--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:31:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1142.67 -1146.93
2 -1142.59 -1145.54
--------------------------------------
TOTAL -1142.63 -1146.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902623 0.092882 0.338260 1.481872 0.866229 1491.17 1496.09 1.000
r(A<->C){all} 0.166079 0.017745 0.000070 0.424695 0.133625 160.21 213.93 1.003
r(A<->G){all} 0.165586 0.020117 0.000084 0.454654 0.127678 181.04 252.45 1.000
r(A<->T){all} 0.168173 0.019518 0.000097 0.448653 0.130654 239.10 265.06 1.002
r(C<->G){all} 0.163814 0.019007 0.000004 0.438611 0.131341 254.10 286.63 1.000
r(C<->T){all} 0.161809 0.018535 0.000015 0.446895 0.126397 175.45 226.66 1.000
r(G<->T){all} 0.174540 0.021992 0.000067 0.480947 0.134218 171.30 175.13 1.000
pi(A){all} 0.210318 0.000190 0.182302 0.236827 0.209865 1405.05 1418.04 1.000
pi(C){all} 0.296409 0.000244 0.264128 0.325182 0.296460 1106.65 1126.28 1.000
pi(G){all} 0.316621 0.000251 0.287801 0.349513 0.316308 1219.62 1228.95 1.000
pi(T){all} 0.176653 0.000171 0.151377 0.201796 0.176510 1249.10 1323.81 1.000
alpha{1,2} 0.427800 0.235244 0.000102 1.418501 0.252252 1282.42 1299.71 1.000
alpha{3} 0.462521 0.246342 0.000342 1.436230 0.304922 949.34 1016.57 1.004
pinvar{all} 0.998160 0.000005 0.994026 0.999998 0.998861 981.81 1147.55 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1102.306969
Model 2: PositiveSelection -1102.306926
Model 0: one-ratio -1102.306957
Model 7: beta -1102.306969
Model 8: beta&w>1 -1102.306928
Model 0 vs 1 2.3999999939405825E-5
Model 2 vs 1 8.600000001024455E-5
Model 8 vs 7 8.200000002034358E-5
>C1
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C2
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C3
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C4
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C5
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C6
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=280
C1 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C2 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C3 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C4 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C5 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C6 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
**************************************************
C1 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C2 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C3 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C4 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C5 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C6 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
**************************************************
C1 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C2 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C3 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C4 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C5 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C6 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
**************************************************
C1 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C2 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C3 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C4 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C5 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C6 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
**************************************************
C1 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C2 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C3 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C4 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C5 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C6 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
**************************************************
C1 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C2 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C3 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C4 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C5 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C6 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 280 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 280 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8400]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8400]--->[8400]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.486 Mb, Max= 30.823 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C2 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C3 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C4 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C5 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C6 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
**************************************************
C1 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C2 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C3 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C4 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C5 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C6 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
**************************************************
C1 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C2 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C3 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C4 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C5 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C6 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
**************************************************
C1 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C2 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C3 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C4 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C5 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C6 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
**************************************************
C1 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C2 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C3 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C4 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C5 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C6 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
**************************************************
C1 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C2 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C3 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C4 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C5 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C6 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C2 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C3 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C4 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C5 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C6 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
**************************************************
C1 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C2 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C3 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C4 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C5 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C6 TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
**************************************************
C1 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C2 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C3 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C4 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C5 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C6 TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
**************************************************
C1 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C2 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C3 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C4 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C5 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C6 ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
**************************************************
C1 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C2 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C3 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C4 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C5 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C6 CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
**************************************************
C1 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C2 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C3 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C4 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C5 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C6 ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
**************************************************
C1 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C2 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C3 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C4 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C5 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C6 AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
**************************************************
C1 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C2 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C3 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C4 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C5 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C6 GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
**************************************************
C1 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C2 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C3 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C4 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C5 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C6 GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
**************************************************
C1 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C2 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C3 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C4 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C5 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C6 GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
**************************************************
C1 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C2 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C3 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C4 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C5 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C6 CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
**************************************************
C1 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C2 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C3 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C4 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C5 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C6 GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
**************************************************
C1 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C2 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C3 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C4 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C5 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C6 CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
**************************************************
C1 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C2 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C3 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C4 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C5 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C6 GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
**************************************************
C1 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C2 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C3 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C4 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C5 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C6 GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
**************************************************
C1 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C2 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C3 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C4 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C5 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C6 GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
**************************************************
C1 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C2 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C3 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C4 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C5 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C6 GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
****************************************
>C1
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C2
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C3
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C4
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C5
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C6
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C1
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C2
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C3
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C4
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C5
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C6
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 840 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789808
Setting output file names to "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 777945979
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0088792756
Seed = 897400566
Swapseed = 1579789808
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1879.960164 -- -24.965149
Chain 2 -- -1879.960164 -- -24.965149
Chain 3 -- -1879.960272 -- -24.965149
Chain 4 -- -1879.959985 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1879.960164 -- -24.965149
Chain 2 -- -1879.960272 -- -24.965149
Chain 3 -- -1879.960272 -- -24.965149
Chain 4 -- -1879.960164 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1879.960] (-1879.960) (-1879.960) (-1879.960) * [-1879.960] (-1879.960) (-1879.960) (-1879.960)
500 -- (-1150.988) (-1172.122) (-1173.775) [-1147.481] * (-1157.932) (-1148.809) (-1153.168) [-1148.545] -- 0:00:00
1000 -- [-1150.330] (-1157.000) (-1153.497) (-1149.381) * (-1156.759) [-1152.448] (-1156.350) (-1150.646) -- 0:00:00
1500 -- (-1152.290) (-1158.000) (-1148.256) [-1146.663] * (-1157.168) (-1155.100) (-1153.019) [-1147.240] -- 0:00:00
2000 -- (-1150.104) (-1155.409) (-1161.637) [-1150.748] * (-1154.671) (-1148.812) (-1147.650) [-1151.605] -- 0:00:00
2500 -- (-1151.616) [-1156.785] (-1157.752) (-1147.084) * (-1150.198) (-1149.082) [-1155.992] (-1151.955) -- 0:06:39
3000 -- (-1156.528) (-1151.409) (-1153.041) [-1150.852] * [-1148.597] (-1151.729) (-1152.617) (-1155.115) -- 0:05:32
3500 -- (-1154.965) (-1159.063) [-1147.847] (-1152.780) * [-1156.825] (-1155.039) (-1153.657) (-1159.635) -- 0:04:44
4000 -- (-1156.129) (-1162.152) (-1149.068) [-1152.879] * (-1150.087) (-1152.751) [-1150.729] (-1153.206) -- 0:04:09
4500 -- (-1151.256) (-1153.466) [-1149.844] (-1151.324) * (-1150.832) (-1153.017) [-1149.523] (-1154.201) -- 0:03:41
5000 -- (-1153.903) (-1156.067) (-1151.679) [-1150.263] * (-1148.572) (-1159.249) [-1155.046] (-1152.877) -- 0:03:19
Average standard deviation of split frequencies: 0.109311
5500 -- (-1156.488) (-1154.987) [-1147.840] (-1157.133) * (-1155.280) (-1148.310) (-1160.432) [-1151.250] -- 0:03:00
6000 -- (-1158.802) [-1149.742] (-1150.066) (-1162.448) * (-1149.463) (-1150.788) [-1152.929] (-1159.810) -- 0:02:45
6500 -- (-1157.171) (-1154.362) (-1149.221) [-1156.118] * [-1160.679] (-1151.716) (-1153.730) (-1151.754) -- 0:02:32
7000 -- (-1155.263) (-1157.910) [-1155.391] (-1150.003) * (-1153.065) [-1154.349] (-1147.986) (-1149.215) -- 0:02:21
