 1.000** 42.830
181 D 1.000** 42.830
182 E 1.000** 42.830
183 K 1.000** 42.830
184 R 1.000** 42.830
185 L 1.000** 42.830
186 A 1.000** 42.830
187 E 1.000** 42.830
188 N 1.000** 42.830
189 Y 1.000** 42.830
190 G 1.000** 42.830
191 A 1.000** 42.830
192 A 1.000** 42.830
193 L 1.000** 42.830
194 E 1.000** 42.830
195 E 1.000** 42.830
196 V 1.000** 42.830
197 L 1.000** 42.830
198 R 1.000** 42.830
199 L 1.000** 42.830
200 K 1.000** 42.830
201 P 1.000** 42.830
202 S 1.000** 42.830
203 S 1.000** 42.830
204 S 1.000** 42.830
205 K 1.000** 42.830
206 G 1.000** 42.830
207 R 1.000** 42.830
208 Y 1.000** 42.830
209 L 1.000** 42.830
210 K 1.000** 42.830
211 K 1.000** 42.830
212 V 1.000** 42.830
213 T 1.000** 42.830
214 V 1.000** 42.830
215 S 1.000** 42.830
216 T 1.000** 42.830
217 T 1.000** 42.830
218 M 1.000** 42.830
219 G 1.000** 42.830
220 P 1.000** 42.830
221 G 1.000** 42.830
222 I 1.000** 42.830
223 P 1.000** 42.830
224 V 1.000** 42.830
225 D 1.000** 42.830
226 P 1.000** 42.830
227 S 1.000** 42.830
228 I 1.000** 42.830
229 T 1.000** 42.830
230 R 1.000** 42.830
231 N 1.000** 42.830
232 F 1.000** 42.830
233 T 1.000** 42.830
234 E 1.000** 42.830
235 E 1.000** 42.830
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908602_1_2030_MLBR_RS09630)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -906.153463 Model 2: PositiveSelection -906.153435 Model 0: one-ratio -906.153467 Model 7: beta -906.153482 Model 8: beta&w>1 -906.153435 Model 0 vs 1 7.999999979801942E-6 Model 2 vs 1 5.600000008598727E-5 Model 8 vs 7 9.400000021742017E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