7500 -- (-1146.875) [-1151.785] (-1151.690) (-1154.176) * (-1152.966) [-1155.200] (-1156.552) (-1151.336) -- 0:02:12
8000 -- (-1148.482) (-1154.056) [-1147.594] (-1158.692) * (-1153.916) (-1154.371) (-1153.960) [-1150.329] -- 0:02:04
8500 -- (-1150.910) (-1150.861) [-1151.798] (-1159.614) * (-1160.882) (-1149.460) [-1149.182] (-1150.723) -- 0:01:56
9000 -- (-1160.473) [-1154.525] (-1151.690) (-1148.874) * [-1153.823] (-1148.778) (-1156.887) (-1149.505) -- 0:01:50
9500 -- (-1151.525) (-1151.134) [-1150.651] (-1156.770) * (-1153.268) [-1155.783] (-1148.180) (-1152.165) -- 0:01:44
10000 -- (-1154.864) (-1159.465) [-1157.950] (-1155.724) * [-1146.737] (-1150.920) (-1152.693) (-1149.623) -- 0:01:39
Average standard deviation of split frequencies: 0.081759
10500 -- (-1150.954) [-1150.823] (-1152.962) (-1157.614) * (-1158.373) (-1156.587) (-1150.046) [-1153.378] -- 0:01:34
11000 -- (-1158.572) [-1149.786] (-1159.316) (-1149.155) * [-1152.677] (-1156.116) (-1150.109) (-1156.710) -- 0:01:29
11500 -- (-1153.346) (-1151.441) [-1152.712] (-1155.562) * [-1151.178] (-1153.061) (-1154.309) (-1153.853) -- 0:01:25
12000 -- (-1153.595) [-1147.710] (-1148.697) (-1149.495) * (-1167.423) (-1162.870) [-1150.883] (-1151.074) -- 0:01:22
12500 -- (-1156.412) [-1150.543] (-1157.880) (-1147.472) * (-1151.685) [-1148.239] (-1161.816) (-1156.665) -- 0:01:19
13000 -- (-1162.624) (-1154.337) (-1150.429) [-1146.701] * (-1151.992) (-1148.949) (-1148.023) [-1152.629] -- 0:01:15
13500 -- (-1153.702) [-1151.280] (-1156.044) (-1143.063) * (-1154.500) [-1152.201] (-1144.798) (-1153.581) -- 0:01:13
14000 -- (-1147.795) (-1148.526) (-1153.568) [-1142.588] * [-1148.914] (-1155.557) (-1158.867) (-1152.498) -- 0:01:10
14500 -- (-1151.599) (-1146.511) [-1147.224] (-1146.192) * (-1154.220) [-1153.292] (-1154.351) (-1154.641) -- 0:01:07
15000 -- (-1153.998) [-1148.458] (-1152.907) (-1144.531) * (-1154.859) [-1159.100] (-1148.757) (-1156.992) -- 0:01:05
Average standard deviation of split frequencies: 0.062027
15500 -- (-1159.612) [-1153.032] (-1148.907) (-1144.353) * (-1160.621) (-1152.334) [-1148.384] (-1155.625) -- 0:01:03
16000 -- [-1157.325] (-1152.756) (-1154.788) (-1143.977) * (-1157.444) [-1148.666] (-1152.313) (-1159.375) -- 0:01:01
16500 -- [-1153.976] (-1149.661) (-1157.864) (-1146.367) * [-1144.644] (-1155.393) (-1154.274) (-1152.126) -- 0:00:59
17000 -- (-1157.910) [-1154.575] (-1154.368) (-1144.190) * [-1144.424] (-1153.134) (-1151.713) (-1166.840) -- 0:00:57
17500 -- (-1164.712) [-1154.874] (-1154.745) (-1144.306) * (-1148.128) (-1152.492) [-1154.371] (-1151.345) -- 0:00:56
18000 -- (-1152.047) (-1158.848) (-1148.091) [-1143.013] * (-1143.877) [-1151.816] (-1156.996) (-1150.329) -- 0:01:49
18500 -- (-1148.893) (-1152.373) [-1148.347] (-1142.040) * (-1143.000) (-1152.615) [-1148.754] (-1146.362) -- 0:01:46
19000 -- [-1154.008] (-1149.967) (-1146.468) (-1145.743) * (-1142.837) (-1154.177) [-1148.006] (-1156.815) -- 0:01:43
19500 -- (-1146.823) (-1150.719) (-1152.362) [-1144.163] * [-1145.356] (-1152.389) (-1156.461) (-1147.448) -- 0:01:40
20000 -- (-1144.277) [-1150.932] (-1146.793) (-1144.778) * (-1146.424) (-1149.870) [-1163.301] (-1142.529) -- 0:01:38
Average standard deviation of split frequencies: 0.053670
20500 -- (-1143.296) (-1154.482) [-1145.534] (-1144.714) * (-1143.687) (-1154.164) [-1150.854] (-1141.860) -- 0:01:35
21000 -- (-1142.858) [-1155.306] (-1151.919) (-1143.452) * [-1143.965] (-1155.405) (-1150.815) (-1142.238) -- 0:01:33
21500 -- [-1142.534] (-1175.170) (-1151.741) (-1142.650) * (-1146.359) (-1150.380) (-1159.341) [-1142.633] -- 0:01:31
22000 -- [-1142.737] (-1148.792) (-1148.017) (-1141.504) * (-1142.894) (-1154.225) (-1151.798) [-1145.802] -- 0:01:28
22500 -- (-1141.576) [-1143.970] (-1154.659) (-1143.228) * (-1143.351) (-1150.400) [-1152.135] (-1147.148) -- 0:01:26
23000 -- (-1143.511) (-1145.881) (-1154.277) [-1141.673] * [-1141.064] (-1150.238) (-1156.391) (-1143.218) -- 0:01:24
23500 -- (-1141.972) [-1143.606] (-1156.193) (-1142.176) * [-1141.009] (-1150.196) (-1154.089) (-1146.091) -- 0:01:23
24000 -- (-1142.712) (-1143.926) [-1149.058] (-1142.537) * (-1141.585) [-1152.479] (-1155.947) (-1142.559) -- 0:01:21
24500 -- (-1142.895) (-1144.938) (-1148.904) [-1141.896] * (-1142.178) (-1155.426) [-1151.655] (-1141.909) -- 0:01:19
25000 -- [-1143.895] (-1145.398) (-1153.594) (-1142.058) * [-1142.071] (-1156.735) (-1152.862) (-1143.962) -- 0:01:18
Average standard deviation of split frequencies: 0.053486
25500 -- (-1143.065) (-1146.398) (-1160.124) [-1142.059] * [-1141.210] (-1148.731) (-1146.236) (-1146.464) -- 0:01:16
26000 -- (-1146.064) [-1142.361] (-1154.746) (-1145.487) * [-1141.330] (-1154.364) (-1154.072) (-1146.372) -- 0:01:14
26500 -- (-1145.799) (-1142.022) [-1150.508] (-1145.860) * (-1141.393) (-1157.873) [-1147.274] (-1144.902) -- 0:01:13
27000 -- (-1145.277) (-1143.908) (-1153.705) [-1146.904] * (-1141.793) (-1158.197) (-1161.479) [-1142.025] -- 0:01:12
27500 -- (-1144.104) (-1142.786) [-1147.977] (-1146.185) * (-1142.824) (-1148.718) (-1146.776) [-1141.893] -- 0:01:10
28000 -- (-1146.084) [-1143.303] (-1149.015) (-1143.031) * [-1141.842] (-1164.546) (-1153.705) (-1146.894) -- 0:01:09
28500 -- [-1144.929] (-1141.639) (-1154.398) (-1142.334) * [-1141.662] (-1150.519) (-1161.331) (-1143.916) -- 0:01:08
29000 -- (-1142.820) [-1141.845] (-1152.047) (-1142.975) * [-1144.789] (-1150.508) (-1152.872) (-1144.859) -- 0:01:06
29500 -- (-1145.279) [-1141.518] (-1160.866) (-1143.013) * (-1142.936) (-1150.491) (-1146.152) [-1144.183] -- 0:01:05
30000 -- (-1143.488) (-1144.305) [-1150.650] (-1143.153) * (-1142.179) (-1151.055) [-1142.419] (-1143.799) -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- (-1145.153) (-1144.446) (-1155.788) [-1143.948] * (-1142.791) (-1150.298) (-1142.014) [-1141.644] -- 0:01:03
31000 -- (-1141.758) [-1144.114] (-1156.005) (-1143.120) * (-1142.443) (-1159.827) [-1143.918] (-1142.258) -- 0:01:02
31500 -- (-1142.318) [-1141.411] (-1149.488) (-1144.651) * (-1144.982) [-1148.206] (-1146.192) (-1144.672) -- 0:01:01
32000 -- (-1145.159) (-1141.377) [-1150.781] (-1143.286) * (-1142.279) [-1152.635] (-1146.989) (-1142.198) -- 0:01:00
32500 -- [-1144.376] (-1143.950) (-1153.585) (-1143.153) * (-1142.638) (-1154.202) [-1145.379] (-1142.892) -- 0:00:59
33000 -- (-1145.298) (-1141.605) [-1149.821] (-1144.126) * (-1142.359) [-1150.661] (-1143.587) (-1142.147) -- 0:00:58
33500 -- (-1142.141) (-1141.900) [-1151.824] (-1142.448) * (-1143.376) (-1149.817) (-1145.304) [-1142.288] -- 0:00:57
34000 -- (-1145.416) (-1142.479) [-1149.117] (-1143.857) * [-1142.226] (-1147.604) (-1141.496) (-1143.427) -- 0:01:25
34500 -- (-1144.935) (-1144.278) [-1147.927] (-1144.832) * (-1144.040) (-1163.118) (-1142.391) [-1142.418] -- 0:01:23
35000 -- [-1141.765] (-1146.528) (-1149.445) (-1148.071) * (-1145.343) (-1154.200) [-1142.732] (-1145.512) -- 0:01:22
Average standard deviation of split frequencies: 0.043419
35500 -- (-1145.925) (-1146.055) [-1152.987] (-1144.687) * (-1144.502) (-1154.876) [-1144.598] (-1142.515) -- 0:01:21
36000 -- (-1153.764) (-1145.476) (-1152.673) [-1143.579] * (-1144.414) (-1160.618) [-1146.171] (-1141.888) -- 0:01:20
36500 -- (-1142.313) [-1144.014] (-1155.310) (-1143.174) * (-1144.544) (-1156.516) [-1142.370] (-1141.080) -- 0:01:19
37000 -- [-1141.909] (-1142.846) (-1149.306) (-1146.098) * (-1144.927) (-1156.340) (-1141.339) [-1141.647] -- 0:01:18
37500 -- (-1143.558) (-1142.208) [-1152.236] (-1143.414) * [-1145.056] (-1153.313) (-1145.280) (-1143.082) -- 0:01:17
38000 -- (-1148.072) (-1141.461) [-1149.283] (-1142.995) * [-1142.313] (-1149.240) (-1144.177) (-1144.088) -- 0:01:15
38500 -- [-1146.471] (-1142.123) (-1149.136) (-1141.498) * (-1144.946) (-1149.901) (-1144.326) [-1141.352] -- 0:01:14
39000 -- (-1142.028) [-1142.460] (-1155.160) (-1143.852) * (-1143.384) (-1159.033) [-1145.438] (-1141.462) -- 0:01:13
39500 -- (-1142.028) (-1143.220) [-1151.470] (-1144.706) * (-1142.967) (-1153.345) (-1142.982) [-1141.327] -- 0:01:12
40000 -- (-1144.591) [-1142.390] (-1154.100) (-1149.421) * [-1143.696] (-1156.304) (-1142.010) (-1143.518) -- 0:01:12
Average standard deviation of split frequencies: 0.032335
40500 -- (-1142.268) (-1147.432) [-1150.115] (-1145.127) * (-1141.768) (-1151.440) [-1145.119] (-1143.188) -- 0:01:11
41000 -- (-1143.817) (-1143.896) [-1148.305] (-1144.151) * (-1145.716) [-1147.340] (-1143.251) (-1143.468) -- 0:01:10
41500 -- [-1143.806] (-1143.367) (-1161.314) (-1143.247) * [-1143.553] (-1152.542) (-1142.522) (-1142.438) -- 0:01:09
42000 -- (-1142.673) (-1142.444) (-1159.143) [-1142.737] * [-1145.666] (-1152.269) (-1142.800) (-1142.044) -- 0:01:08
42500 -- (-1142.118) (-1145.014) (-1161.637) [-1143.490] * [-1142.699] (-1155.046) (-1144.002) (-1144.727) -- 0:01:07
43000 -- (-1143.352) (-1145.297) [-1152.651] (-1146.162) * (-1144.694) [-1146.651] (-1145.930) (-1144.750) -- 0:01:06
43500 -- (-1144.921) (-1146.447) [-1154.936] (-1143.344) * (-1144.501) (-1151.865) (-1143.067) [-1143.696] -- 0:01:05
44000 -- (-1142.354) (-1145.107) [-1146.093] (-1147.170) * [-1147.044] (-1160.665) (-1143.453) (-1143.129) -- 0:01:05
44500 -- (-1142.354) [-1148.368] (-1153.076) (-1145.904) * [-1143.128] (-1152.846) (-1144.658) (-1143.649) -- 0:01:04
45000 -- (-1145.698) (-1146.137) (-1157.411) [-1148.496] * (-1145.157) (-1150.433) (-1143.705) [-1143.586] -- 0:01:03
Average standard deviation of split frequencies: 0.024222
45500 -- [-1142.974] (-1145.375) (-1152.510) (-1142.714) * (-1144.809) (-1160.208) [-1142.606] (-1143.338) -- 0:01:02
46000 -- (-1144.741) [-1145.203] (-1154.525) (-1142.880) * [-1146.180] (-1154.004) (-1142.476) (-1144.484) -- 0:01:02
46500 -- (-1142.755) (-1147.307) [-1159.686] (-1142.970) * (-1145.779) [-1151.393] (-1146.927) (-1143.907) -- 0:01:01
47000 -- (-1144.336) (-1147.225) [-1153.197] (-1143.339) * (-1147.180) (-1157.654) (-1144.998) [-1143.259] -- 0:01:00
47500 -- (-1142.539) (-1145.949) [-1143.581] (-1141.879) * (-1148.353) [-1148.907] (-1143.294) (-1146.280) -- 0:01:00
48000 -- (-1142.699) (-1150.005) (-1143.988) [-1143.008] * [-1144.059] (-1155.721) (-1142.513) (-1143.381) -- 0:00:59
48500 -- (-1144.466) (-1143.371) [-1142.659] (-1142.148) * [-1143.490] (-1151.250) (-1143.881) (-1141.321) -- 0:00:58
49000 -- (-1142.160) (-1143.025) [-1143.180] (-1142.828) * (-1145.098) (-1150.460) (-1142.975) [-1141.520] -- 0:00:58
49500 -- (-1142.234) [-1142.106] (-1145.018) (-1142.828) * [-1146.581] (-1154.685) (-1143.795) (-1141.238) -- 0:00:57
50000 -- (-1142.676) (-1141.868) (-1147.067) [-1141.950] * (-1145.915) (-1152.795) (-1142.809) [-1141.260] -- 0:01:16
Average standard deviation of split frequencies: 0.024811
50500 -- (-1143.850) (-1141.461) (-1145.386) [-1141.969] * (-1143.497) (-1152.385) [-1143.317] (-1142.618) -- 0:01:15
51000 -- (-1144.470) (-1143.813) (-1146.915) [-1143.882] * (-1143.422) (-1151.074) [-1147.497] (-1143.359) -- 0:01:14
51500 -- (-1142.561) [-1142.159] (-1146.895) (-1143.895) * [-1143.449] (-1152.262) (-1145.843) (-1141.804) -- 0:01:13
52000 -- (-1143.961) (-1141.264) (-1145.705) [-1142.680] * (-1144.310) [-1148.334] (-1144.103) (-1141.793) -- 0:01:12
52500 -- (-1142.647) [-1141.664] (-1145.904) (-1143.113) * (-1142.937) [-1159.166] (-1142.316) (-1143.733) -- 0:01:12
53000 -- (-1144.280) (-1142.961) (-1143.599) [-1141.522] * [-1141.817] (-1155.859) (-1141.655) (-1142.853) -- 0:01:11
53500 -- (-1144.146) (-1141.623) [-1143.703] (-1142.971) * (-1141.561) (-1154.160) [-1144.384] (-1145.958) -- 0:01:10
54000 -- (-1144.929) [-1141.440] (-1144.299) (-1142.262) * (-1143.605) [-1149.031] (-1143.176) (-1144.567) -- 0:01:10
54500 -- (-1141.823) (-1146.362) (-1143.305) [-1143.214] * [-1146.775] (-1152.664) (-1142.557) (-1141.829) -- 0:01:09
55000 -- (-1142.184) [-1142.300] (-1143.526) (-1142.932) * (-1144.368) [-1150.011] (-1143.790) (-1144.218) -- 0:01:08
Average standard deviation of split frequencies: 0.023482
55500 -- (-1147.778) (-1141.417) (-1144.500) [-1142.612] * (-1144.671) [-1148.399] (-1141.207) (-1145.628) -- 0:01:08
56000 -- (-1143.891) [-1141.324] (-1147.701) (-1146.383) * (-1145.513) [-1149.110] (-1142.364) (-1143.960) -- 0:01:07
56500 -- [-1144.204] (-1142.409) (-1147.813) (-1145.847) * (-1143.799) (-1158.298) [-1142.905] (-1143.035) -- 0:01:06
57000 -- (-1145.663) (-1142.265) [-1147.827] (-1144.147) * (-1143.525) [-1148.121] (-1143.700) (-1141.368) -- 0:01:06
57500 -- [-1141.690] (-1142.199) (-1146.272) (-1143.026) * [-1144.539] (-1156.330) (-1143.414) (-1142.129) -- 0:01:05
58000 -- (-1143.648) [-1144.127] (-1146.213) (-1142.020) * [-1145.135] (-1164.060) (-1143.775) (-1143.292) -- 0:01:04
58500 -- (-1141.868) (-1141.509) (-1144.997) [-1142.313] * (-1144.159) (-1151.890) [-1142.510] (-1148.318) -- 0:01:04
59000 -- (-1141.905) (-1143.891) (-1146.945) [-1144.101] * (-1146.780) (-1158.850) [-1144.004] (-1148.097) -- 0:01:03
59500 -- (-1142.720) [-1143.637] (-1149.510) (-1142.424) * (-1144.066) [-1147.063] (-1142.927) (-1146.700) -- 0:01:03
60000 -- [-1142.060] (-1146.324) (-1146.912) (-1142.111) * (-1143.660) [-1152.800] (-1142.705) (-1143.435) -- 0:01:02
Average standard deviation of split frequencies: 0.024947
60500 -- (-1142.696) (-1145.946) (-1142.409) [-1141.942] * (-1143.819) (-1146.772) [-1141.791] (-1143.324) -- 0:01:02
61000 -- (-1142.733) (-1147.539) (-1145.539) [-1142.316] * (-1145.660) (-1154.459) (-1141.126) [-1143.120] -- 0:01:01
61500 -- (-1141.802) (-1146.315) (-1151.262) [-1147.693] * (-1143.058) [-1147.059] (-1143.643) (-1147.497) -- 0:01:01
62000 -- (-1141.152) [-1148.173] (-1146.537) (-1144.516) * [-1145.317] (-1149.557) (-1145.164) (-1145.602) -- 0:01:00
62500 -- (-1141.856) [-1143.231] (-1144.506) (-1144.677) * (-1142.737) [-1149.585] (-1143.744) (-1145.387) -- 0:01:00
63000 -- (-1144.003) [-1143.093] (-1142.706) (-1144.538) * (-1142.945) [-1149.493] (-1145.310) (-1142.459) -- 0:00:59
63500 -- [-1143.795] (-1143.265) (-1142.397) (-1142.755) * (-1144.349) (-1155.044) [-1147.626] (-1143.780) -- 0:00:58
64000 -- (-1143.503) (-1146.230) (-1146.189) [-1143.647] * (-1145.860) (-1157.701) (-1145.813) [-1143.235] -- 0:00:58
64500 -- [-1142.564] (-1142.641) (-1146.279) (-1146.141) * (-1145.731) [-1151.983] (-1146.161) (-1143.813) -- 0:00:58
65000 -- [-1142.337] (-1141.583) (-1144.977) (-1144.804) * (-1143.257) (-1158.590) [-1148.568] (-1142.850) -- 0:00:57
Average standard deviation of split frequencies: 0.021752
65500 -- (-1144.659) [-1145.679] (-1142.900) (-1145.762) * [-1141.360] (-1164.285) (-1150.076) (-1146.563) -- 0:00:57
66000 -- (-1145.614) (-1141.791) (-1142.090) [-1145.525] * (-1143.386) (-1151.743) (-1145.171) [-1141.290] -- 0:01:10
66500 -- (-1145.440) [-1141.606] (-1143.060) (-1146.169) * (-1146.532) [-1156.174] (-1144.843) (-1142.469) -- 0:01:10
67000 -- (-1144.785) [-1142.640] (-1144.331) (-1144.077) * (-1142.755) (-1152.936) [-1142.845] (-1144.577) -- 0:01:09
67500 -- [-1142.569] (-1143.179) (-1144.173) (-1144.024) * (-1143.104) (-1161.917) [-1142.477] (-1142.551) -- 0:01:09
68000 -- (-1149.218) [-1144.163] (-1142.278) (-1143.243) * (-1143.709) (-1154.160) [-1142.291] (-1143.296) -- 0:01:08
68500 -- (-1148.558) (-1144.167) [-1141.241] (-1147.168) * (-1142.436) (-1147.339) (-1141.919) [-1144.614] -- 0:01:07
69000 -- [-1145.985] (-1143.982) (-1143.786) (-1148.113) * (-1144.634) [-1145.603] (-1143.818) (-1141.436) -- 0:01:07
69500 -- [-1142.671] (-1142.063) (-1141.927) (-1142.661) * [-1141.842] (-1153.191) (-1148.573) (-1144.326) -- 0:01:06
70000 -- (-1144.068) (-1141.723) (-1141.231) [-1143.269] * [-1141.667] (-1154.409) (-1146.074) (-1141.392) -- 0:01:06
Average standard deviation of split frequencies: 0.024682
70500 -- [-1144.383] (-1142.211) (-1144.889) (-1143.849) * [-1142.501] (-1151.652) (-1143.688) (-1143.195) -- 0:01:05
71000 -- (-1143.587) (-1141.874) [-1142.264] (-1141.916) * (-1141.240) [-1151.831] (-1145.169) (-1142.444) -- 0:01:05
71500 -- (-1142.991) (-1141.874) [-1147.968] (-1141.614) * (-1141.173) (-1151.439) [-1142.617] (-1143.517) -- 0:01:04
72000 -- (-1145.889) (-1142.602) (-1142.331) [-1141.578] * [-1146.145] (-1153.537) (-1142.588) (-1143.114) -- 0:01:04
72500 -- [-1142.288] (-1141.601) (-1143.635) (-1142.131) * (-1142.533) (-1148.084) [-1145.579] (-1143.114) -- 0:01:03
73000 -- (-1142.588) (-1141.173) (-1144.087) [-1143.193] * (-1143.209) (-1148.321) (-1142.598) [-1142.580] -- 0:01:03
73500 -- (-1142.171) (-1141.996) (-1146.092) [-1142.617] * (-1143.785) (-1159.627) [-1142.887] (-1140.985) -- 0:01:03
74000 -- (-1145.097) (-1143.713) [-1142.325] (-1145.584) * (-1142.518) [-1149.385] (-1146.155) (-1140.959) -- 0:01:02
74500 -- (-1143.204) (-1143.123) [-1145.390] (-1146.335) * [-1143.633] (-1152.597) (-1141.779) (-1142.753) -- 0:01:02
75000 -- (-1143.266) (-1141.742) (-1147.947) [-1144.249] * (-1144.067) (-1164.824) [-1141.390] (-1142.561) -- 0:01:01
Average standard deviation of split frequencies: 0.017149
75500 -- (-1142.624) [-1141.418] (-1144.911) (-1142.512) * (-1141.205) (-1159.903) [-1142.396] (-1142.696) -- 0:01:01
76000 -- (-1141.823) (-1143.806) (-1144.606) [-1141.985] * [-1144.918] (-1154.895) (-1146.663) (-1141.688) -- 0:01:00
76500 -- (-1151.737) (-1143.877) (-1144.830) [-1143.637] * (-1143.861) [-1149.385] (-1143.386) (-1141.946) -- 0:01:00
77000 -- (-1145.171) [-1143.134] (-1148.831) (-1145.498) * (-1144.759) [-1154.398] (-1142.650) (-1142.414) -- 0:00:59
77500 -- (-1144.425) (-1141.300) (-1144.748) [-1142.756] * (-1147.125) (-1154.265) (-1141.363) [-1141.394] -- 0:00:59
78000 -- (-1144.756) (-1142.618) (-1142.319) [-1144.236] * (-1142.910) [-1156.950] (-1142.831) (-1143.870) -- 0:00:59
78500 -- (-1143.820) [-1142.657] (-1145.399) (-1142.136) * (-1144.300) (-1155.098) [-1145.089] (-1145.431) -- 0:00:58
79000 -- [-1144.385] (-1144.820) (-1144.819) (-1143.735) * [-1144.352] (-1149.853) (-1143.133) (-1142.661) -- 0:00:58
79500 -- (-1146.174) (-1144.074) (-1142.954) [-1144.620] * [-1142.898] (-1156.696) (-1142.106) (-1142.572) -- 0:00:57
80000 -- [-1143.232] (-1145.572) (-1147.025) (-1144.023) * (-1149.282) [-1154.073] (-1143.522) (-1143.282) -- 0:00:57
Average standard deviation of split frequencies: 0.014782
80500 -- (-1141.938) [-1142.635] (-1142.073) (-1141.865) * [-1143.516] (-1161.004) (-1142.394) (-1141.633) -- 0:00:57
81000 -- (-1142.383) [-1142.095] (-1142.412) (-1143.328) * (-1144.139) [-1150.397] (-1142.934) (-1142.702) -- 0:00:56
81500 -- (-1142.336) (-1142.752) (-1143.120) [-1143.879] * (-1143.007) (-1151.556) [-1143.669] (-1144.072) -- 0:00:56
82000 -- (-1145.099) [-1142.646] (-1141.612) (-1144.466) * (-1143.088) [-1151.139] (-1145.526) (-1144.654) -- 0:00:55
82500 -- (-1144.951) (-1142.423) (-1145.446) [-1142.405] * (-1146.793) (-1154.083) (-1144.858) [-1145.843] -- 0:01:06
83000 -- [-1141.763] (-1141.446) (-1142.669) (-1142.128) * (-1152.509) (-1161.785) [-1147.090] (-1144.698) -- 0:01:06
83500 -- (-1143.678) (-1142.694) [-1142.863] (-1142.356) * [-1142.718] (-1159.203) (-1143.964) (-1144.640) -- 0:01:05
84000 -- (-1144.984) (-1142.213) (-1143.340) [-1145.178] * [-1143.373] (-1153.373) (-1144.000) (-1143.859) -- 0:01:05
84500 -- (-1149.127) (-1142.458) (-1143.340) [-1143.648] * [-1141.502] (-1151.438) (-1143.956) (-1144.537) -- 0:01:05
85000 -- (-1146.707) (-1143.820) [-1141.818] (-1143.329) * (-1142.094) (-1154.462) (-1143.282) [-1145.724] -- 0:01:04
Average standard deviation of split frequencies: 0.014617
85500 -- (-1145.269) (-1144.216) [-1141.370] (-1144.831) * [-1143.783] (-1161.987) (-1143.979) (-1143.454) -- 0:01:04
86000 -- [-1144.656] (-1142.013) (-1142.341) (-1142.129) * [-1143.643] (-1155.408) (-1141.879) (-1145.428) -- 0:01:03
86500 -- (-1144.035) [-1142.017] (-1142.231) (-1146.325) * (-1142.915) [-1148.223] (-1144.544) (-1142.246) -- 0:01:03
87000 -- (-1142.727) (-1142.266) [-1142.690] (-1147.669) * (-1144.428) (-1156.166) (-1142.768) [-1143.048] -- 0:01:02
87500 -- [-1143.599] (-1143.617) (-1144.727) (-1143.705) * [-1144.645] (-1157.992) (-1146.357) (-1142.304) -- 0:01:02
88000 -- (-1144.645) (-1143.480) (-1143.112) [-1146.727] * (-1142.679) (-1155.064) [-1145.122] (-1142.401) -- 0:01:02
88500 -- [-1146.231] (-1144.420) (-1143.608) (-1145.238) * [-1141.934] (-1151.155) (-1141.525) (-1142.425) -- 0:01:01
89000 -- (-1146.518) (-1144.952) [-1143.079] (-1144.345) * [-1141.903] (-1148.954) (-1142.049) (-1142.395) -- 0:01:01
89500 -- (-1141.865) (-1142.127) [-1144.078] (-1147.595) * (-1141.573) (-1154.627) (-1143.647) [-1145.037] -- 0:01:01
90000 -- [-1142.450] (-1143.054) (-1145.295) (-1147.297) * (-1143.836) (-1154.870) (-1141.397) [-1143.562] -- 0:01:00
Average standard deviation of split frequencies: 0.017513
90500 -- (-1145.462) (-1143.155) [-1144.950] (-1144.216) * (-1141.439) (-1148.051) (-1146.487) [-1144.202] -- 0:01:00
91000 -- [-1142.470] (-1143.084) (-1145.683) (-1143.084) * (-1143.906) [-1149.085] (-1143.241) (-1144.983) -- 0:00:59
91500 -- (-1143.456) [-1141.734] (-1143.620) (-1142.565) * [-1142.302] (-1150.491) (-1144.567) (-1147.103) -- 0:00:59
92000 -- (-1144.799) [-1143.088] (-1143.883) (-1143.113) * [-1144.876] (-1153.787) (-1145.008) (-1146.583) -- 0:00:59
92500 -- (-1144.495) (-1143.916) [-1142.794] (-1141.996) * [-1145.145] (-1158.102) (-1143.249) (-1145.083) -- 0:00:58
93000 -- (-1145.663) [-1141.666] (-1141.147) (-1145.963) * (-1144.079) [-1153.702] (-1143.568) (-1142.984) -- 0:00:58
93500 -- (-1146.017) [-1141.296] (-1141.470) (-1142.696) * (-1147.252) [-1152.404] (-1144.111) (-1145.400) -- 0:00:58
94000 -- [-1146.475] (-1141.379) (-1141.365) (-1143.633) * (-1148.040) (-1152.089) [-1141.854] (-1143.399) -- 0:00:57
94500 -- (-1142.532) [-1141.888] (-1143.056) (-1144.043) * (-1145.549) [-1147.347] (-1146.278) (-1143.397) -- 0:00:57
95000 -- [-1143.988] (-1143.342) (-1143.574) (-1144.309) * (-1143.456) (-1152.929) [-1142.166] (-1142.774) -- 0:00:57
Average standard deviation of split frequencies: 0.018278
95500 -- (-1143.292) (-1143.490) (-1141.617) [-1141.959] * (-1142.212) [-1149.972] (-1142.616) (-1146.288) -- 0:00:56
96000 -- (-1143.358) (-1142.909) [-1142.768] (-1142.686) * [-1143.499] (-1147.437) (-1143.003) (-1144.602) -- 0:00:56
96500 -- (-1143.765) [-1141.085] (-1142.855) (-1142.363) * (-1144.474) (-1152.829) (-1143.919) [-1144.826] -- 0:00:56
97000 -- [-1143.517] (-1144.804) (-1145.227) (-1144.290) * (-1143.631) (-1148.762) [-1143.197] (-1143.912) -- 0:00:55
97500 -- [-1144.464] (-1144.887) (-1147.940) (-1144.999) * (-1142.110) (-1156.594) [-1143.972] (-1142.510) -- 0:00:55
98000 -- (-1146.396) (-1141.480) (-1144.602) [-1143.541] * (-1142.521) [-1156.734] (-1143.184) (-1142.446) -- 0:00:55
98500 -- (-1145.017) [-1141.243] (-1146.898) (-1143.278) * (-1146.160) [-1149.318] (-1141.506) (-1142.225) -- 0:01:04
99000 -- [-1145.942] (-1141.909) (-1145.369) (-1144.781) * (-1141.331) [-1147.920] (-1141.986) (-1144.486) -- 0:01:03
99500 -- (-1145.472) (-1143.860) (-1142.879) [-1142.480] * (-1142.227) (-1148.333) (-1142.436) [-1141.853] -- 0:01:03
100000 -- (-1143.377) (-1142.961) [-1142.954] (-1142.977) * [-1144.690] (-1156.702) (-1142.099) (-1146.559) -- 0:01:02
Average standard deviation of split frequencies: 0.018456
100500 -- (-1141.354) (-1143.433) [-1142.450] (-1144.722) * (-1142.708) [-1153.890] (-1143.888) (-1146.072) -- 0:01:02
101000 -- (-1141.491) (-1144.307) (-1142.838) [-1142.936] * (-1143.327) [-1149.291] (-1144.189) (-1144.674) -- 0:01:02
101500 -- (-1143.630) (-1143.985) [-1142.753] (-1141.863) * [-1142.499] (-1148.614) (-1143.966) (-1142.503) -- 0:01:01
102000 -- (-1142.929) (-1143.433) [-1142.635] (-1143.072) * (-1144.943) (-1151.636) [-1146.195] (-1142.392) -- 0:01:01
102500 -- (-1143.909) (-1146.970) (-1143.792) [-1145.371] * (-1141.967) (-1151.884) [-1143.323] (-1146.207) -- 0:01:01
103000 -- (-1142.619) (-1145.187) [-1143.206] (-1143.897) * (-1144.563) [-1152.922] (-1143.849) (-1145.544) -- 0:01:00
103500 -- (-1141.319) (-1142.775) (-1142.648) [-1143.824] * (-1142.266) (-1149.409) [-1143.123] (-1146.334) -- 0:01:00
104000 -- (-1143.018) [-1142.916] (-1143.591) (-1142.411) * (-1142.435) [-1153.521] (-1143.000) (-1143.526) -- 0:01:00
104500 -- (-1141.874) (-1142.075) [-1146.757] (-1142.802) * (-1142.792) (-1148.174) (-1144.415) [-1142.507] -- 0:00:59
105000 -- (-1142.800) (-1143.000) [-1148.221] (-1143.453) * (-1144.500) [-1149.966] (-1149.994) (-1144.666) -- 0:00:59
Average standard deviation of split frequencies: 0.017321
105500 -- (-1142.988) (-1142.350) (-1147.333) [-1145.333] * (-1144.821) [-1152.808] (-1142.360) (-1145.817) -- 0:00:59
106000 -- (-1143.259) (-1142.555) (-1144.820) [-1147.311] * (-1143.449) (-1153.044) [-1142.743] (-1142.653) -- 0:00:59
106500 -- (-1145.413) (-1145.406) [-1144.648] (-1143.847) * (-1143.276) [-1147.391] (-1142.794) (-1147.881) -- 0:00:58
107000 -- (-1143.756) (-1143.577) [-1144.178] (-1144.515) * [-1144.559] (-1149.638) (-1141.771) (-1142.325) -- 0:00:58
107500 -- [-1141.273] (-1143.210) (-1146.272) (-1146.083) * (-1147.307) (-1153.401) [-1142.072] (-1142.769) -- 0:00:58
108000 -- [-1141.124] (-1143.191) (-1141.550) (-1143.065) * (-1144.549) (-1151.260) (-1144.069) [-1142.616] -- 0:00:57
108500 -- (-1141.263) [-1142.542] (-1141.766) (-1143.627) * [-1142.652] (-1155.837) (-1144.893) (-1143.598) -- 0:00:57
109000 -- (-1141.058) (-1145.450) [-1141.740] (-1142.290) * [-1143.456] (-1149.769) (-1146.470) (-1148.663) -- 0:00:57
109500 -- (-1144.186) [-1144.498] (-1141.960) (-1142.405) * (-1145.931) (-1154.093) [-1142.491] (-1144.821) -- 0:00:56
110000 -- (-1148.425) (-1146.342) (-1142.472) [-1142.936] * (-1144.397) (-1150.862) (-1143.225) [-1144.329] -- 0:00:56
Average standard deviation of split frequencies: 0.017039
110500 -- (-1141.368) (-1146.290) [-1141.840] (-1142.825) * (-1142.303) [-1152.354] (-1145.047) (-1142.327) -- 0:00:56
111000 -- (-1141.950) (-1144.794) (-1142.180) [-1142.612] * (-1143.043) (-1159.904) (-1147.243) [-1145.361] -- 0:00:56
111500 -- (-1145.181) (-1143.008) (-1142.713) [-1142.469] * (-1143.685) (-1152.029) [-1142.710] (-1145.509) -- 0:00:55
112000 -- [-1144.182] (-1143.099) (-1143.584) (-1143.772) * (-1146.130) [-1154.672] (-1144.478) (-1148.277) -- 0:00:55
112500 -- (-1144.572) [-1143.529] (-1146.436) (-1146.537) * [-1145.914] (-1152.540) (-1144.598) (-1142.518) -- 0:00:55
113000 -- [-1144.247] (-1144.301) (-1145.016) (-1145.602) * (-1144.752) (-1153.788) (-1143.467) [-1143.457] -- 0:00:54
113500 -- (-1145.624) (-1142.816) [-1143.038] (-1141.573) * (-1145.572) (-1164.255) (-1145.158) [-1144.538] -- 0:00:54
114000 -- (-1146.055) (-1142.431) (-1144.808) [-1142.142] * [-1142.658] (-1144.428) (-1144.216) (-1143.085) -- 0:00:54
114500 -- (-1145.553) (-1142.898) (-1146.810) [-1141.783] * [-1142.824] (-1144.893) (-1142.378) (-1142.440) -- 0:01:01
115000 -- (-1146.324) [-1142.377] (-1144.957) (-1142.401) * (-1144.216) (-1142.247) (-1142.483) [-1142.245] -- 0:01:01
Average standard deviation of split frequencies: 0.019416
115500 -- (-1142.151) (-1143.388) [-1141.981] (-1146.787) * (-1145.349) (-1142.019) (-1142.483) [-1146.050] -- 0:01:01
116000 -- (-1141.888) (-1143.004) (-1143.132) [-1143.825] * (-1144.542) [-1143.679] (-1142.187) (-1143.300) -- 0:01:00
116500 -- [-1141.976] (-1143.505) (-1143.080) (-1145.203) * [-1144.419] (-1142.760) (-1142.770) (-1143.647) -- 0:01:00
117000 -- (-1144.349) (-1147.415) [-1143.904] (-1146.395) * (-1149.924) [-1141.147] (-1144.055) (-1144.503) -- 0:01:00
117500 -- (-1145.806) (-1142.637) [-1144.566] (-1143.862) * [-1143.572] (-1141.337) (-1148.446) (-1143.841) -- 0:01:00
118000 -- (-1144.373) [-1142.034] (-1144.321) (-1143.564) * (-1144.032) [-1143.437] (-1146.655) (-1142.188) -- 0:00:59
118500 -- [-1142.465] (-1142.376) (-1143.549) (-1143.887) * (-1143.536) (-1142.490) (-1146.934) [-1141.955] -- 0:00:59
119000 -- (-1144.004) (-1144.813) [-1142.448] (-1144.483) * (-1143.413) (-1143.282) [-1144.483] (-1141.634) -- 0:00:59
119500 -- (-1142.949) (-1143.360) [-1144.412] (-1144.527) * (-1144.639) (-1145.293) (-1145.503) [-1141.985] -- 0:00:58
120000 -- (-1143.244) [-1147.732] (-1142.978) (-1142.423) * (-1143.563) [-1144.192] (-1145.224) (-1145.592) -- 0:00:58
Average standard deviation of split frequencies: 0.019763
120500 -- (-1145.794) [-1141.954] (-1143.557) (-1145.030) * (-1141.530) [-1144.035] (-1144.131) (-1146.966) -- 0:00:58
121000 -- [-1143.938] (-1144.517) (-1144.577) (-1142.211) * (-1141.419) (-1146.272) (-1145.403) [-1147.945] -- 0:00:58
121500 -- (-1142.649) [-1143.834] (-1141.722) (-1144.007) * (-1142.809) [-1143.432] (-1144.437) (-1146.432) -- 0:00:57
122000 -- (-1145.133) (-1142.482) [-1142.184] (-1145.798) * (-1141.612) (-1142.672) [-1149.396] (-1152.619) -- 0:00:57
122500 -- (-1144.044) (-1144.522) [-1142.579] (-1147.068) * (-1141.795) (-1143.285) (-1144.263) [-1145.249] -- 0:00:57
123000 -- [-1142.036] (-1141.581) (-1142.493) (-1142.285) * (-1142.457) (-1145.502) [-1145.753] (-1143.653) -- 0:00:57
123500 -- (-1143.151) [-1141.570] (-1143.440) (-1142.176) * (-1141.483) (-1145.482) (-1143.141) [-1142.146] -- 0:00:56
124000 -- (-1142.848) (-1143.562) (-1146.180) [-1141.536] * (-1145.217) [-1143.950] (-1145.175) (-1144.879) -- 0:00:56
124500 -- (-1141.821) [-1145.358] (-1144.494) (-1144.617) * (-1144.409) (-1143.234) (-1145.458) [-1144.698] -- 0:00:56
125000 -- (-1144.106) (-1145.323) [-1143.825] (-1142.208) * [-1142.700] (-1144.158) (-1143.944) (-1144.535) -- 0:00:56
Average standard deviation of split frequencies: 0.018291
125500 -- [-1147.607] (-1146.545) (-1142.978) (-1141.703) * (-1142.700) (-1143.857) (-1142.490) [-1143.889] -- 0:00:55
126000 -- (-1143.476) [-1144.313] (-1142.325) (-1141.481) * (-1142.976) [-1142.128] (-1145.245) (-1143.905) -- 0:00:55
126500 -- (-1143.036) (-1144.755) (-1142.704) [-1145.425] * (-1142.209) (-1141.912) (-1141.900) [-1143.629] -- 0:00:55
127000 -- [-1142.129] (-1143.218) (-1144.546) (-1143.045) * [-1142.670] (-1142.660) (-1141.628) (-1143.791) -- 0:00:54
127500 -- (-1142.089) (-1142.825) [-1145.288] (-1142.156) * [-1143.338] (-1147.957) (-1141.596) (-1145.266) -- 0:00:54
128000 -- (-1142.765) [-1143.702] (-1143.200) (-1141.554) * (-1141.860) [-1142.985] (-1143.244) (-1142.297) -- 0:00:54
128500 -- (-1142.141) (-1145.429) (-1143.041) [-1146.123] * (-1147.250) [-1145.172] (-1143.946) (-1143.140) -- 0:00:54
129000 -- (-1144.644) (-1147.031) [-1143.933] (-1146.779) * (-1144.921) (-1144.928) (-1144.468) [-1141.859] -- 0:00:54
129500 -- [-1144.576] (-1146.850) (-1146.003) (-1143.253) * (-1141.631) [-1144.243] (-1141.831) (-1142.521) -- 0:00:53
130000 -- [-1143.580] (-1148.429) (-1142.547) (-1143.688) * (-1143.495) (-1143.751) [-1142.213] (-1142.236) -- 0:00:53
Average standard deviation of split frequencies: 0.017838
130500 -- [-1143.637] (-1145.273) (-1143.022) (-1143.668) * (-1143.892) (-1145.651) (-1141.940) [-1142.591] -- 0:00:59
131000 -- (-1143.684) (-1143.455) [-1145.434] (-1144.506) * [-1143.182] (-1146.412) (-1141.933) (-1141.109) -- 0:00:59
131500 -- (-1142.075) [-1142.009] (-1150.473) (-1145.782) * (-1146.605) (-1145.168) [-1144.762] (-1143.588) -- 0:00:59
132000 -- (-1142.683) (-1141.980) (-1147.737) [-1144.363] * (-1145.116) (-1144.772) (-1142.206) [-1142.139] -- 0:00:59
132500 -- (-1142.974) [-1144.177] (-1144.997) (-1147.326) * (-1142.549) (-1145.720) (-1147.006) [-1142.087] -- 0:00:58
133000 -- (-1144.035) (-1142.797) [-1143.107] (-1141.983) * (-1142.133) (-1146.635) [-1145.888] (-1141.422) -- 0:00:58
133500 -- (-1144.335) (-1142.750) (-1143.419) [-1141.759] * [-1143.302] (-1147.030) (-1145.954) (-1142.148) -- 0:00:58
134000 -- (-1143.549) (-1142.546) [-1144.012] (-1144.728) * (-1144.347) (-1143.762) [-1144.298] (-1142.081) -- 0:00:58
134500 -- (-1143.539) [-1144.252] (-1143.671) (-1144.238) * (-1145.668) (-1144.380) [-1143.104] (-1142.100) -- 0:00:57
135000 -- (-1144.327) [-1144.960] (-1143.932) (-1143.297) * (-1143.135) (-1142.693) [-1143.197] (-1142.013) -- 0:00:57
Average standard deviation of split frequencies: 0.019064
135500 -- [-1145.083] (-1147.013) (-1142.846) (-1144.495) * (-1142.943) (-1141.956) (-1142.820) [-1141.840] -- 0:00:57
136000 -- (-1147.361) (-1148.463) [-1141.923] (-1143.480) * [-1142.555] (-1141.842) (-1142.380) (-1147.801) -- 0:00:57
136500 -- (-1143.064) (-1143.019) [-1142.968] (-1143.454) * (-1143.497) (-1141.937) [-1142.012] (-1144.713) -- 0:00:56
137000 -- [-1142.580] (-1143.270) (-1142.146) (-1143.372) * [-1142.068] (-1142.504) (-1147.141) (-1143.007) -- 0:00:56
137500 -- [-1142.250] (-1145.120) (-1144.031) (-1142.689) * [-1141.865] (-1142.493) (-1142.666) (-1144.005) -- 0:00:56
138000 -- [-1142.110] (-1143.785) (-1143.277) (-1143.544) * (-1143.709) [-1142.402] (-1145.059) (-1143.293) -- 0:00:56
138500 -- [-1142.213] (-1143.845) (-1146.605) (-1142.216) * [-1143.258] (-1141.975) (-1143.991) (-1141.259) -- 0:00:55
139000 -- [-1142.760] (-1143.638) (-1144.308) (-1145.465) * (-1144.479) [-1141.060] (-1142.852) (-1143.825) -- 0:00:55
139500 -- (-1142.465) [-1141.406] (-1144.333) (-1143.800) * (-1148.144) [-1141.880] (-1142.905) (-1143.436) -- 0:00:55
140000 -- (-1142.271) (-1141.401) (-1141.436) [-1141.957] * (-1141.229) (-1142.018) [-1142.831] (-1151.428) -- 0:00:55
Average standard deviation of split frequencies: 0.016942
140500 -- (-1143.930) (-1142.468) [-1141.606] (-1142.548) * (-1141.879) (-1143.956) [-1145.811] (-1144.580) -- 0:00:55
141000 -- (-1149.335) (-1142.181) (-1141.522) [-1141.646] * (-1145.007) [-1141.893] (-1146.009) (-1142.940) -- 0:00:54
141500 -- (-1143.920) [-1142.287] (-1141.815) (-1141.455) * (-1143.789) (-1142.952) (-1142.768) [-1143.712] -- 0:00:54
142000 -- (-1144.660) (-1142.444) [-1141.498] (-1141.352) * [-1143.257] (-1141.402) (-1142.071) (-1143.159) -- 0:00:54
142500 -- [-1144.671] (-1142.148) (-1142.296) (-1141.809) * (-1142.918) (-1142.149) (-1144.425) [-1141.677] -- 0:00:54
143000 -- (-1150.166) (-1144.836) [-1143.599] (-1141.456) * [-1142.324] (-1145.052) (-1143.051) (-1143.347) -- 0:00:53
143500 -- (-1144.835) [-1143.572] (-1144.905) (-1144.603) * (-1143.946) [-1143.746] (-1143.428) (-1141.846) -- 0:00:53
144000 -- [-1143.543] (-1145.628) (-1143.932) (-1144.042) * (-1145.514) (-1143.702) (-1141.771) [-1143.310] -- 0:00:53
144500 -- (-1143.366) (-1146.149) (-1141.586) [-1145.884] * (-1143.862) (-1142.998) (-1142.094) [-1143.607] -- 0:00:53
145000 -- (-1145.031) (-1146.090) [-1143.379] (-1142.826) * (-1144.832) (-1141.416) [-1143.091] (-1143.485) -- 0:00:53
Average standard deviation of split frequencies: 0.014709
145500 -- (-1141.826) (-1145.441) (-1144.985) [-1143.360] * (-1143.312) [-1142.819] (-1143.756) (-1143.470) -- 0:00:52
146000 -- (-1145.596) (-1144.684) (-1146.024) [-1141.768] * (-1142.436) (-1141.482) [-1147.191] (-1146.565) -- 0:00:52
146500 -- (-1141.531) (-1145.044) (-1148.275) [-1142.697] * (-1142.409) (-1142.854) [-1146.538] (-1142.232) -- 0:00:58
147000 -- (-1146.929) (-1144.511) (-1142.615) [-1142.748] * (-1143.887) (-1143.132) (-1142.087) [-1142.122] -- 0:00:58
147500 -- [-1144.567] (-1144.823) (-1143.642) (-1144.836) * (-1142.290) [-1142.683] (-1142.173) (-1142.162) -- 0:00:57
148000 -- (-1146.873) (-1144.811) (-1142.897) [-1143.309] * [-1144.492] (-1146.897) (-1144.022) (-1145.879) -- 0:00:57
148500 -- (-1143.723) (-1142.985) [-1142.594] (-1142.624) * [-1144.398] (-1144.130) (-1143.571) (-1145.619) -- 0:00:57
149000 -- (-1143.438) [-1144.055] (-1147.916) (-1143.791) * (-1146.728) (-1143.513) [-1144.914] (-1142.169) -- 0:00:57
149500 -- (-1143.178) [-1146.544] (-1142.682) (-1142.706) * (-1146.108) [-1144.181] (-1143.373) (-1142.539) -- 0:00:56
150000 -- (-1144.164) (-1145.492) (-1144.163) [-1141.747] * [-1143.712] (-1144.668) (-1142.860) (-1141.913) -- 0:00:56
Average standard deviation of split frequencies: 0.014080
150500 -- (-1144.635) (-1143.320) (-1146.695) [-1142.850] * (-1144.945) (-1148.240) [-1141.855] (-1142.006) -- 0:00:56
151000 -- (-1144.804) (-1147.030) (-1144.972) [-1143.314] * (-1143.269) [-1144.517] (-1143.048) (-1142.670) -- 0:00:56
151500 -- [-1141.585] (-1144.771) (-1146.886) (-1142.869) * (-1143.213) (-1146.017) (-1143.463) [-1143.198] -- 0:00:56
152000 -- [-1141.649] (-1145.541) (-1145.909) (-1146.714) * [-1142.192] (-1147.301) (-1142.726) (-1141.811) -- 0:00:55
152500 -- [-1141.645] (-1143.715) (-1146.201) (-1146.213) * (-1141.838) (-1145.310) (-1143.581) [-1144.376] -- 0:00:55
153000 -- (-1141.656) (-1143.777) (-1144.600) [-1143.921] * [-1141.867] (-1142.965) (-1141.193) (-1142.251) -- 0:00:55
153500 -- (-1143.565) (-1141.942) (-1146.524) [-1144.411] * (-1141.890) [-1144.046] (-1141.226) (-1141.748) -- 0:00:55
154000 -- [-1141.437] (-1141.563) (-1144.266) (-1144.464) * (-1142.166) (-1143.054) [-1142.003] (-1143.113) -- 0:00:54
154500 -- (-1142.728) [-1141.562] (-1145.559) (-1143.760) * (-1143.095) [-1144.188] (-1144.992) (-1143.311) -- 0:00:54
155000 -- (-1143.593) (-1141.928) (-1144.687) [-1142.225] * (-1143.325) [-1140.992] (-1144.876) (-1141.904) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
155500 -- [-1143.068] (-1142.343) (-1153.469) (-1143.670) * (-1145.061) (-1141.071) (-1144.863) [-1142.757] -- 0:00:54
156000 -- (-1143.726) [-1141.838] (-1144.856) (-1146.583) * (-1143.745) (-1141.267) (-1143.724) [-1142.839] -- 0:00:54
156500 -- (-1142.680) (-1144.018) [-1144.108] (-1143.690) * (-1143.757) (-1141.278) [-1146.397] (-1143.123) -- 0:00:53
157000 -- (-1142.579) (-1148.185) (-1145.073) [-1143.167] * (-1143.501) (-1141.386) (-1144.788) [-1143.068] -- 0:00:53
157500 -- (-1144.561) (-1147.572) (-1143.178) [-1142.754] * (-1146.204) (-1143.798) [-1144.569] (-1142.370) -- 0:00:53
158000 -- (-1143.280) (-1144.397) [-1143.231] (-1141.831) * (-1143.649) (-1143.017) (-1145.628) [-1146.481] -- 0:00:53
158500 -- (-1143.784) [-1143.657] (-1143.359) (-1143.052) * (-1142.251) (-1141.026) [-1144.505] (-1145.915) -- 0:00:53
159000 -- (-1144.134) [-1143.779] (-1144.621) (-1144.908) * (-1142.197) [-1141.045] (-1142.508) (-1145.934) -- 0:00:52
159500 -- (-1145.463) [-1143.405] (-1144.410) (-1145.203) * (-1141.454) (-1140.983) [-1144.085] (-1146.088) -- 0:00:52
160000 -- [-1141.443] (-1144.167) (-1142.337) (-1146.318) * [-1145.867] (-1141.874) (-1144.798) (-1146.942) -- 0:00:52
Average standard deviation of split frequencies: 0.012045
160500 -- [-1141.443] (-1144.997) (-1146.379) (-1143.176) * [-1142.151] (-1144.455) (-1145.018) (-1141.383) -- 0:00:52
161000 -- (-1142.876) [-1143.704] (-1142.244) (-1144.755) * (-1146.467) (-1141.988) (-1144.812) [-1141.469] -- 0:00:52
161500 -- [-1143.532] (-1142.875) (-1142.778) (-1145.424) * [-1142.363] (-1142.866) (-1142.576) (-1144.082) -- 0:00:51
162000 -- (-1146.046) (-1144.769) [-1143.142] (-1146.936) * (-1143.003) (-1142.042) [-1143.149] (-1144.270) -- 0:00:51
162500 -- (-1148.549) (-1144.928) (-1142.534) [-1144.398] * [-1142.630] (-1143.918) (-1143.206) (-1143.249) -- 0:00:51
163000 -- (-1142.452) (-1145.390) [-1142.042] (-1142.943) * (-1144.451) [-1141.858] (-1144.288) (-1145.508) -- 0:00:56
163500 -- (-1143.197) (-1143.399) (-1144.501) [-1143.742] * [-1141.802] (-1143.600) (-1145.113) (-1146.145) -- 0:00:56
164000 -- (-1143.588) (-1142.681) [-1144.705] (-1142.464) * (-1141.524) [-1142.222] (-1145.270) (-1146.912) -- 0:00:56
164500 -- [-1143.086] (-1143.579) (-1143.534) (-1142.453) * (-1145.614) [-1141.796] (-1142.255) (-1148.127) -- 0:00:55
165000 -- (-1143.790) (-1143.506) [-1142.653] (-1142.183) * (-1141.874) (-1142.582) [-1144.415] (-1143.739) -- 0:00:55
Average standard deviation of split frequencies: 0.013900
165500 -- (-1142.495) (-1143.658) (-1143.148) [-1145.166] * [-1142.431] (-1145.145) (-1143.136) (-1143.778) -- 0:00:55
166000 -- (-1145.855) [-1142.903] (-1142.911) (-1142.339) * (-1142.371) (-1143.144) [-1142.488] (-1141.218) -- 0:00:55
166500 -- [-1143.820] (-1143.162) (-1142.926) (-1146.022) * (-1145.217) (-1142.838) (-1150.205) [-1141.217] -- 0:00:55
167000 -- (-1142.809) (-1141.823) [-1144.346] (-1142.779) * [-1143.568] (-1143.355) (-1144.183) (-1141.284) -- 0:00:54
167500 -- [-1146.504] (-1141.615) (-1144.346) (-1142.810) * (-1142.806) (-1145.250) [-1145.756] (-1142.038) -- 0:00:54
168000 -- (-1144.160) [-1141.688] (-1142.123) (-1142.686) * [-1144.625] (-1146.348) (-1143.814) (-1142.599) -- 0:00:54
168500 -- (-1142.804) (-1148.108) (-1143.199) [-1141.635] * [-1142.490] (-1143.723) (-1144.364) (-1145.647) -- 0:00:54
169000 -- (-1143.576) (-1143.348) (-1146.384) [-1142.635] * (-1143.898) [-1144.842] (-1143.569) (-1143.615) -- 0:00:54
169500 -- (-1143.227) (-1147.179) [-1144.886] (-1142.695) * (-1145.088) [-1145.604] (-1144.345) (-1142.505) -- 0:00:53
170000 -- (-1144.359) (-1144.675) [-1142.415] (-1146.397) * (-1142.672) [-1145.040] (-1141.564) (-1143.826) -- 0:00:53
Average standard deviation of split frequencies: 0.014731
170500 -- [-1144.626] (-1144.658) (-1143.230) (-1148.760) * (-1142.715) (-1142.883) [-1142.200] (-1149.837) -- 0:00:53
171000 -- (-1148.314) (-1142.493) (-1142.205) [-1146.446] * (-1146.997) (-1143.012) [-1143.623] (-1147.521) -- 0:00:53
171500 -- (-1146.463) [-1143.755] (-1142.564) (-1144.105) * (-1147.193) (-1142.040) [-1141.760] (-1146.206) -- 0:00:53
172000 -- (-1142.746) (-1142.519) [-1146.647] (-1145.165) * (-1143.566) (-1142.623) (-1143.185) [-1142.746] -- 0:00:52
172500 -- (-1144.888) [-1141.728] (-1141.772) (-1145.576) * (-1144.667) (-1142.252) [-1144.937] (-1145.218) -- 0:00:52
173000 -- (-1141.431) [-1142.651] (-1143.145) (-1144.173) * [-1142.937] (-1144.648) (-1143.056) (-1145.655) -- 0:00:52
173500 -- (-1141.373) (-1143.546) (-1142.567) [-1141.202] * [-1142.471] (-1143.881) (-1143.730) (-1143.157) -- 0:00:52
174000 -- (-1141.489) [-1141.831] (-1146.115) (-1143.606) * [-1143.801] (-1143.958) (-1143.066) (-1143.258) -- 0:00:52
174500 -- (-1142.109) (-1151.935) [-1142.031] (-1144.267) * (-1142.923) (-1144.008) [-1146.700] (-1143.270) -- 0:00:52
175000 -- [-1143.009] (-1149.959) (-1143.486) (-1142.872) * (-1144.369) [-1144.394] (-1145.836) (-1142.634) -- 0:00:51
Average standard deviation of split frequencies: 0.013987
175500 -- (-1147.102) (-1142.770) (-1142.422) [-1142.283] * [-1145.136] (-1147.600) (-1145.678) (-1141.880) -- 0:00:51
176000 -- (-1145.271) (-1141.503) [-1143.556] (-1142.743) * (-1145.139) [-1141.876] (-1144.403) (-1142.094) -- 0:00:51
176500 -- [-1142.523] (-1141.992) (-1143.560) (-1142.466) * (-1144.277) (-1141.918) [-1142.150] (-1144.839) -- 0:00:51
177000 -- (-1142.269) [-1143.373] (-1142.642) (-1142.754) * [-1142.714] (-1143.865) (-1141.356) (-1144.406) -- 0:00:51
177500 -- (-1142.268) (-1146.283) [-1143.534] (-1144.568) * [-1142.158] (-1147.250) (-1143.400) (-1144.587) -- 0:00:50
178000 -- (-1143.442) [-1145.210] (-1141.711) (-1144.835) * (-1142.860) (-1141.853) (-1143.594) [-1144.763] -- 0:00:50
178500 -- (-1142.154) (-1143.941) (-1144.708) [-1145.360] * (-1144.893) (-1144.590) [-1144.443] (-1144.220) -- 0:00:50
179000 -- (-1146.068) (-1146.241) [-1141.973] (-1144.333) * (-1144.686) (-1143.812) (-1144.124) [-1143.268] -- 0:00:55
179500 -- [-1144.028] (-1143.333) (-1141.978) (-1146.971) * (-1144.851) (-1143.812) (-1146.577) [-1143.280] -- 0:00:54
180000 -- [-1141.685] (-1141.948) (-1142.215) (-1144.044) * [-1142.423] (-1146.106) (-1141.492) (-1143.006) -- 0:00:54
Average standard deviation of split frequencies: 0.015656
180500 -- (-1148.295) (-1142.855) (-1141.287) [-1144.172] * (-1141.354) (-1148.598) [-1141.842] (-1141.991) -- 0:00:54
181000 -- (-1143.039) (-1145.637) [-1141.302] (-1142.881) * (-1143.961) (-1150.395) [-1142.384] (-1145.090) -- 0:00:54
181500 -- [-1142.737] (-1141.800) (-1142.724) (-1145.934) * [-1144.348] (-1146.505) (-1142.539) (-1146.684) -- 0:00:54
182000 -- (-1143.614) [-1141.636] (-1144.831) (-1147.117) * (-1146.655) (-1146.967) (-1145.987) [-1144.325] -- 0:00:53
182500 -- (-1142.186) [-1142.242] (-1143.156) (-1141.605) * [-1147.315] (-1144.626) (-1145.216) (-1143.426) -- 0:00:53
183000 -- (-1143.407) (-1142.398) [-1144.572] (-1142.355) * [-1145.364] (-1143.925) (-1144.431) (-1147.833) -- 0:00:53
183500 -- [-1144.121] (-1143.387) (-1145.425) (-1144.531) * [-1142.422] (-1143.775) (-1143.736) (-1145.799) -- 0:00:53
184000 -- (-1143.644) (-1145.625) (-1143.466) [-1148.553] * (-1141.787) (-1143.626) [-1142.364] (-1144.444) -- 0:00:53
184500 -- (-1143.220) [-1144.667] (-1145.836) (-1142.451) * (-1144.658) [-1143.027] (-1142.190) (-1143.224) -- 0:00:53
185000 -- (-1142.265) (-1144.215) [-1143.511] (-1142.451) * (-1143.743) (-1142.870) (-1146.047) [-1143.799] -- 0:00:52
Average standard deviation of split frequencies: 0.015340
185500 -- (-1142.421) (-1143.483) [-1141.544] (-1141.580) * (-1147.605) (-1142.716) (-1148.373) [-1144.563] -- 0:00:52
186000 -- (-1143.147) (-1144.470) [-1146.614] (-1141.580) * (-1144.791) (-1144.315) [-1142.401] (-1143.213) -- 0:00:52
186500 -- [-1143.164] (-1150.575) (-1144.133) (-1141.846) * (-1144.557) [-1148.504] (-1143.671) (-1141.626) -- 0:00:52
187000 -- (-1147.164) [-1144.866] (-1142.462) (-1142.240) * (-1145.111) (-1146.675) [-1141.642] (-1141.047) -- 0:00:52
187500 -- (-1147.594) (-1142.868) (-1146.976) [-1142.885] * [-1142.730] (-1143.609) (-1142.198) (-1141.954) -- 0:00:52
188000 -- (-1143.694) [-1142.141] (-1141.049) (-1144.684) * (-1142.322) (-1147.183) (-1142.478) [-1142.450] -- 0:00:51
188500 -- (-1146.621) [-1141.635] (-1143.258) (-1142.509) * (-1144.464) [-1144.050] (-1141.676) (-1141.250) -- 0:00:51
189000 -- (-1143.873) (-1142.886) [-1142.046] (-1144.765) * (-1148.649) (-1143.093) (-1142.843) [-1141.992] -- 0:00:51
189500 -- (-1144.915) [-1144.336] (-1142.404) (-1142.206) * (-1145.835) (-1143.395) [-1144.089] (-1144.994) -- 0:00:51
190000 -- (-1142.197) (-1144.869) (-1143.181) [-1142.372] * (-1143.521) (-1142.933) (-1144.486) [-1142.948] -- 0:00:51
Average standard deviation of split frequencies: 0.013736
190500 -- (-1142.705) (-1144.644) (-1142.996) [-1143.052] * (-1143.009) (-1142.926) [-1143.492] (-1143.071) -- 0:00:50
191000 -- (-1145.155) (-1144.334) (-1154.457) [-1144.372] * [-1144.161] (-1142.496) (-1144.883) (-1144.945) -- 0:00:50
191500 -- (-1143.343) (-1150.196) (-1146.365) [-1141.151] * (-1144.182) (-1142.766) [-1143.828] (-1143.841) -- 0:00:50
192000 -- (-1144.324) (-1143.543) (-1143.184) [-1142.126] * (-1141.390) (-1143.377) [-1142.464] (-1141.821) -- 0:00:50
192500 -- (-1142.314) [-1142.356] (-1152.010) (-1142.663) * (-1148.405) (-1142.603) [-1143.403] (-1141.473) -- 0:00:50
193000 -- (-1146.464) (-1143.804) (-1142.489) [-1141.655] * (-1142.828) (-1142.453) (-1143.356) [-1142.943] -- 0:00:50
193500 -- (-1146.301) (-1143.103) [-1141.525] (-1141.655) * (-1144.245) [-1143.171] (-1141.791) (-1142.803) -- 0:00:50
194000 -- (-1146.418) (-1143.612) [-1144.344] (-1141.641) * (-1144.715) (-1143.168) [-1142.115] (-1142.239) -- 0:00:49
194500 -- (-1143.111) (-1143.463) [-1144.007] (-1141.704) * (-1143.487) (-1142.979) (-1142.454) [-1143.943] -- 0:00:53
195000 -- (-1143.543) (-1144.414) [-1143.254] (-1143.437) * [-1143.161] (-1144.724) (-1143.160) (-1142.669) -- 0:00:53
Average standard deviation of split frequencies: 0.013362
195500 -- [-1143.603] (-1143.480) (-1143.777) (-1143.303) * (-1143.186) [-1144.803] (-1142.675) (-1146.172) -- 0:00:53
196000 -- (-1145.109) (-1142.903) (-1143.376) [-1144.791] * [-1142.291] (-1142.389) (-1142.648) (-1146.543) -- 0:00:53
196500 -- [-1144.680] (-1142.586) (-1143.450) (-1144.463) * (-1142.062) (-1142.717) (-1142.163) [-1142.709] -- 0:00:53
197000 -- (-1145.827) [-1142.727] (-1147.201) (-1142.754) * [-1144.324] (-1143.421) (-1142.442) (-1142.948) -- 0:00:52
197500 -- (-1142.352) [-1142.199] (-1145.027) (-1142.926) * (-1147.764) (-1144.240) (-1142.370) [-1143.083] -- 0:00:52
198000 -- (-1143.452) [-1142.008] (-1145.438) (-1143.432) * (-1148.738) (-1150.016) [-1142.180] (-1143.667) -- 0:00:52
198500 -- (-1142.071) (-1141.990) (-1142.199) [-1141.338] * (-1142.556) [-1146.288] (-1144.824) (-1142.132) -- 0:00:52
199000 -- [-1142.200] (-1142.648) (-1146.852) (-1144.963) * (-1142.865) [-1143.346] (-1147.076) (-1146.691) -- 0:00:52
199500 -- (-1142.135) (-1142.434) (-1145.862) [-1143.053] * (-1145.138) (-1147.971) (-1146.227) [-1142.336] -- 0:00:52
200000 -- (-1142.603) (-1145.526) [-1143.463] (-1141.737) * (-1144.777) [-1142.888] (-1143.258) (-1143.233) -- 0:00:51
Average standard deviation of split frequencies: 0.012660
200500 -- [-1148.383] (-1141.923) (-1144.137) (-1144.887) * (-1143.809) (-1142.687) [-1142.947] (-1142.477) -- 0:00:51
201000 -- (-1147.433) [-1142.078] (-1142.805) (-1143.869) * [-1144.647] (-1145.624) (-1143.026) (-1143.568) -- 0:00:51
201500 -- (-1143.293) (-1141.543) (-1142.174) [-1141.594] * [-1144.380] (-1142.945) (-1144.113) (-1143.154) -- 0:00:51
202000 -- [-1143.873] (-1141.716) (-1141.835) (-1144.741) * [-1143.453] (-1144.367) (-1144.361) (-1146.180) -- 0:00:51
202500 -- (-1143.318) [-1142.376] (-1149.805) (-1143.158) * [-1142.990] (-1144.033) (-1144.751) (-1142.233) -- 0:00:51
203000 -- (-1142.474) (-1142.327) [-1146.559] (-1144.590) * (-1142.965) (-1148.179) (-1144.075) [-1143.743] -- 0:00:51
203500 -- (-1143.090) (-1142.642) [-1142.563] (-1142.831) * (-1141.572) (-1146.950) (-1142.345) [-1146.200] -- 0:00:50
204000 -- (-1143.861) [-1143.613] (-1142.036) (-1143.190) * [-1142.912] (-1148.983) (-1144.059) (-1147.683) -- 0:00:50
204500 -- (-1142.807) (-1143.106) (-1141.810) [-1142.603] * (-1143.517) (-1146.782) (-1141.802) [-1146.187] -- 0:00:50
205000 -- (-1145.745) [-1142.213] (-1147.477) (-1142.736) * (-1144.206) [-1141.708] (-1142.742) (-1146.241) -- 0:00:50
Average standard deviation of split frequencies: 0.012526
205500 -- [-1144.289] (-1142.153) (-1144.654) (-1145.169) * (-1145.118) (-1142.679) [-1141.582] (-1152.382) -- 0:00:50
206000 -- (-1146.519) [-1144.119] (-1143.260) (-1141.952) * [-1143.150] (-1142.411) (-1143.908) (-1149.139) -- 0:00:50
206500 -- (-1145.897) [-1141.258] (-1144.490) (-1144.020) * (-1141.064) (-1142.760) [-1144.087] (-1145.292) -- 0:00:49
207000 -- (-1142.425) [-1142.563] (-1143.307) (-1142.445) * (-1141.807) (-1145.406) [-1141.730] (-1143.022) -- 0:00:49
207500 -- [-1145.609] (-1142.086) (-1145.179) (-1142.291) * (-1141.110) [-1144.141] (-1142.722) (-1143.187) -- 0:00:49
208000 -- [-1147.032] (-1142.877) (-1142.904) (-1144.041) * (-1142.215) (-1141.355) [-1142.504] (-1144.227) -- 0:00:49
208500 -- [-1141.950] (-1151.756) (-1145.577) (-1144.174) * (-1142.686) [-1142.860] (-1142.740) (-1144.224) -- 0:00:49
209000 -- (-1147.692) (-1147.695) (-1142.630) [-1141.904] * [-1141.967] (-1141.738) (-1143.421) (-1145.799) -- 0:00:52
209500 -- [-1144.629] (-1145.922) (-1143.320) (-1141.984) * [-1144.699] (-1143.197) (-1141.430) (-1145.204) -- 0:00:52
210000 -- (-1145.070) (-1149.533) (-1144.017) [-1141.735] * [-1143.548] (-1143.292) (-1141.252) (-1145.880) -- 0:00:52
Average standard deviation of split frequencies: 0.011686
210500 -- [-1143.437] (-1142.250) (-1144.899) (-1144.808) * (-1142.986) (-1142.364) (-1141.934) [-1144.936] -- 0:00:52
211000 -- [-1142.082] (-1142.265) (-1144.179) (-1142.541) * (-1145.101) [-1142.033] (-1142.469) (-1142.227) -- 0:00:52
211500 -- [-1142.961] (-1142.306) (-1143.403) (-1150.098) * (-1143.959) (-1143.175) [-1142.469] (-1142.236) -- 0:00:52
212000 -- (-1144.014) [-1142.812] (-1144.402) (-1143.242) * (-1144.515) [-1142.716] (-1143.950) (-1147.654) -- 0:00:52
212500 -- (-1147.932) [-1142.815] (-1145.206) (-1144.870) * (-1145.857) (-1144.631) (-1142.982) [-1142.647] -- 0:00:51
213000 -- (-1146.549) (-1141.884) (-1143.104) [-1141.689] * (-1145.857) [-1144.637] (-1142.295) (-1141.254) -- 0:00:51
213500 -- (-1145.626) (-1144.454) [-1146.040] (-1144.453) * (-1143.630) (-1144.398) (-1141.856) [-1141.445] -- 0:00:51
214000 -- (-1145.305) [-1147.319] (-1143.250) (-1146.260) * (-1143.737) (-1143.993) (-1143.599) [-1141.505] -- 0:00:51
214500 -- (-1145.307) (-1143.698) (-1142.612) [-1142.304] * (-1144.277) (-1144.433) (-1141.652) [-1141.091] -- 0:00:51
215000 -- (-1145.661) (-1144.924) (-1142.816) [-1142.858] * (-1142.882) (-1145.871) [-1141.133] (-1142.305) -- 0:00:51
Average standard deviation of split frequencies: 0.012246
215500 -- (-1143.607) [-1142.650] (-1143.569) (-1144.884) * (-1141.579) [-1143.573] (-1143.584) (-1143.544) -- 0:00:50
216000 -- (-1143.513) (-1141.318) [-1142.434] (-1143.645) * (-1142.751) (-1144.731) (-1145.327) [-1141.896] -- 0:00:50
216500 -- (-1146.298) (-1143.535) [-1142.943] (-1142.229) * (-1141.514) [-1144.152] (-1141.804) (-1141.530) -- 0:00:50
217000 -- (-1143.695) (-1142.390) [-1142.251] (-1143.300) * (-1143.194) (-1144.354) (-1141.429) [-1142.930] -- 0:00:50
217500 -- (-1145.258) [-1144.418] (-1142.520) (-1145.254) * (-1142.643) (-1142.527) (-1141.345) [-1142.732] -- 0:00:50
218000 -- (-1142.411) (-1145.395) (-1145.495) [-1145.242] * (-1147.660) (-1142.957) (-1142.991) [-1146.210] -- 0:00:50
218500 -- [-1141.976] (-1146.442) (-1146.302) (-1146.751) * (-1146.724) (-1142.494) [-1142.000] (-1142.407) -- 0:00:50
219000 -- [-1141.499] (-1145.913) (-1142.543) (-1142.663) * [-1143.304] (-1143.292) (-1143.125) (-1143.928) -- 0:00:49
219500 -- [-1142.943] (-1144.000) (-1143.026) (-1145.490) * (-1144.309) (-1144.963) [-1142.516] (-1146.046) -- 0:00:49
220000 -- (-1143.786) (-1142.998) [-1143.694] (-1143.663) * (-1142.442) (-1143.126) [-1143.924] (-1143.964) -- 0:00:49
Average standard deviation of split frequencies: 0.011561
220500 -- (-1142.575) [-1143.586] (-1146.004) (-1144.075) * (-1143.678) (-1143.451) (-1145.058) [-1144.813] -- 0:00:49
221000 -- [-1143.219] (-1142.830) (-1147.524) (-1144.123) * (-1143.167) (-1142.907) [-1143.805] (-1147.196) -- 0:00:49
221500 -- (-1142.424) [-1146.580] (-1143.342) (-1143.035) * [-1141.396] (-1145.910) (-1144.017) (-1142.765) -- 0:00:49
222000 -- (-1143.887) (-1143.564) (-1143.201) [-1145.279] * (-1141.525) [-1143.254] (-1144.120) (-1142.744) -- 0:00:49
222500 -- (-1143.199) (-1146.690) (-1141.783) [-1141.708] * [-1145.320] (-1143.324) (-1144.568) (-1145.246) -- 0:00:48
223000 -- (-1143.396) [-1143.981] (-1145.253) (-1144.079) * (-1141.872) [-1143.128] (-1146.218) (-1146.770) -- 0:00:48
223500 -- (-1146.011) (-1145.325) (-1143.332) [-1143.887] * [-1142.830] (-1143.624) (-1145.320) (-1146.727) -- 0:00:52
224000 -- (-1143.451) (-1142.787) (-1141.821) [-1142.837] * (-1146.161) (-1144.876) [-1143.242] (-1143.151) -- 0:00:51
224500 -- [-1143.875] (-1144.126) (-1143.917) (-1143.712) * [-1142.403] (-1144.171) (-1141.250) (-1143.151) -- 0:00:51
225000 -- [-1142.190] (-1145.304) (-1142.102) (-1143.485) * [-1141.454] (-1142.897) (-1143.465) (-1146.024) -- 0:00:51
Average standard deviation of split frequencies: 0.012515
225500 -- [-1144.203] (-1144.056) (-1141.457) (-1143.062) * (-1143.832) [-1143.362] (-1143.246) (-1142.034) -- 0:00:51
226000 -- [-1144.925] (-1142.071) (-1141.809) (-1142.524) * [-1141.557] (-1143.354) (-1144.134) (-1141.220) -- 0:00:51
226500 -- (-1144.853) (-1149.721) [-1142.290] (-1142.928) * [-1142.210] (-1141.875) (-1147.030) (-1141.220) -- 0:00:51
227000 -- [-1146.253] (-1143.285) (-1142.244) (-1142.117) * (-1141.998) [-1144.429] (-1146.878) (-1142.137) -- 0:00:51
227500 -- [-1146.130] (-1144.695) (-1145.582) (-1143.932) * (-1146.511) [-1142.763] (-1146.079) (-1142.301) -- 0:00:50
228000 -- (-1144.687) (-1145.796) (-1141.005) [-1143.125] * [-1144.528] (-1144.546) (-1143.727) (-1142.746) -- 0:00:50
228500 -- [-1145.084] (-1142.946) (-1141.224) (-1142.332) * (-1143.882) (-1143.662) (-1142.878) [-1141.067] -- 0:00:50
229000 -- (-1144.123) (-1144.018) (-1141.230) [-1142.005] * (-1144.181) [-1142.650] (-1142.512) (-1142.715) -- 0:00:50
229500 -- (-1145.012) (-1147.447) (-1141.473) [-1142.068] * (-1145.324) [-1143.271] (-1143.016) (-1143.592) -- 0:00:50
230000 -- (-1145.497) [-1147.955] (-1141.942) (-1141.505) * (-1142.755) (-1143.982) [-1142.805] (-1143.222) -- 0:00:50
Average standard deviation of split frequencies: 0.012376
230500 -- [-1144.415] (-1145.300) (-1142.579) (-1142.247) * (-1143.584) [-1142.052] (-1144.408) (-1143.587) -- 0:00:50
231000 -- (-1144.037) [-1142.578] (-1151.379) (-1141.783) * [-1146.226] (-1144.623) (-1145.952) (-1146.377) -- 0:00:49
231500 -- (-1141.467) (-1141.760) [-1141.888] (-1143.983) * (-1142.727) (-1141.950) [-1144.312] (-1144.074) -- 0:00:49
232000 -- [-1141.424] (-1142.470) (-1146.906) (-1144.423) * (-1141.898) (-1141.894) (-1146.068) [-1147.994] -- 0:00:49
232500 -- (-1142.256) [-1145.542] (-1142.806) (-1143.316) * (-1142.579) [-1145.593] (-1145.547) (-1145.374) -- 0:00:49
233000 -- (-1146.085) [-1144.841] (-1144.099) (-1145.885) * [-1142.237] (-1145.146) (-1145.267) (-1145.386) -- 0:00:49
233500 -- (-1142.466) (-1143.392) (-1149.634) [-1143.798] * (-1142.491) (-1142.934) (-1144.331) [-1142.957] -- 0:00:49
234000 -- (-1142.862) [-1147.257] (-1146.893) (-1150.920) * [-1144.635] (-1142.932) (-1145.133) (-1143.257) -- 0:00:49
234500 -- (-1145.466) [-1146.404] (-1144.734) (-1144.102) * (-1144.537) (-1143.382) (-1143.416) [-1141.285] -- 0:00:48
235000 -- (-1144.022) (-1145.976) [-1143.102] (-1146.475) * [-1144.418] (-1143.995) (-1144.676) (-1142.378) -- 0:00:48
Average standard deviation of split frequencies: 0.012651
235500 -- (-1141.807) (-1143.995) [-1144.106] (-1145.377) * (-1144.302) [-1141.908] (-1142.698) (-1141.827) -- 0:00:48
236000 -- (-1148.976) (-1142.293) [-1142.870] (-1143.240) * (-1141.906) (-1142.881) (-1143.202) [-1142.664] -- 0:00:48
236500 -- (-1144.489) (-1147.919) (-1142.772) [-1143.116] * (-1142.282) (-1142.877) [-1141.553] (-1142.805) -- 0:00:48
237000 -- (-1142.843) (-1145.781) [-1145.329] (-1145.147) * [-1141.698] (-1145.023) (-1144.465) (-1142.075) -- 0:00:48
237500 -- (-1142.293) (-1143.537) [-1150.220] (-1145.147) * [-1143.296] (-1142.570) (-1145.711) (-1142.143) -- 0:00:48
238000 -- (-1142.406) (-1143.309) [-1142.884] (-1143.848) * (-1141.104) (-1141.288) (-1142.948) [-1143.952] -- 0:00:48
238500 -- [-1141.944] (-1142.449) (-1142.886) (-1144.557) * [-1142.239] (-1142.156) (-1144.312) (-1142.328) -- 0:00:51
239000 -- [-1142.414] (-1148.303) (-1142.486) (-1141.606) * (-1141.227) (-1141.755) [-1143.900] (-1143.147) -- 0:00:50
239500 -- (-1141.949) [-1143.179] (-1142.231) (-1141.122) * (-1142.654) (-1141.405) (-1142.128) [-1142.783] -- 0:00:50
240000 -- (-1145.528) (-1142.554) [-1141.684] (-1141.188) * [-1145.292] (-1141.217) (-1141.078) (-1144.712) -- 0:00:50
Average standard deviation of split frequencies: 0.013596
240500 -- (-1146.569) [-1142.457] (-1141.752) (-1143.764) * (-1145.687) (-1142.802) (-1144.490) [-1141.920] -- 0:00:50
241000 -- (-1146.778) (-1142.253) [-1141.830] (-1143.426) * (-1144.377) [-1144.176] (-1146.533) (-1141.739) -- 0:00:50
241500 -- [-1143.135] (-1143.227) (-1142.238) (-1142.157) * (-1144.818) [-1142.111] (-1145.051) (-1142.146) -- 0:00:50
242000 -- [-1142.569] (-1142.702) (-1151.764) (-1145.693) * (-1144.315) (-1142.444) (-1143.048) [-1143.285] -- 0:00:50
242500 -- (-1143.927) (-1142.245) (-1143.857) [-1144.035] * (-1144.611) [-1142.485] (-1142.043) (-1142.234) -- 0:00:49
243000 -- [-1143.314] (-1142.030) (-1142.831) (-1143.109) * (-1142.359) (-1142.310) [-1142.687] (-1142.311) -- 0:00:49
243500 -- (-1144.258) [-1142.089] (-1142.584) (-1144.545) * (-1145.537) [-1141.580] (-1141.802) (-1144.851) -- 0:00:49
244000 -- (-1143.220) (-1142.083) (-1145.432) [-1142.474] * (-1143.587) (-1141.602) (-1142.717) [-1145.082] -- 0:00:49
244500 -- (-1143.220) (-1143.276) (-1141.625) [-1145.165] * (-1144.627) [-1142.047] (-1142.626) (-1145.288) -- 0:00:49
245000 -- (-1142.732) (-1145.761) [-1141.937] (-1141.820) * (-1157.074) [-1142.053] (-1146.343) (-1145.705) -- 0:00:49
Average standard deviation of split frequencies: 0.013865
245500 -- [-1145.538] (-1142.727) (-1142.188) (-1141.320) * (-1150.422) [-1141.582] (-1146.214) (-1142.437) -- 0:00:49
246000 -- (-1145.436) (-1146.909) [-1144.412] (-1142.252) * (-1146.757) (-1143.642) (-1144.909) [-1141.823] -- 0:00:49
246500 -- (-1141.936) (-1146.678) (-1148.607) [-1142.252] * (-1145.399) [-1144.355] (-1143.537) (-1144.948) -- 0:00:48
247000 -- (-1141.930) (-1147.327) [-1142.973] (-1142.140) * (-1145.106) (-1145.849) (-1143.631) [-1144.272] -- 0:00:48
247500 -- (-1142.244) [-1143.847] (-1143.978) (-1143.460) * (-1146.720) [-1143.187] (-1141.689) (-1142.725) -- 0:00:48
248000 -- [-1142.689] (-1144.373) (-1141.570) (-1145.798) * (-1144.260) (-1142.216) [-1141.434] (-1143.167) -- 0:00:48
248500 -- (-1145.301) [-1144.198] (-1143.576) (-1147.786) * (-1144.669) [-1143.590] (-1141.416) (-1146.116) -- 0:00:48
249000 -- [-1143.085] (-1143.123) (-1143.711) (-1143.475) * (-1143.442) [-1143.194] (-1141.671) (-1142.934) -- 0:00:48
249500 -- [-1142.198] (-1143.142) (-1147.287) (-1142.142) * (-1143.181) (-1143.689) [-1144.097] (-1143.128) -- 0:00:48
250000 -- (-1141.778) (-1146.240) [-1145.114] (-1149.020) * [-1142.084] (-1142.080) (-1143.593) (-1142.503) -- 0:00:48
Average standard deviation of split frequencies: 0.014160
250500 -- (-1141.657) (-1145.332) [-1144.370] (-1142.783) * (-1146.692) [-1143.605] (-1144.403) (-1141.248) -- 0:00:47
251000 -- [-1141.382] (-1145.098) (-1148.223) (-1141.976) * (-1146.297) [-1147.213] (-1141.794) (-1143.275) -- 0:00:47
251500 -- (-1141.110) (-1143.790) [-1144.405] (-1142.446) * (-1143.138) (-1144.138) (-1141.797) [-1141.841] -- 0:00:47
252000 -- (-1142.549) [-1142.328] (-1144.547) (-1146.791) * (-1142.881) (-1144.259) [-1146.118] (-1145.348) -- 0:00:47
252500 -- [-1143.392] (-1143.512) (-1144.956) (-1144.116) * (-1144.230) (-1143.354) (-1143.664) [-1143.581] -- 0:00:47
253000 -- (-1144.689) [-1143.476] (-1146.589) (-1142.588) * (-1144.366) (-1143.831) (-1144.175) [-1144.251] -- 0:00:47
253500 -- (-1144.603) [-1144.862] (-1143.370) (-1142.517) * (-1143.821) (-1143.317) [-1143.140] (-1142.639) -- 0:00:47
254000 -- [-1143.154] (-1143.430) (-1143.697) (-1144.937) * (-1142.478) (-1143.965) [-1141.943] (-1147.842) -- 0:00:49
254500 -- [-1143.420] (-1143.787) (-1144.175) (-1145.617) * (-1143.581) (-1142.657) [-1141.622] (-1145.331) -- 0:00:49
255000 -- (-1142.438) (-1145.227) [-1143.874] (-1143.199) * [-1143.299] (-1144.846) (-1143.463) (-1145.788) -- 0:00:49
Average standard deviation of split frequencies: 0.014081
255500 -- (-1142.633) (-1148.120) [-1141.850] (-1142.702) * (-1143.656) (-1146.532) [-1143.840] (-1143.670) -- 0:00:49
256000 -- (-1141.936) (-1145.834) [-1141.108] (-1141.989) * [-1141.286] (-1145.146) (-1143.724) (-1142.632) -- 0:00:49
256500 -- (-1143.066) [-1143.588] (-1143.945) (-1142.011) * (-1146.310) (-1143.590) [-1142.058] (-1142.661) -- 0:00:49
257000 -- (-1141.918) (-1144.004) (-1145.779) [-1141.963] * (-1142.943) (-1144.836) [-1142.234] (-1142.317) -- 0:00:49
257500 -- (-1142.372) [-1143.339] (-1146.438) (-1144.281) * (-1142.204) [-1143.468] (-1142.137) (-1141.919) -- 0:00:49
258000 -- (-1146.048) (-1144.989) (-1144.841) [-1143.121] * (-1142.970) (-1144.266) [-1142.528] (-1141.858) -- 0:00:48
258500 -- (-1142.926) [-1142.925] (-1145.991) (-1143.222) * [-1145.879] (-1144.356) (-1141.801) (-1141.821) -- 0:00:48
259000 -- [-1142.171] (-1144.121) (-1144.573) (-1142.101) * (-1143.630) (-1143.431) (-1146.234) [-1142.086] -- 0:00:48
259500 -- (-1141.209) (-1141.667) (-1144.505) [-1141.619] * (-1146.237) (-1142.051) [-1143.432] (-1144.451) -- 0:00:48
260000 -- (-1142.006) (-1143.808) (-1143.569) [-1143.201] * (-1147.612) [-1142.761] (-1142.973) (-1144.511) -- 0:00:48
Average standard deviation of split frequencies: 0.013404
260500 -- (-1141.977) (-1143.250) (-1142.188) [-1143.717] * [-1145.120] (-1144.504) (-1142.828) (-1144.762) -- 0:00:48
261000 -- (-1143.170) (-1144.751) (-1141.735) [-1141.589] * (-1148.666) (-1142.139) [-1142.182] (-1145.008) -- 0:00:48
261500 -- (-1143.277) [-1142.270] (-1143.351) (-1141.783) * (-1145.125) [-1141.618] (-1143.590) (-1143.540) -- 0:00:48
262000 -- (-1141.954) (-1146.994) (-1143.847) [-1141.751] * (-1144.256) [-1141.144] (-1144.296) (-1143.047) -- 0:00:47
262500 -- (-1142.954) (-1142.315) (-1146.278) [-1141.561] * (-1142.644) [-1142.121] (-1143.575) (-1143.687) -- 0:00:47
263000 -- (-1141.905) [-1141.837] (-1142.838) (-1141.561) * (-1142.387) (-1145.139) [-1143.428] (-1146.308) -- 0:00:47
263500 -- (-1142.642) [-1142.151] (-1141.917) (-1143.541) * (-1142.745) [-1145.109] (-1144.651) (-1143.859) -- 0:00:47
264000 -- (-1143.678) [-1145.144] (-1142.245) (-1143.702) * (-1144.159) (-1144.983) [-1142.684] (-1142.714) -- 0:00:47
264500 -- (-1142.161) (-1141.518) (-1142.836) [-1141.586] * (-1141.044) (-1144.722) [-1143.671] (-1144.532) -- 0:00:47
265000 -- (-1142.626) [-1141.548] (-1142.892) (-1143.401) * (-1141.727) [-1143.971] (-1143.041) (-1144.789) -- 0:00:47
Average standard deviation of split frequencies: 0.013239
265500 -- (-1143.897) (-1143.298) (-1142.798) [-1141.745] * [-1141.997] (-1143.735) (-1143.587) (-1143.888) -- 0:00:47
266000 -- (-1143.689) (-1142.849) (-1144.783) [-1144.500] * [-1141.040] (-1143.704) (-1147.244) (-1146.855) -- 0:00:46
266500 -- (-1145.292) (-1142.978) (-1146.302) [-1143.215] * [-1142.015] (-1141.381) (-1145.275) (-1143.743) -- 0:00:46
267000 -- [-1144.275] (-1143.028) (-1144.644) (-1143.267) * (-1141.427) [-1141.605] (-1144.364) (-1142.182) -- 0:00:46
267500 -- [-1145.323] (-1142.567) (-1141.749) (-1143.384) * (-1142.278) (-1141.145) [-1144.430] (-1143.385) -- 0:00:46
268000 -- (-1144.341) (-1142.248) (-1141.922) [-1143.044] * [-1143.932] (-1141.529) (-1146.819) (-1143.045) -- 0:00:46
268500 -- (-1145.710) (-1142.143) [-1143.165] (-1145.591) * (-1142.776) (-1144.927) (-1146.386) [-1141.996] -- 0:00:46
269000 -- (-1147.358) (-1142.246) (-1142.567) [-1146.674] * (-1141.539) (-1144.204) [-1144.110] (-1141.750) -- 0:00:48
269500 -- (-1143.811) [-1142.335] (-1141.581) (-1147.611) * (-1142.670) (-1142.597) (-1142.646) [-1141.462] -- 0:00:48
270000 -- (-1143.284) [-1143.646] (-1141.268) (-1144.011) * (-1141.877) (-1143.339) (-1142.435) [-1141.633] -- 0:00:48
Average standard deviation of split frequencies: 0.012579
270500 -- [-1144.364] (-1143.356) (-1141.956) (-1153.078) * (-1144.548) (-1144.130) (-1142.400) [-1141.533] -- 0:00:48
271000 -- (-1147.976) [-1143.252] (-1142.725) (-1145.146) * (-1145.882) (-1143.738) (-1146.690) [-1142.138] -- 0:00:48
271500 -- [-1144.305] (-1146.025) (-1142.322) (-1145.663) * (-1141.981) (-1145.431) [-1142.532] (-1141.641) -- 0:00:48
272000 -- (-1143.787) (-1144.057) [-1141.886] (-1145.056) * (-1141.585) (-1145.601) (-1146.879) [-1144.703] -- 0:00:48
272500 -- [-1144.081] (-1143.087) (-1142.773) (-1146.929) * (-1142.805) (-1143.345) [-1142.086] (-1146.479) -- 0:00:48
273000 -- (-1144.377) (-1141.339) [-1141.494] (-1143.882) * (-1141.961) [-1145.101] (-1142.319) (-1143.028) -- 0:00:47
273500 -- (-1144.630) (-1141.037) (-1142.046) [-1144.248] * (-1142.471) (-1143.265) (-1146.437) [-1141.816] -- 0:00:47
274000 -- (-1142.761) (-1143.362) [-1142.434] (-1145.839) * (-1143.033) (-1142.975) (-1143.793) [-1143.319] -- 0:00:47
274500 -- (-1145.854) [-1143.986] (-1142.326) (-1143.517) * (-1146.708) (-1142.849) [-1143.893] (-1141.087) -- 0:00:47
275000 -- (-1145.648) (-1143.751) [-1142.161] (-1144.341) * (-1143.614) (-1145.735) [-1143.726] (-1143.238) -- 0:00:47
Average standard deviation of split frequencies: 0.011956
275500 -- [-1143.804] (-1142.033) (-1141.998) (-1148.723) * (-1144.456) (-1143.979) [-1143.363] (-1145.916) -- 0:00:47
276000 -- (-1145.415) (-1141.992) (-1144.923) [-1141.954] * (-1143.643) [-1143.652] (-1144.115) (-1145.201) -- 0:00:47
276500 -- (-1143.051) (-1143.908) [-1141.803] (-1143.257) * (-1143.883) [-1144.989] (-1143.677) (-1144.260) -- 0:00:47
277000 -- (-1141.662) (-1146.931) (-1146.863) [-1141.141] * (-1143.524) (-1142.599) (-1141.098) [-1143.292] -- 0:00:46
277500 -- [-1142.117] (-1142.249) (-1145.304) (-1143.193) * [-1143.875] (-1143.847) (-1141.072) (-1141.719) -- 0:00:46
278000 -- (-1141.731) (-1143.099) [-1147.372] (-1141.116) * (-1144.022) (-1144.340) (-1142.496) [-1142.461] -- 0:00:46
278500 -- [-1142.585] (-1146.316) (-1142.635) (-1141.693) * (-1143.985) (-1142.469) (-1143.525) [-1141.628] -- 0:00:46
279000 -- (-1145.028) (-1142.914) (-1142.441) [-1142.023] * [-1142.422] (-1141.456) (-1144.582) (-1143.601) -- 0:00:46
279500 -- (-1144.639) (-1141.687) [-1142.578] (-1142.769) * (-1141.685) (-1145.491) (-1142.763) [-1144.599] -- 0:00:46
280000 -- (-1144.451) [-1143.235] (-1142.241) (-1142.731) * (-1144.001) (-1141.712) (-1141.575) [-1141.502] -- 0:00:46
Average standard deviation of split frequencies: 0.011856
280500 -- [-1143.806] (-1145.794) (-1143.648) (-1141.572) * [-1144.556] (-1143.003) (-1141.789) (-1141.555) -- 0:00:46
281000 -- [-1146.143] (-1145.415) (-1149.012) (-1147.164) * (-1143.938) (-1142.713) (-1141.787) [-1141.343] -- 0:00:46
281500 -- [-1143.096] (-1145.052) (-1149.562) (-1146.745) * (-1141.610) (-1142.386) [-1141.366] (-1141.871) -- 0:00:45
282000 -- (-1145.773) (-1143.959) (-1146.640) [-1143.622] * (-1141.606) (-1143.086) [-1143.107] (-1145.877) -- 0:00:45
282500 -- (-1146.940) (-1145.279) [-1143.478] (-1142.586) * (-1144.689) [-1142.592] (-1145.918) (-1143.256) -- 0:00:45
283000 -- (-1150.500) (-1143.258) [-1144.764] (-1148.643) * (-1145.718) (-1143.500) [-1145.123] (-1143.585) -- 0:00:45
283500 -- [-1146.098] (-1144.298) (-1142.322) (-1148.920) * (-1142.706) [-1142.654] (-1142.465) (-1147.189) -- 0:00:45
284000 -- (-1142.736) [-1142.466] (-1144.249) (-1146.688) * (-1141.545) (-1141.823) (-1142.389) [-1145.809] -- 0:00:45
284500 -- (-1142.722) (-1142.357) [-1143.242] (-1141.305) * (-1142.861) (-1143.564) [-1143.975] (-1147.272) -- 0:00:45
285000 -- (-1142.596) (-1143.739) (-1146.059) [-1143.989] * (-1141.612) (-1148.139) [-1146.511] (-1144.335) -- 0:00:47
Average standard deviation of split frequencies: 0.011355
285500 -- [-1141.562] (-1141.982) (-1144.613) (-1144.706) * (-1142.273) (-1147.352) (-1146.789) [-1143.130] -- 0:00:47
286000 -- (-1143.189) (-1144.485) [-1142.710] (-1145.499) * (-1141.838) [-1142.757] (-1143.471) (-1142.987) -- 0:00:47
286500 -- (-1144.503) [-1143.335] (-1146.166) (-1142.524) * (-1141.229) (-1141.716) [-1143.006] (-1143.179) -- 0:00:47
287000 -- (-1151.035) [-1142.704] (-1144.418) (-1145.934) * (-1141.497) (-1141.749) [-1141.471] (-1145.288) -- 0:00:47
287500 -- (-1146.132) [-1143.230] (-1145.082) (-1147.227) * (-1141.624) (-1144.565) (-1141.471) [-1142.206] -- 0:00:47
288000 -- (-1144.607) (-1144.112) [-1144.416] (-1144.666) * (-1141.521) (-1141.607) [-1141.025] (-1142.960) -- 0:00:46
288500 -- [-1142.880] (-1142.026) (-1146.845) (-1145.848) * (-1145.762) (-1150.051) [-1141.024] (-1143.313) -- 0:00:46
289000 -- (-1142.453) (-1142.924) [-1143.920] (-1145.197) * (-1143.444) (-1148.329) (-1142.908) [-1143.562] -- 0:00:46
289500 -- (-1143.330) (-1142.461) [-1142.251] (-1145.364) * (-1143.257) [-1144.079] (-1143.556) (-1142.911) -- 0:00:46
290000 -- [-1142.148] (-1144.206) (-1143.755) (-1146.246) * (-1143.831) [-1142.216] (-1143.687) (-1143.263) -- 0:00:46
Average standard deviation of split frequencies: 0.011263
290500 -- (-1143.234) (-1143.265) [-1144.446] (-1142.898) * (-1145.915) (-1142.558) (-1144.067) [-1144.047] -- 0:00:46
291000 -- (-1143.663) (-1141.793) [-1141.109] (-1143.800) * (-1146.950) [-1143.186] (-1142.002) (-1143.690) -- 0:00:46
291500 -- (-1141.579) (-1142.133) [-1146.748] (-1141.485) * (-1143.347) [-1143.958] (-1143.385) (-1144.159) -- 0:00:46
292000 -- (-1143.424) (-1143.758) [-1145.202] (-1141.938) * (-1143.667) [-1144.250] (-1144.372) (-1143.866) -- 0:00:46
292500 -- (-1143.067) (-1143.118) [-1142.848] (-1142.416) * (-1147.947) (-1145.952) (-1143.291) [-1143.129] -- 0:00:45
293000 -- (-1143.454) [-1142.614] (-1144.504) (-1143.328) * (-1142.128) (-1146.349) (-1141.354) [-1141.623] -- 0:00:45
293500 -- (-1144.368) (-1142.932) (-1146.445) [-1143.430] * (-1145.526) (-1146.546) [-1143.773] (-1142.753) -- 0:00:45
294000 -- (-1146.480) [-1147.993] (-1144.632) (-1143.115) * (-1145.539) (-1146.734) (-1143.060) [-1142.943] -- 0:00:45
294500 -- (-1145.973) (-1143.600) [-1145.745] (-1142.135) * (-1143.984) (-1143.411) (-1144.440) [-1144.832] -- 0:00:45
295000 -- (-1149.233) [-1146.484] (-1144.680) (-1142.636) * (-1142.450) (-1148.574) (-1143.071) [-1141.970] -- 0:00:45
Average standard deviation of split frequencies: 0.011429
295500 -- (-1150.753) [-1144.504] (-1146.284) (-1143.939) * [-1145.518] (-1146.525) (-1142.811) (-1141.779) -- 0:00:45
296000 -- [-1144.379] (-1141.786) (-1142.925) (-1145.028) * (-1145.073) (-1143.031) [-1144.779] (-1144.664) -- 0:00:45
296500 -- (-1143.391) (-1143.679) [-1142.968] (-1142.218) * (-1144.199) (-1144.912) (-1142.537) [-1147.589] -- 0:00:45
297000 -- [-1143.867] (-1144.018) (-1144.759) (-1145.115) * [-1142.258] (-1141.741) (-1142.899) (-1144.345) -- 0:00:44
297500 -- (-1144.813) (-1143.653) [-1142.806] (-1147.173) * (-1143.914) [-1141.674] (-1143.042) (-1146.465) -- 0:00:44
298000 -- (-1142.998) [-1143.856] (-1144.942) (-1142.391) * (-1154.889) (-1142.564) (-1149.944) [-1143.587] -- 0:00:44
298500 -- (-1143.612) (-1144.427) (-1141.717) [-1143.404] * (-1147.170) [-1143.947] (-1145.817) (-1143.134) -- 0:00:44
299000 -- (-1143.759) (-1147.701) (-1141.748) [-1141.281] * [-1143.530] (-1143.675) (-1143.769) (-1142.256) -- 0:00:44
299500 -- (-1141.484) (-1147.414) (-1141.805) [-1142.331] * (-1143.599) (-1142.107) [-1147.384] (-1143.445) -- 0:00:44
300000 -- (-1142.809) (-1144.848) [-1142.287] (-1143.540) * (-1143.889) [-1142.847] (-1144.929) (-1143.738) -- 0:00:44
Average standard deviation of split frequencies: 0.012266
300500 -- (-1146.343) [-1143.682] (-1149.296) (-1150.135) * (-1144.091) (-1146.428) (-1143.487) [-1143.248] -- 0:00:46
301000 -- (-1145.186) (-1145.426) (-1144.508) [-1145.967] * (-1142.569) [-1148.667] (-1144.311) (-1144.090) -- 0:00:46
301500 -- (-1143.079) (-1145.426) (-1142.511) [-1143.707] * (-1144.398) [-1145.681] (-1146.154) (-1145.381) -- 0:00:46
302000 -- (-1142.689) (-1145.757) (-1143.149) [-1147.021] * (-1142.554) (-1143.864) [-1143.396] (-1144.465) -- 0:00:46
302500 -- [-1142.315] (-1142.412) (-1143.903) (-1142.538) * (-1143.154) [-1142.191] (-1143.812) (-1146.368) -- 0:00:46
303000 -- (-1142.262) (-1143.212) [-1143.371] (-1141.986) * (-1144.086) (-1141.262) (-1143.566) [-1146.542] -- 0:00:46
303500 -- [-1141.343] (-1142.304) (-1144.310) (-1143.693) * (-1144.171) (-1144.901) [-1143.515] (-1142.532) -- 0:00:45
304000 -- (-1141.428) (-1144.867) (-1144.018) [-1142.186] * [-1143.358] (-1144.688) (-1151.684) (-1141.693) -- 0:00:45
304500 -- [-1146.517] (-1141.638) (-1144.104) (-1143.014) * (-1144.361) [-1143.780] (-1149.918) (-1145.470) -- 0:00:45
305000 -- (-1141.510) [-1144.560] (-1143.704) (-1142.269) * (-1146.162) (-1146.604) (-1144.101) [-1142.844] -- 0:00:45
Average standard deviation of split frequencies: 0.011896
305500 -- (-1143.671) (-1147.270) [-1142.754] (-1142.849) * (-1145.031) (-1146.832) [-1143.647] (-1145.095) -- 0:00:45
306000 -- (-1143.977) (-1142.780) [-1143.194] (-1142.534) * [-1143.704] (-1144.405) (-1145.544) (-1144.599) -- 0:00:45
306500 -- (-1143.132) [-1142.719] (-1142.930) (-1149.531) * (-1148.470) (-1142.879) [-1145.311] (-1141.682) -- 0:00:45
307000 -- (-1144.209) [-1142.997] (-1143.023) (-1147.359) * (-1145.668) [-1141.731] (-1143.913) (-1141.140) -- 0:00:45
307500 -- [-1143.745] (-1143.446) (-1145.840) (-1143.097) * [-1144.868] (-1141.827) (-1143.155) (-1141.418) -- 0:00:45
308000 -- (-1142.068) [-1143.255] (-1145.908) (-1142.705) * (-1141.738) (-1142.586) [-1142.996] (-1144.099) -- 0:00:44
308500 -- (-1143.304) (-1144.365) (-1149.737) [-1142.221] * (-1142.069) (-1144.508) [-1142.863] (-1142.009) -- 0:00:44
309000 -- (-1141.720) (-1143.149) (-1144.511) [-1143.372] * [-1141.882] (-1147.745) (-1143.991) (-1143.886) -- 0:00:44
309500 -- [-1145.205] (-1143.043) (-1143.070) (-1143.684) * (-1142.222) (-1147.133) [-1142.086] (-1145.428) -- 0:00:44
310000 -- (-1149.533) [-1147.046] (-1148.242) (-1143.528) * (-1142.665) (-1147.349) [-1142.988] (-1145.088) -- 0:00:44
Average standard deviation of split frequencies: 0.012219
310500 -- (-1147.830) (-1144.551) (-1146.289) [-1142.557] * (-1141.933) [-1145.380] (-1146.054) (-1142.507) -- 0:00:44
311000 -- (-1146.676) [-1143.163] (-1143.813) (-1145.030) * (-1141.662) [-1143.175] (-1144.843) (-1142.291) -- 0:00:44
311500 -- (-1144.559) (-1141.418) (-1146.927) [-1144.220] * (-1141.662) (-1143.065) [-1141.870] (-1146.588) -- 0:00:44
312000 -- [-1141.750] (-1143.141) (-1143.930) (-1143.740) * (-1141.838) [-1142.089] (-1142.536) (-1144.700) -- 0:00:44
312500 -- [-1141.381] (-1143.561) (-1142.830) (-1143.520) * [-1143.154] (-1146.499) (-1145.535) (-1142.332) -- 0:00:44
313000 -- (-1143.550) [-1143.346] (-1143.606) (-1143.086) * [-1143.945] (-1148.431) (-1144.435) (-1143.198) -- 0:00:43
313500 -- (-1142.828) (-1148.209) (-1143.144) [-1142.330] * (-1146.527) [-1143.769] (-1144.780) (-1144.459) -- 0:00:43
314000 -- (-1142.828) (-1145.283) [-1142.311] (-1142.561) * (-1147.849) (-1142.613) (-1147.606) [-1144.843] -- 0:00:43
314500 -- [-1142.817] (-1147.628) (-1144.682) (-1143.155) * [-1145.277] (-1142.160) (-1143.316) (-1144.744) -- 0:00:43
315000 -- [-1146.177] (-1147.682) (-1142.122) (-1142.909) * (-1147.591) (-1142.656) [-1142.972] (-1146.745) -- 0:00:43
Average standard deviation of split frequencies: 0.012461
315500 -- (-1141.675) [-1144.559] (-1142.637) (-1144.627) * (-1145.538) (-1144.128) (-1142.144) [-1145.409] -- 0:00:43
316000 -- (-1146.115) [-1142.121] (-1142.145) (-1144.605) * (-1142.896) [-1142.938] (-1142.934) (-1147.388) -- 0:00:43
316500 -- (-1144.399) (-1144.735) (-1144.481) [-1143.314] * (-1146.410) [-1143.010] (-1142.054) (-1143.622) -- 0:00:43
317000 -- (-1144.584) (-1144.323) [-1141.159] (-1146.408) * (-1150.444) (-1144.262) (-1141.935) [-1144.351] -- 0:00:45
317500 -- (-1141.496) (-1143.292) [-1141.322] (-1145.254) * (-1142.119) [-1143.132] (-1143.691) (-1143.734) -- 0:00:45
318000 -- (-1141.392) [-1142.739] (-1144.658) (-1145.314) * (-1143.963) [-1142.936] (-1147.737) (-1142.477) -- 0:00:45
318500 -- [-1142.906] (-1145.089) (-1141.769) (-1143.567) * (-1143.555) (-1147.682) [-1143.252] (-1144.264) -- 0:00:44
319000 -- (-1144.070) (-1145.582) (-1143.879) [-1144.337] * (-1142.559) (-1144.992) (-1144.784) [-1143.787] -- 0:00:44
319500 -- [-1141.928] (-1144.467) (-1141.986) (-1143.172) * (-1143.231) (-1144.261) (-1143.504) [-1142.384] -- 0:00:44
320000 -- (-1144.838) (-1146.564) (-1141.919) [-1144.228] * (-1145.117) (-1147.474) [-1145.225] (-1142.300) -- 0:00:44
Average standard deviation of split frequencies: 0.011924
320500 -- (-1144.034) [-1141.289] (-1142.036) (-1143.664) * [-1143.817] (-1146.406) (-1148.530) (-1141.799) -- 0:00:44
321000 -- (-1147.914) (-1141.704) [-1141.336] (-1144.602) * (-1145.007) [-1143.451] (-1143.917) (-1143.605) -- 0:00:44
321500 -- (-1148.701) [-1142.301] (-1142.642) (-1143.978) * (-1142.124) (-1143.332) [-1144.435] (-1144.939) -- 0:00:44
322000 -- (-1144.404) (-1142.553) [-1142.028] (-1143.660) * [-1145.332] (-1141.947) (-1144.251) (-1141.478) -- 0:00:44
322500 -- (-1144.006) (-1144.261) [-1142.577] (-1143.274) * (-1142.347) (-1143.078) (-1142.291) [-1141.863] -- 0:00:44
323000 -- [-1141.988] (-1150.082) (-1143.551) (-1144.578) * (-1142.859) (-1141.571) [-1141.894] (-1141.402) -- 0:00:44
323500 -- [-1142.374] (-1143.063) (-1145.279) (-1144.769) * [-1141.116] (-1143.727) (-1141.827) (-1142.792) -- 0:00:43
324000 -- (-1142.811) (-1141.471) (-1143.460) [-1143.144] * [-1141.183] (-1142.104) (-1150.499) (-1150.058) -- 0:00:43
324500 -- (-1143.761) [-1141.907] (-1142.693) (-1144.267) * [-1142.098] (-1142.783) (-1141.958) (-1144.583) -- 0:00:43
325000 -- (-1141.944) [-1141.946] (-1147.551) (-1141.937) * (-1142.940) [-1143.317] (-1141.965) (-1146.685) -- 0:00:43
Average standard deviation of split frequencies: 0.012211
325500 -- (-1142.046) (-1142.530) [-1143.951] (-1145.652) * (-1143.219) (-1143.211) [-1141.972] (-1144.506) -- 0:00:43
326000 -- [-1142.580] (-1143.276) (-1142.801) (-1143.168) * (-1142.660) (-1142.409) (-1141.791) [-1142.358] -- 0:00:43
326500 -- (-1145.875) (-1142.353) (-1141.756) [-1144.025] * [-1145.373] (-1143.123) (-1141.079) (-1141.588) -- 0:00:43
327000 -- (-1142.931) [-1142.779] (-1142.418) (-1144.608) * (-1144.352) (-1142.993) [-1141.674] (-1141.173) -- 0:00:43
327500 -- (-1145.302) (-1142.933) [-1142.038] (-1144.748) * (-1144.319) (-1142.386) (-1141.671) [-1142.056] -- 0:00:43
328000 -- [-1143.054] (-1142.926) (-1142.018) (-1145.123) * [-1142.237] (-1146.206) (-1142.869) (-1142.504) -- 0:00:43
328500 -- [-1143.524] (-1144.354) (-1141.137) (-1145.070) * [-1146.796] (-1143.749) (-1142.952) (-1143.585) -- 0:00:42
329000 -- (-1145.008) (-1142.280) [-1141.134] (-1142.260) * [-1143.469] (-1141.998) (-1142.893) (-1142.710) -- 0:00:42
329500 -- (-1146.663) [-1142.937] (-1141.179) (-1145.706) * (-1143.018) (-1141.554) (-1142.609) [-1144.074] -- 0:00:42
330000 -- (-1145.048) [-1148.198] (-1142.282) (-1145.872) * (-1142.121) [-1141.772] (-1142.456) (-1146.654) -- 0:00:42
Average standard deviation of split frequencies: 0.012244
330500 -- (-1143.667) (-1149.849) [-1143.106] (-1142.451) * (-1141.428) (-1141.633) [-1143.355] (-1144.384) -- 0:00:42
331000 -- [-1143.309] (-1144.614) (-1141.398) (-1142.907) * (-1143.345) (-1141.155) [-1141.488] (-1144.158) -- 0:00:42
331500 -- (-1147.866) (-1144.412) [-1142.424] (-1144.613) * [-1143.432] (-1142.020) (-1143.590) (-1148.296) -- 0:00:42
332000 -- (-1147.195) (-1142.373) (-1144.434) [-1144.662] * (-1142.831) (-1142.977) (-1146.357) [-1143.821] -- 0:00:42
332500 -- (-1143.599) [-1144.783] (-1144.106) (-1144.019) * [-1142.120] (-1144.490) (-1141.591) (-1141.674) -- 0:00:42
333000 -- [-1144.729] (-1142.640) (-1144.735) (-1141.907) * (-1142.016) (-1142.234) (-1145.392) [-1141.672] -- 0:00:44
333500 -- [-1143.740] (-1141.975) (-1143.134) (-1144.689) * (-1142.162) (-1142.185) (-1145.514) [-1141.812] -- 0:00:43
334000 -- (-1145.422) (-1146.323) [-1143.990] (-1144.962) * [-1145.404] (-1147.179) (-1145.955) (-1144.553) -- 0:00:43
334500 -- [-1142.232] (-1146.497) (-1143.129) (-1142.260) * (-1145.094) (-1144.257) (-1142.252) [-1142.269] -- 0:00:43
335000 -- [-1142.434] (-1143.031) (-1144.784) (-1142.568) * (-1144.195) (-1144.322) (-1142.062) [-1144.218] -- 0:00:43
Average standard deviation of split frequencies: 0.013562
335500 -- (-1143.513) [-1145.432] (-1142.278) (-1143.558) * (-1144.912) (-1146.453) [-1142.045] (-1147.489) -- 0:00:43
336000 -- [-1142.152] (-1143.931) (-1142.932) (-1143.552) * [-1143.714] (-1148.758) (-1142.672) (-1142.433) -- 0:00:43
336500 -- [-1142.628] (-1144.349) (-1143.926) (-1141.822) * (-1142.636) (-1142.696) [-1143.760] (-1142.844) -- 0:00:43
337000 -- (-1142.727) (-1143.040) [-1142.609] (-1146.651) * (-1143.174) (-1141.444) [-1143.592] (-1143.149) -- 0:00:43
337500 -- (-1141.601) (-1142.231) (-1141.403) [-1142.424] * (-1142.565) [-1141.297] (-1143.001) (-1142.013) -- 0:00:43
338000 -- (-1143.478) (-1144.349) [-1143.675] (-1142.822) * (-1143.564) (-1141.271) [-1141.333] (-1146.280) -- 0:00:43
338500 -- [-1141.095] (-1145.515) (-1142.900) (-1145.224) * (-1149.855) (-1144.619) [-1141.744] (-1146.852) -- 0:00:42
339000 -- [-1141.544] (-1147.433) (-1144.330) (-1142.038) * (-1143.746) [-1142.365] (-1141.556) (-1144.753) -- 0:00:42
339500 -- (-1141.609) (-1144.677) (-1146.710) [-1142.029] * (-1144.229) [-1144.136] (-1143.645) (-1147.838) -- 0:00:42
340000 -- [-1142.457] (-1144.318) (-1144.572) (-1146.229) * (-1143.756) (-1146.884) [-1142.620] (-1144.653) -- 0:00:42
Average standard deviation of split frequencies: 0.013453
340500 -- [-1145.092] (-1143.724) (-1146.216) (-1147.831) * (-1141.710) (-1148.088) (-1141.831) [-1142.740] -- 0:00:42
341000 -- (-1146.281) [-1143.726] (-1143.859) (-1148.447) * (-1142.046) (-1143.762) [-1143.053] (-1144.633) -- 0:00:42
341500 -- (-1147.706) [-1144.564] (-1143.829) (-1145.477) * (-1144.540) [-1142.844] (-1144.422) (-1143.196) -- 0:00:42
342000 -- [-1142.988] (-1142.798) (-1141.774) (-1144.160) * (-1144.286) (-1144.399) (-1144.325) [-1142.104] -- 0:00:42
342500 -- [-1142.236] (-1143.691) (-1143.860) (-1147.951) * (-1146.931) [-1142.836] (-1143.924) (-1143.134) -- 0:00:42
343000 -- [-1142.019] (-1141.632) (-1142.737) (-1144.831) * (-1145.007) [-1144.753] (-1142.882) (-1144.728) -- 0:00:42
343500 -- (-1143.678) (-1144.643) [-1142.927] (-1144.133) * (-1142.308) (-1143.408) (-1142.957) [-1143.556] -- 0:00:42
344000 -- (-1144.649) (-1146.841) [-1143.299] (-1143.070) * [-1142.687] (-1141.585) (-1142.986) (-1145.466) -- 0:00:41
344500 -- (-1145.390) (-1145.265) [-1142.083] (-1144.473) * (-1142.110) (-1142.545) [-1144.823] (-1144.873) -- 0:00:41
345000 -- (-1146.023) (-1143.801) (-1142.247) [-1141.861] * (-1142.114) (-1142.991) (-1149.460) [-1144.342] -- 0:00:41
Average standard deviation of split frequencies: 0.012565
345500 -- (-1142.657) (-1143.483) (-1142.682) [-1142.355] * (-1143.274) (-1143.029) (-1146.235) [-1142.547] -- 0:00:41
346000 -- (-1148.568) (-1145.881) (-1142.628) [-1143.021] * (-1146.003) [-1148.770] (-1143.522) (-1141.988) -- 0:00:41
346500 -- [-1149.286] (-1145.056) (-1142.586) (-1142.347) * (-1142.022) (-1143.029) (-1142.602) [-1141.907] -- 0:00:41
347000 -- [-1142.508] (-1142.555) (-1145.480) (-1141.908) * (-1141.899) (-1145.792) (-1142.999) [-1145.538] -- 0:00:41
347500 -- (-1142.431) [-1144.239] (-1147.554) (-1141.184) * (-1143.067) (-1141.982) (-1142.531) [-1145.841] -- 0:00:41
348000 -- [-1141.608] (-1145.197) (-1149.856) (-1143.168) * [-1141.424] (-1142.171) (-1144.370) (-1144.097) -- 0:00:41
348500 -- (-1143.782) (-1150.173) (-1144.945) [-1142.700] * (-1144.254) (-1143.086) (-1145.023) [-1141.968] -- 0:00:41
349000 -- (-1145.075) [-1143.052] (-1143.174) (-1143.729) * [-1143.072] (-1145.253) (-1142.511) (-1143.841) -- 0:00:41
349500 -- [-1147.953] (-1145.613) (-1143.474) (-1143.193) * (-1142.836) (-1143.835) (-1146.638) [-1145.072] -- 0:00:42
350000 -- (-1147.515) (-1145.371) [-1145.046] (-1142.382) * (-1146.460) [-1142.299] (-1144.817) (-1144.226) -- 0:00:42
Average standard deviation of split frequencies: 0.012846
350500 -- [-1141.771] (-1142.977) (-1143.820) (-1143.056) * (-1141.372) (-1141.877) (-1143.109) [-1143.369] -- 0:00:42
351000 -- (-1151.273) (-1142.969) [-1144.565] (-1142.287) * (-1144.519) [-1142.670] (-1142.994) (-1141.943) -- 0:00:42
351500 -- [-1141.830] (-1144.167) (-1148.218) (-1146.300) * [-1145.102] (-1144.277) (-1143.594) (-1141.856) -- 0:00:42
352000 -- (-1142.801) [-1144.391] (-1149.251) (-1143.755) * (-1146.453) (-1143.322) (-1142.823) [-1141.754] -- 0:00:42
352500 -- [-1143.573] (-1143.946) (-1143.367) (-1144.432) * (-1146.754) (-1146.616) (-1141.868) [-1143.732] -- 0:00:42
353000 -- (-1142.482) (-1145.043) (-1144.014) [-1147.929] * (-1141.959) (-1146.422) (-1142.391) [-1143.513] -- 0:00:42
353500 -- [-1142.539] (-1143.765) (-1146.633) (-1144.559) * (-1141.803) [-1141.715] (-1142.296) (-1143.024) -- 0:00:42
354000 -- (-1141.178) (-1146.940) (-1141.754) [-1141.931] * (-1142.989) [-1142.569] (-1143.665) (-1143.493) -- 0:00:41
354500 -- (-1142.290) [-1141.970] (-1141.989) (-1141.842) * (-1142.175) (-1142.694) (-1144.071) [-1143.744] -- 0:00:41
355000 -- (-1143.954) (-1141.991) [-1141.934] (-1141.129) * (-1144.297) (-1142.745) [-1146.299] (-1143.079) -- 0:00:41
Average standard deviation of split frequencies: 0.013021
355500 -- (-1142.375) (-1143.076) [-1142.261] (-1142.324) * (-1148.929) [-1144.234] (-1145.073) (-1144.294) -- 0:00:41
356000 -- (-1144.497) (-1143.889) [-1144.007] (-1143.332) * [-1141.997] (-1144.443) (-1144.401) (-1145.677) -- 0:00:41
356500 -- (-1147.443) (-1143.092) (-1143.912) [-1143.439] * (-1142.480) [-1142.138] (-1145.619) (-1145.315) -- 0:00:41
357000 -- [-1146.962] (-1144.470) (-1143.429) (-1148.235) * (-1143.202) [-1142.256] (-1144.999) (-1143.543) -- 0:00:41
357500 -- (-1141.366) (-1143.913) [-1145.856] (-1148.958) * (-1145.917) [-1144.015] (-1143.502) (-1143.248) -- 0:00:41
358000 -- (-1144.565) (-1142.370) [-1143.002] (-1144.421) * [-1141.759] (-1142.465) (-1143.712) (-1143.618) -- 0:00:41
358500 -- [-1147.525] (-1144.558) (-1143.484) (-1144.703) * (-1147.289) [-1145.144] (-1144.470) (-1144.296) -- 0:00:41
359000 -- [-1142.871] (-1144.311) (-1142.080) (-1150.751) * (-1147.810) [-1142.688] (-1142.925) (-1144.263) -- 0:00:41
359500 -- (-1144.525) (-1145.162) [-1145.914] (-1144.495) * (-1148.538) (-1143.507) [-1146.316] (-1145.375) -- 0:00:40
360000 -- (-1143.677) (-1145.167) [-1149.540] (-1142.912) * (-1150.150) (-1147.015) [-1142.683] (-1148.703) -- 0:00:40
Average standard deviation of split frequencies: 0.013143
360500 -- (-1145.340) (-1144.989) (-1147.851) [-1144.497] * (-1141.825) (-1143.213) (-1143.580) [-1145.685] -- 0:00:40
361000 -- [-1143.991] (-1146.235) (-1143.287) (-1142.768) * [-1141.991] (-1145.663) (-1142.960) (-1141.696) -- 0:00:40
361500 -- [-1141.741] (-1145.991) (-1141.854) (-1144.129) * (-1141.900) [-1143.306] (-1142.746) (-1141.345) -- 0:00:40
362000 -- [-1141.686] (-1149.366) (-1142.465) (-1143.707) * [-1142.652] (-1144.431) (-1141.622) (-1141.318) -- 0:00:40
362500 -- [-1142.151] (-1144.512) (-1142.775) (-1142.214) * (-1142.452) (-1144.262) [-1142.706] (-1143.859) -- 0:00:40
363000 -- (-1142.581) (-1145.147) [-1143.184] (-1141.982) * (-1141.283) [-1146.695] (-1142.064) (-1142.174) -- 0:00:40
363500 -- (-1144.621) (-1144.407) (-1142.530) [-1142.293] * (-1144.653) [-1142.547] (-1144.117) (-1141.256) -- 0:00:40
364000 -- [-1142.148] (-1142.730) (-1143.952) (-1145.273) * (-1141.872) (-1142.006) (-1141.956) [-1141.799] -- 0:00:40
364500 -- [-1143.572] (-1142.799) (-1142.827) (-1145.943) * (-1144.308) (-1144.060) (-1142.263) [-1141.880] -- 0:00:40
365000 -- (-1142.171) [-1144.069] (-1143.185) (-1143.040) * (-1143.260) (-1141.960) [-1142.436] (-1144.210) -- 0:00:40
Average standard deviation of split frequencies: 0.012594
365500 -- (-1145.879) [-1143.219] (-1144.966) (-1147.559) * (-1141.712) (-1141.451) (-1142.109) [-1142.461] -- 0:00:41
366000 -- (-1143.905) [-1143.168] (-1142.650) (-1143.518) * [-1141.712] (-1142.280) (-1141.704) (-1142.050) -- 0:00:41
366500 -- (-1143.160) (-1143.858) (-1143.432) [-1143.942] * (-1143.715) (-1142.581) (-1141.226) [-1142.799] -- 0:00:41
367000 -- [-1144.865] (-1141.622) (-1142.463) (-1145.987) * (-1145.782) (-1142.176) (-1144.897) [-1141.435] -- 0:00:41
367500 -- [-1143.529] (-1141.748) (-1146.382) (-1142.800) * (-1142.301) (-1142.712) (-1145.468) [-1141.669] -- 0:00:41
368000 -- [-1142.119] (-1143.063) (-1142.635) (-1142.834) * [-1144.143] (-1142.351) (-1146.179) (-1145.714) -- 0:00:41
368500 -- [-1143.969] (-1141.657) (-1143.004) (-1144.489) * [-1145.165] (-1143.791) (-1141.922) (-1143.513) -- 0:00:41
369000 -- (-1146.494) (-1141.607) [-1143.261] (-1143.560) * (-1143.253) [-1147.684] (-1143.166) (-1144.881) -- 0:00:41
369500 -- [-1144.871] (-1143.675) (-1141.960) (-1143.922) * (-1143.032) [-1146.542] (-1143.132) (-1142.833) -- 0:00:40
370000 -- (-1142.554) (-1141.963) [-1153.737] (-1145.538) * (-1143.549) (-1148.172) (-1141.656) [-1145.807] -- 0:00:40
Average standard deviation of split frequencies: 0.011915
370500 -- (-1144.261) (-1144.734) [-1143.870] (-1145.690) * [-1142.053] (-1146.984) (-1142.062) (-1143.255) -- 0:00:40
371000 -- (-1142.770) (-1143.362) [-1147.194] (-1149.111) * (-1144.635) (-1144.117) (-1142.363) [-1142.474] -- 0:00:40
371500 -- [-1144.217] (-1143.474) (-1143.556) (-1145.122) * [-1143.331] (-1143.748) (-1144.032) (-1146.043) -- 0:00:40
372000 -- (-1143.287) [-1143.921] (-1143.709) (-1144.966) * (-1142.511) (-1143.009) (-1145.739) [-1142.464] -- 0:00:40
372500 -- (-1142.864) [-1148.025] (-1146.745) (-1143.666) * (-1144.035) [-1148.277] (-1142.062) (-1144.358) -- 0:00:40
373000 -- (-1142.334) (-1145.492) [-1144.760] (-1142.441) * [-1145.597] (-1144.361) (-1142.538) (-1143.952) -- 0:00:40
373500 -- (-1145.547) [-1144.109] (-1146.752) (-1145.966) * [-1143.463] (-1143.644) (-1142.538) (-1148.119) -- 0:00:40
374000 -- [-1145.605] (-1144.566) (-1146.749) (-1144.644) * (-1141.865) [-1142.226] (-1141.802) (-1146.434) -- 0:00:40
374500 -- (-1141.441) [-1143.450] (-1144.888) (-1144.501) * (-1141.450) [-1142.166] (-1144.924) (-1146.126) -- 0:00:40
375000 -- [-1143.176] (-1143.546) (-1143.734) (-1142.877) * (-1142.775) (-1142.173) (-1144.518) [-1143.273] -- 0:00:40
Average standard deviation of split frequencies: 0.012398
375500 -- (-1143.187) (-1142.804) [-1143.665] (-1143.279) * (-1143.606) [-1143.064] (-1141.661) (-1141.603) -- 0:00:39
376000 -- (-1143.793) [-1141.446] (-1145.511) (-1142.080) * (-1141.711) [-1142.134] (-1143.384) (-1143.941) -- 0:00:39
376500 -- (-1144.134) [-1142.873] (-1144.335) (-1142.994) * (-1142.641) [-1141.830] (-1143.286) (-1142.816) -- 0:00:39
377000 -- (-1141.819) (-1142.245) [-1142.289] (-1143.705) * [-1141.379] (-1142.463) (-1146.032) (-1143.999) -- 0:00:39
377500 -- (-1141.767) (-1142.089) (-1143.661) [-1143.579] * (-1144.119) (-1143.457) [-1142.616] (-1153.288) -- 0:00:39
378000 -- (-1143.101) [-1142.262] (-1146.236) (-1145.621) * (-1143.197) (-1142.499) [-1142.348] (-1146.675) -- 0:00:39
378500 -- [-1142.664] (-1149.454) (-1145.982) (-1146.799) * (-1143.810) (-1143.793) (-1145.617) [-1144.555] -- 0:00:39
379000 -- (-1143.332) (-1142.188) (-1143.304) [-1143.812] * (-1144.038) [-1143.308] (-1143.436) (-1143.606) -- 0:00:39
379500 -- (-1143.047) [-1143.499] (-1141.869) (-1142.658) * (-1144.796) (-1147.242) (-1143.416) [-1144.122] -- 0:00:39
380000 -- (-1143.542) (-1143.931) (-1142.585) [-1142.091] * (-1141.250) (-1144.420) (-1143.962) [-1143.183] -- 0:00:39
Average standard deviation of split frequencies: 0.011997
380500 -- (-1142.743) [-1142.931] (-1142.761) (-1146.551) * (-1143.199) [-1146.635] (-1143.876) (-1145.573) -- 0:00:39
381000 -- (-1142.149) [-1143.816] (-1145.255) (-1142.921) * (-1143.649) (-1141.005) [-1143.341] (-1146.431) -- 0:00:38
381500 -- (-1144.579) (-1144.460) (-1143.160) [-1142.813] * (-1142.921) [-1141.692] (-1143.303) (-1142.217) -- 0:00:40
382000 -- [-1141.586] (-1143.909) (-1143.504) (-1144.241) * (-1141.683) (-1145.015) (-1142.796) [-1142.124] -- 0:00:40
382500 -- (-1142.788) (-1146.263) (-1141.880) [-1143.816] * (-1141.619) [-1141.666] (-1144.884) (-1143.693) -- 0:00:40
383000 -- (-1142.762) (-1145.361) (-1144.052) [-1142.582] * (-1142.421) (-1143.524) [-1144.097] (-1141.669) -- 0:00:40
383500 -- (-1143.032) (-1142.757) [-1151.594] (-1142.311) * [-1141.735] (-1147.972) (-1143.364) (-1149.971) -- 0:00:40
384000 -- (-1146.068) [-1142.425] (-1146.928) (-1142.975) * [-1142.188] (-1144.434) (-1142.612) (-1143.133) -- 0:00:40
384500 -- (-1143.685) [-1142.454] (-1143.638) (-1143.046) * [-1141.756] (-1142.900) (-1142.724) (-1142.442) -- 0:00:40
385000 -- (-1144.305) [-1143.070] (-1143.849) (-1146.693) * (-1142.557) [-1142.443] (-1144.934) (-1142.168) -- 0:00:39
Average standard deviation of split frequencies: 0.012416
385500 -- [-1142.601] (-1143.264) (-1146.123) (-1142.024) * (-1143.683) [-1142.772] (-1144.101) (-1143.668) -- 0:00:39
386000 -- (-1141.637) [-1143.119] (-1147.521) (-1142.342) * [-1142.648] (-1142.375) (-1148.344) (-1144.439) -- 0:00:39
386500 -- [-1142.375] (-1145.224) (-1145.126) (-1145.729) * (-1143.173) (-1143.743) [-1143.012] (-1142.950) -- 0:00:39
387000 -- (-1143.819) [-1143.983] (-1145.001) (-1141.871) * (-1143.085) (-1143.846) (-1143.676) [-1142.594] -- 0:00:39
387500 -- (-1141.427) [-1143.025] (-1141.923) (-1143.957) * (-1145.712) [-1143.039] (-1142.626) (-1141.417) -- 0:00:39
388000 -- [-1141.863] (-1144.597) (-1146.303) (-1144.262) * (-1143.729) (-1141.863) [-1143.154] (-1141.092) -- 0:00:39
388500 -- (-1142.240) (-1144.432) [-1149.231] (-1143.770) * [-1143.224] (-1142.600) (-1142.944) (-1143.047) -- 0:00:39
389000 -- [-1141.975] (-1148.574) (-1144.767) (-1144.482) * (-1146.069) [-1141.637] (-1141.859) (-1141.671) -- 0:00:39
389500 -- (-1141.955) (-1146.340) (-1146.268) [-1146.569] * (-1143.570) (-1145.528) [-1147.408] (-1142.838) -- 0:00:39
390000 -- [-1142.012] (-1144.567) (-1145.095) (-1145.925) * (-1147.308) [-1143.864] (-1142.229) (-1143.585) -- 0:00:39
Average standard deviation of split frequencies: 0.012134
390500 -- (-1141.712) (-1145.276) [-1142.536] (-1146.198) * (-1144.095) (-1145.066) [-1141.552] (-1145.023) -- 0:00:39
391000 -- (-1143.085) [-1142.537] (-1142.537) (-1144.342) * (-1142.579) (-1146.262) [-1141.268] (-1142.148) -- 0:00:38
391500 -- [-1141.962] (-1143.347) (-1141.896) (-1141.961) * (-1144.895) (-1146.473) [-1142.065] (-1142.127) -- 0:00:38
392000 -- [-1143.301] (-1146.516) (-1143.912) (-1142.204) * [-1144.313] (-1145.425) (-1145.081) (-1142.501) -- 0:00:38
392500 -- [-1142.239] (-1143.546) (-1143.331) (-1141.990) * (-1150.090) (-1143.803) (-1142.306) [-1142.742] -- 0:00:38
393000 -- (-1143.232) (-1145.979) (-1141.581) [-1143.853] * (-1150.412) (-1142.069) [-1141.844] (-1141.879) -- 0:00:38
393500 -- (-1142.576) [-1144.583] (-1142.117) (-1143.675) * (-1144.670) (-1141.923) (-1141.546) [-1145.303] -- 0:00:38
394000 -- (-1142.785) [-1144.484] (-1145.033) (-1143.231) * [-1142.189] (-1141.446) (-1141.524) (-1143.115) -- 0:00:38
394500 -- (-1141.696) (-1142.577) [-1142.041] (-1152.492) * (-1151.366) (-1141.443) [-1141.815] (-1142.986) -- 0:00:38
395000 -- [-1141.595] (-1142.088) (-1142.164) (-1144.325) * (-1143.601) (-1142.941) (-1144.492) [-1142.200] -- 0:00:38
Average standard deviation of split frequencies: 0.011904
395500 -- [-1143.806] (-1142.342) (-1143.982) (-1142.788) * (-1147.542) (-1143.866) [-1146.339] (-1142.259) -- 0:00:38
396000 -- [-1141.429] (-1141.759) (-1144.411) (-1142.117) * (-1144.433) (-1143.817) (-1144.459) [-1142.468] -- 0:00:38
396500 -- (-1143.431) [-1146.244] (-1143.766) (-1141.949) * [-1142.541] (-1143.789) (-1142.024) (-1146.376) -- 0:00:38
397000 -- [-1143.956] (-1144.045) (-1142.936) (-1144.490) * (-1144.926) [-1145.718] (-1141.934) (-1146.113) -- 0:00:37
397500 -- (-1143.548) [-1141.721] (-1143.337) (-1142.922) * [-1147.088] (-1145.299) (-1141.410) (-1147.006) -- 0:00:39
398000 -- (-1144.679) [-1143.222] (-1144.188) (-1143.234) * [-1142.468] (-1144.891) (-1141.976) (-1146.086) -- 0:00:39
398500 -- (-1146.743) (-1142.794) [-1142.709] (-1142.749) * (-1143.674) (-1143.937) [-1144.361] (-1148.072) -- 0:00:39
399000 -- [-1146.938] (-1143.637) (-1144.016) (-1143.509) * (-1144.280) (-1144.788) (-1144.827) [-1144.467] -- 0:00:39
399500 -- (-1142.575) (-1144.707) (-1143.918) [-1145.891] * (-1146.362) (-1146.182) (-1143.636) [-1143.610] -- 0:00:39
400000 -- (-1141.731) (-1143.869) (-1142.682) [-1147.533] * [-1143.733] (-1143.571) (-1144.375) (-1142.219) -- 0:00:39
Average standard deviation of split frequencies: 0.013080
400500 -- (-1143.724) (-1144.576) [-1142.272] (-1144.852) * (-1144.350) (-1142.504) [-1144.896] (-1142.567) -- 0:00:38
401000 -- (-1144.262) (-1144.995) [-1141.530] (-1143.662) * [-1143.080] (-1144.247) (-1141.730) (-1141.530) -- 0:00:38
401500 -- (-1149.097) [-1142.843] (-1141.313) (-1144.522) * [-1145.116] (-1143.841) (-1141.760) (-1145.743) -- 0:00:38
402000 -- (-1147.561) [-1144.430] (-1141.312) (-1146.617) * (-1144.895) (-1142.522) (-1142.406) [-1145.477] -- 0:00:38
402500 -- (-1141.434) [-1146.573] (-1141.271) (-1147.128) * (-1144.735) (-1142.785) [-1142.411] (-1144.704) -- 0:00:38
403000 -- (-1142.815) [-1145.529] (-1142.571) (-1144.856) * (-1141.782) [-1141.721] (-1142.061) (-1144.067) -- 0:00:38
403500 -- [-1141.977] (-1147.019) (-1141.782) (-1143.915) * (-1142.119) (-1141.961) (-1144.683) [-1145.698] -- 0:00:38
404000 -- (-1143.485) (-1145.614) (-1141.635) [-1144.049] * (-1142.190) (-1142.063) [-1142.711] (-1145.336) -- 0:00:38
404500 -- (-1151.118) (-1144.004) (-1143.953) [-1144.096] * (-1149.221) (-1142.706) [-1142.737] (-1143.639) -- 0:00:38
405000 -- (-1147.125) (-1147.071) [-1143.266] (-1144.176) * [-1149.704] (-1144.350) (-1146.965) (-1143.171) -- 0:00:38
Average standard deviation of split frequencies: 0.013546
405500 -- (-1141.630) (-1141.882) [-1142.662] (-1144.860) * (-1145.792) (-1143.044) (-1144.243) [-1142.316] -- 0:00:38
406000 -- (-1142.166) (-1141.987) (-1141.673) [-1146.134] * (-1144.130) (-1142.434) [-1142.272] (-1143.092) -- 0:00:38
406500 -- [-1145.789] (-1144.914) (-1145.739) (-1144.718) * (-1144.062) (-1142.734) (-1146.698) [-1143.087] -- 0:00:37
407000 -- (-1147.882) (-1141.107) [-1144.308] (-1143.049) * (-1145.401) (-1142.656) (-1146.455) [-1143.117] -- 0:00:37
407500 -- (-1142.142) (-1143.288) [-1143.837] (-1142.277) * (-1147.442) [-1143.591] (-1143.877) (-1141.700) -- 0:00:37
408000 -- (-1144.302) [-1143.911] (-1142.994) (-1144.307) * (-1146.280) (-1143.984) (-1142.804) [-1144.953] -- 0:00:37
408500 -- (-1144.613) (-1146.363) (-1141.535) [-1143.522] * (-1143.137) [-1142.169] (-1142.071) (-1143.825) -- 0:00:37
409000 -- (-1142.735) [-1146.283] (-1141.849) (-1142.242) * (-1154.032) (-1143.083) (-1144.459) [-1143.510] -- 0:00:37
409500 -- (-1142.317) [-1142.717] (-1143.069) (-1144.793) * (-1145.441) [-1144.285] (-1142.195) (-1144.160) -- 0:00:37
410000 -- (-1142.161) (-1143.005) [-1143.936] (-1142.623) * (-1143.087) (-1144.648) [-1144.208] (-1144.286) -- 0:00:37
Average standard deviation of split frequencies: 0.014094
410500 -- (-1142.268) [-1150.010] (-1142.266) (-1141.435) * [-1141.070] (-1144.921) (-1147.974) (-1142.930) -- 0:00:37
411000 -- [-1142.226] (-1143.522) (-1143.456) (-1141.643) * [-1141.243] (-1146.895) (-1144.019) (-1143.573) -- 0:00:37
411500 -- (-1142.431) (-1142.999) (-1148.365) [-1143.285] * [-1141.790] (-1146.917) (-1144.259) (-1143.948) -- 0:00:37
412000 -- [-1142.396] (-1143.123) (-1144.683) (-1141.201) * (-1144.748) (-1143.560) (-1144.132) [-1143.448] -- 0:00:37
412500 -- (-1145.982) [-1144.723] (-1143.795) (-1147.875) * (-1144.143) [-1145.734] (-1143.694) (-1142.789) -- 0:00:37
413000 -- (-1143.656) (-1143.362) [-1144.338] (-1142.293) * [-1142.623] (-1147.547) (-1146.210) (-1143.355) -- 0:00:38
413500 -- [-1143.558] (-1144.255) (-1145.437) (-1143.174) * (-1142.127) (-1142.774) (-1144.907) [-1145.959] -- 0:00:38
414000 -- [-1143.856] (-1144.660) (-1146.999) (-1141.538) * [-1145.217] (-1142.031) (-1149.139) (-1148.046) -- 0:00:38
414500 -- (-1143.959) (-1144.723) (-1143.528) [-1141.172] * (-1143.601) [-1143.000] (-1144.262) (-1146.264) -- 0:00:38
415000 -- (-1149.454) (-1146.316) (-1142.042) [-1141.221] * (-1145.788) [-1146.198] (-1141.582) (-1144.220) -- 0:00:38
Average standard deviation of split frequencies: 0.013472
415500 -- (-1146.321) [-1143.435] (-1141.431) (-1142.543) * (-1142.069) (-1143.421) [-1142.519] (-1142.361) -- 0:00:37
416000 -- (-1143.840) (-1143.481) (-1141.464) [-1145.264] * (-1144.401) (-1143.089) (-1144.294) [-1144.020] -- 0:00:37
416500 -- [-1143.828] (-1144.374) (-1142.101) (-1144.383) * (-1143.112) (-1144.125) (-1151.187) [-1141.441] -- 0:00:37
417000 -- (-1145.371) (-1147.597) (-1142.134) [-1144.247] * (-1143.695) (-1143.222) [-1142.733] (-1143.784) -- 0:00:37
417500 -- [-1143.673] (-1143.286) (-1143.488) (-1145.500) * (-1144.336) [-1145.495] (-1143.037) (-1143.264) -- 0:00:37
418000 -- [-1142.013] (-1149.673) (-1142.033) (-1147.016) * (-1144.787) [-1148.682] (-1143.087) (-1146.209) -- 0:00:37
418500 -- (-1151.035) (-1144.363) (-1143.387) [-1141.786] * (-1143.958) (-1142.895) [-1141.086] (-1150.942) -- 0:00:37
419000 -- (-1147.825) [-1142.222] (-1143.626) (-1145.846) * (-1145.530) [-1145.045] (-1141.184) (-1151.520) -- 0:00:37
419500 -- (-1143.004) (-1149.771) (-1143.972) [-1146.762] * (-1141.705) (-1146.041) [-1142.576] (-1142.392) -- 0:00:37
420000 -- (-1142.134) (-1144.544) [-1143.096] (-1143.490) * (-1143.205) [-1141.769] (-1141.298) (-1142.255) -- 0:00:37
Average standard deviation of split frequencies: 0.013385
420500 -- (-1142.619) (-1149.701) (-1143.236) [-1142.026] * (-1145.687) (-1141.929) [-1141.298] (-1142.909) -- 0:00:37
421000 -- (-1142.102) (-1143.706) (-1141.592) [-1142.252] * (-1145.180) (-1141.510) (-1141.281) [-1145.265] -- 0:00:37
421500 -- (-1143.718) [-1141.945] (-1142.868) (-1142.111) * (-1144.881) (-1141.768) [-1141.353] (-1145.095) -- 0:00:37
422000 -- (-1144.111) (-1143.695) (-1142.417) [-1141.914] * (-1144.303) [-1142.226] (-1142.266) (-1145.682) -- 0:00:36
422500 -- (-1143.717) (-1144.790) (-1141.657) [-1143.962] * (-1142.089) (-1142.186) [-1146.012] (-1141.607) -- 0:00:36
423000 -- (-1142.153) (-1145.225) (-1146.132) [-1142.671] * (-1144.753) (-1142.661) (-1142.755) [-1140.984] -- 0:00:36
423500 -- (-1142.261) (-1143.012) [-1145.616] (-1148.184) * (-1143.821) (-1142.772) (-1141.997) [-1146.635] -- 0:00:36
424000 -- (-1142.625) (-1146.722) (-1143.658) [-1148.405] * (-1141.618) (-1142.478) [-1143.333] (-1142.588) -- 0:00:36
424500 -- (-1142.546) (-1144.526) [-1142.671] (-1147.269) * (-1144.039) (-1143.431) (-1142.396) [-1142.413] -- 0:00:36
425000 -- [-1141.755] (-1144.361) (-1141.865) (-1142.529) * [-1141.823] (-1142.207) (-1142.189) (-1142.254) -- 0:00:36
Average standard deviation of split frequencies: 0.012787
425500 -- (-1142.418) [-1141.931] (-1143.381) (-1143.104) * (-1142.079) (-1141.906) (-1142.004) [-1142.295] -- 0:00:36
426000 -- (-1144.691) (-1147.276) (-1142.834) [-1142.710] * (-1146.112) (-1146.563) [-1141.847] (-1144.585) -- 0:00:36
426500 -- (-1144.142) [-1142.156] (-1143.824) (-1142.201) * [-1145.554] (-1141.387) (-1144.382) (-1141.910) -- 0:00:36
427000 -- (-1141.852) (-1141.330) [-1145.267] (-1143.158) * (-1143.589) (-1144.557) (-1143.443) [-1141.381] -- 0:00:36
427500 -- (-1143.891) [-1145.322] (-1142.598) (-1145.918) * (-1142.730) (-1145.385) (-1143.207) [-1142.715] -- 0:00:36
428000 -- (-1142.940) (-1144.887) [-1143.787] (-1141.660) * [-1141.559] (-1147.156) (-1142.693) (-1147.803) -- 0:00:36
428500 -- (-1144.775) (-1144.207) [-1143.779] (-1141.554) * (-1142.456) (-1150.598) [-1142.003] (-1145.065) -- 0:00:36
429000 -- (-1142.670) (-1143.676) (-1141.349) [-1144.120] * (-1142.238) (-1142.205) [-1142.213] (-1145.652) -- 0:00:37
429500 -- [-1142.362] (-1143.368) (-1143.610) (-1143.649) * (-1143.798) (-1142.880) (-1144.554) [-1143.130] -- 0:00:37
430000 -- (-1144.815) [-1146.304] (-1143.216) (-1141.775) * (-1144.002) [-1146.421] (-1144.066) (-1142.331) -- 0:00:37
Average standard deviation of split frequencies: 0.013135
430500 -- (-1149.647) (-1148.125) (-1141.981) [-1141.435] * (-1142.439) (-1143.812) (-1143.972) [-1143.363] -- 0:00:37
431000 -- (-1146.165) [-1142.450] (-1144.281) (-1144.846) * [-1144.545] (-1143.330) (-1143.112) (-1147.388) -- 0:00:36
431500 -- (-1146.185) [-1143.234] (-1142.610) (-1142.172) * [-1143.929] (-1143.369) (-1142.476) (-1143.027) -- 0:00:36
432000 -- [-1144.165] (-1141.878) (-1142.572) (-1145.060) * (-1143.628) [-1144.075] (-1144.237) (-1146.648) -- 0:00:36
432500 -- (-1142.853) [-1142.151] (-1142.624) (-1142.013) * (-1143.606) [-1142.625] (-1142.528) (-1144.197) -- 0:00:36
433000 -- [-1144.427] (-1141.479) (-1142.221) (-1144.370) * [-1142.932] (-1142.843) (-1142.557) (-1143.741) -- 0:00:36
433500 -- [-1141.908] (-1142.115) (-1144.811) (-1141.902) * (-1142.214) [-1143.344] (-1147.324) (-1143.798) -- 0:00:36
434000 -- (-1142.629) [-1144.102] (-1148.689) (-1142.128) * (-1143.861) (-1144.240) (-1146.898) [-1142.297] -- 0:00:36
434500 -- (-1143.200) (-1146.307) (-1148.293) [-1142.619] * (-1143.897) (-1145.381) [-1145.486] (-1144.721) -- 0:00:36
435000 -- (-1144.850) (-1142.115) (-1148.193) [-1142.512] * (-1142.031) [-1142.925] (-1143.351) (-1143.593) -- 0:00:36
Average standard deviation of split frequencies: 0.013455
435500 -- (-1141.383) (-1149.202) [-1145.286] (-1146.141) * (-1143.309) (-1143.655) (-1142.055) [-1143.628] -- 0:00:36
436000 -- (-1142.950) (-1143.572) [-1142.218] (-1147.912) * (-1143.291) [-1146.764] (-1142.224) (-1143.547) -- 0:00:36
436500 -- (-1141.583) [-1142.963] (-1143.267) (-1146.859) * [-1142.911] (-1148.495) (-1142.331) (-1142.190) -- 0:00:36
437000 -- (-1143.417) (-1144.420) (-1143.685) [-1146.152] * (-1142.079) (-1143.605) [-1142.285] (-1142.826) -- 0:00:36
437500 -- (-1143.502) (-1145.535) [-1145.330] (-1147.469) * [-1144.595] (-1146.022) (-1141.779) (-1146.440) -- 0:00:36
438000 -- (-1144.649) (-1143.927) [-1144.120] (-1142.524) * (-1145.603) (-1144.698) (-1142.031) [-1144.943] -- 0:00:35
438500 -- (-1142.942) (-1143.929) (-1142.766) [-1142.351] * (-1145.402) (-1143.799) [-1141.678] (-1144.735) -- 0:00:35
439000 -- (-1142.342) (-1143.530) (-1142.860) [-1142.039] * (-1144.625) (-1146.140) [-1141.557] (-1144.301) -- 0:00:35
439500 -- (-1142.352) [-1143.246] (-1142.960) (-1145.311) * (-1146.603) [-1142.670] (-1141.443) (-1141.285) -- 0:00:35
440000 -- (-1141.486) [-1144.390] (-1144.170) (-1144.218) * (-1147.063) (-1143.410) (-1141.487) [-1142.562] -- 0:00:35
Average standard deviation of split frequencies: 0.013847
440500 -- (-1144.063) (-1147.181) (-1143.419) [-1141.782] * (-1145.599) (-1142.258) (-1143.116) [-1143.692] -- 0:00:35
441000 -- (-1142.836) [-1144.155] (-1142.025) (-1141.511) * (-1142.298) (-1143.706) [-1142.930] (-1142.951) -- 0:00:35
441500 -- (-1144.948) (-1143.390) [-1144.311] (-1143.452) * (-1142.546) (-1143.922) (-1143.038) [-1143.587] -- 0:00:35
442000 -- (-1144.930) [-1144.969] (-1144.062) (-1144.793) * [-1142.224] (-1142.268) (-1144.464) (-1142.673) -- 0:00:35
442500 -- (-1143.366) (-1145.944) (-1145.576) [-1143.183] * [-1142.033] (-1145.093) (-1142.136) (-1142.401) -- 0:00:35
443000 -- (-1142.221) (-1142.434) (-1144.438) [-1144.671] * [-1145.392] (-1145.425) (-1144.062) (-1142.736) -- 0:00:35
443500 -- (-1142.083) (-1143.593) [-1143.754] (-1148.577) * (-1144.268) [-1142.212] (-1144.547) (-1143.503) -- 0:00:35
444000 -- [-1143.024] (-1141.944) (-1142.203) (-1150.454) * [-1141.221] (-1141.947) (-1141.989) (-1141.813) -- 0:00:35
444500 -- [-1143.877] (-1142.723) (-1142.065) (-1143.651) * (-1141.948) (-1143.449) [-1142.890] (-1142.016) -- 0:00:34
445000 -- (-1145.824) (-1142.101) (-1141.838) [-1142.214] * (-1142.050) [-1141.899] (-1144.334) (-1142.043) -- 0:00:36
Average standard deviation of split frequencies: 0.013564
445500 -- (-1142.976) (-1143.978) (-1143.663) [-1143.355] * (-1141.708) (-1145.212) (-1147.852) [-1145.327] -- 0:00:36
446000 -- [-1141.774] (-1144.076) (-1149.255) (-1143.918) * (-1143.048) (-1143.176) [-1148.150] (-1143.589) -- 0:00:36
446500 -- [-1142.939] (-1144.757) (-1144.081) (-1142.888) * [-1142.631] (-1143.812) (-1142.444) (-1143.889) -- 0:00:35
447000 -- [-1142.245] (-1141.085) (-1144.812) (-1144.518) * (-1144.697) (-1144.156) [-1142.988] (-1146.157) -- 0:00:35
447500 -- (-1143.837) [-1141.546] (-1147.483) (-1145.732) * (-1144.284) [-1144.559] (-1142.716) (-1147.584) -- 0:00:35
448000 -- (-1143.092) (-1142.991) [-1147.311] (-1141.983) * (-1142.648) (-1144.847) (-1143.090) [-1144.904] -- 0:00:35
448500 -- (-1144.694) (-1143.410) [-1143.177] (-1142.499) * [-1142.830] (-1144.558) (-1142.187) (-1143.192) -- 0:00:35
449000 -- (-1142.745) (-1145.081) [-1142.668] (-1141.514) * [-1142.186] (-1145.177) (-1142.187) (-1143.749) -- 0:00:35
449500 -- (-1149.870) (-1142.223) [-1141.872] (-1141.538) * [-1142.317] (-1143.039) (-1142.309) (-1143.255) -- 0:00:35
450000 -- (-1142.453) [-1142.393] (-1143.237) (-1143.056) * [-1142.928] (-1144.078) (-1143.132) (-1141.557) -- 0:00:35
Average standard deviation of split frequencies: 0.014237
450500 -- [-1143.004] (-1143.111) (-1144.308) (-1143.027) * (-1142.630) [-1145.134] (-1143.562) (-1144.758) -- 0:00:35
451000 -- (-1141.740) (-1142.413) (-1145.724) [-1142.622] * (-1141.953) (-1142.333) (-1142.747) [-1142.514] -- 0:00:35
451500 -- (-1142.465) (-1144.728) (-1145.428) [-1144.072] * [-1145.255] (-1144.043) (-1144.625) (-1143.039) -- 0:00:35
452000 -- (-1143.506) [-1145.494] (-1145.569) (-1143.154) * (-1143.003) (-1144.415) [-1144.830] (-1146.409) -- 0:00:35
452500 -- (-1142.241) (-1143.017) [-1143.140] (-1143.718) * (-1142.264) (-1150.225) [-1147.582] (-1146.569) -- 0:00:35
453000 -- (-1142.250) (-1141.930) (-1143.677) [-1142.186] * (-1145.023) (-1148.200) (-1146.644) [-1145.072] -- 0:00:35
453500 -- (-1145.149) (-1142.460) [-1144.568] (-1143.100) * (-1143.314) (-1142.897) [-1143.709] (-1149.211) -- 0:00:34
454000 -- (-1143.563) (-1141.717) [-1141.688] (-1141.934) * (-1142.708) [-1141.919] (-1142.750) (-1146.009) -- 0:00:34
454500 -- (-1144.405) (-1144.560) (-1142.157) [-1142.167] * (-1142.137) [-1142.687] (-1142.397) (-1143.339) -- 0:00:34
455000 -- [-1144.988] (-1143.148) (-1143.147) (-1144.828) * (-1144.560) [-1142.797] (-1143.562) (-1143.810) -- 0:00:34
Average standard deviation of split frequencies: 0.013497
455500 -- [-1146.811] (-1142.666) (-1144.558) (-1143.305) * [-1142.366] (-1144.647) (-1142.135) (-1146.884) -- 0:00:34
456000 -- (-1141.949) (-1142.816) (-1146.753) [-1144.801] * [-1141.290] (-1142.878) (-1142.640) (-1145.138) -- 0:00:34
456500 -- [-1142.056] (-1143.326) (-1142.594) (-1144.498) * [-1144.081] (-1142.845) (-1141.288) (-1147.594) -- 0:00:34
457000 -- (-1143.001) (-1143.054) [-1144.839] (-1143.357) * [-1144.295] (-1144.366) (-1142.089) (-1145.481) -- 0:00:34
457500 -- [-1143.536] (-1146.217) (-1142.875) (-1143.911) * [-1143.845] (-1142.307) (-1142.313) (-1145.838) -- 0:00:34
458000 -- (-1143.059) (-1143.860) (-1143.776) [-1143.775] * (-1142.225) [-1143.162] (-1142.943) (-1144.427) -- 0:00:34
458500 -- (-1144.476) [-1141.499] (-1148.589) (-1144.283) * (-1144.044) [-1143.281] (-1143.037) (-1141.827) -- 0:00:34
459000 -- (-1144.322) [-1142.934] (-1144.384) (-1142.516) * [-1146.490] (-1142.365) (-1144.114) (-1141.620) -- 0:00:34
459500 -- (-1142.236) (-1145.854) (-1142.238) [-1142.107] * [-1147.104] (-1143.528) (-1143.995) (-1142.241) -- 0:00:34
460000 -- (-1143.421) (-1142.805) [-1142.371] (-1144.821) * (-1146.996) [-1141.482] (-1143.655) (-1143.089) -- 0:00:34
Average standard deviation of split frequencies: 0.013758
460500 -- (-1142.786) (-1141.187) [-1142.427] (-1145.658) * (-1149.538) (-1141.851) [-1142.029] (-1144.562) -- 0:00:33
461000 -- (-1143.474) (-1141.238) (-1142.521) [-1143.741] * (-1145.885) (-1141.797) [-1142.263] (-1142.998) -- 0:00:35
461500 -- [-1142.348] (-1141.608) (-1142.780) (-1145.771) * (-1144.023) (-1142.051) [-1144.369] (-1142.122) -- 0:00:35
462000 -- [-1144.373] (-1144.161) (-1142.806) (-1144.852) * [-1143.543] (-1144.694) (-1142.196) (-1144.771) -- 0:00:34
462500 -- [-1144.957] (-1143.757) (-1142.354) (-1142.548) * [-1141.039] (-1143.402) (-1143.205) (-1143.186) -- 0:00:34
463000 -- [-1143.010] (-1144.348) (-1141.483) (-1142.022) * (-1143.068) (-1141.979) [-1143.942] (-1145.583) -- 0:00:34
463500 -- (-1142.491) [-1141.278] (-1141.487) (-1144.220) * [-1142.350] (-1143.203) (-1144.639) (-1147.874) -- 0:00:34
464000 -- (-1141.663) [-1142.931] (-1144.579) (-1145.247) * (-1145.894) (-1142.097) (-1143.491) [-1147.988] -- 0:00:34
464500 -- [-1146.587] (-1141.939) (-1142.028) (-1145.342) * (-1147.611) [-1141.929] (-1144.115) (-1143.734) -- 0:00:34
465000 -- [-1143.025] (-1143.488) (-1142.949) (-1147.139) * (-1142.129) [-1143.264] (-1141.653) (-1146.915) -- 0:00:34
Average standard deviation of split frequencies: 0.012814
465500 -- (-1143.208) [-1144.290] (-1141.253) (-1143.478) * [-1141.976] (-1145.995) (-1144.854) (-1144.140) -- 0:00:34
466000 -- (-1143.192) [-1142.923] (-1141.420) (-1143.742) * (-1144.585) (-1145.816) [-1146.009] (-1148.189) -- 0:00:34
466500 -- (-1143.624) [-1143.292] (-1142.017) (-1142.867) * (-1143.257) [-1143.721] (-1145.752) (-1145.151) -- 0:00:34
467000 -- [-1144.470] (-1143.414) (-1142.248) (-1143.376) * [-1143.415] (-1142.201) (-1142.546) (-1146.018) -- 0:00:34
467500 -- (-1142.096) (-1145.504) [-1142.867] (-1144.577) * (-1143.096) (-1146.794) (-1144.230) [-1142.308] -- 0:00:34
468000 -- (-1144.343) (-1143.932) [-1142.339] (-1143.721) * [-1141.243] (-1142.925) (-1143.979) (-1143.176) -- 0:00:34
468500 -- [-1142.777] (-1145.314) (-1142.084) (-1149.488) * [-1141.716] (-1143.565) (-1142.249) (-1142.793) -- 0:00:34
469000 -- (-1143.340) (-1142.549) [-1143.670] (-1145.194) * (-1141.588) (-1142.170) [-1145.780] (-1148.077) -- 0:00:33
469500 -- (-1145.374) [-1148.880] (-1142.698) (-1145.002) * [-1141.705] (-1144.949) (-1146.848) (-1145.455) -- 0:00:33
470000 -- (-1145.485) [-1143.668] (-1142.198) (-1144.380) * (-1142.025) (-1145.189) [-1142.720] (-1143.155) -- 0:00:33
Average standard deviation of split frequencies: 0.012853
470500 -- (-1142.606) (-1142.500) [-1144.809] (-1144.073) * [-1141.830] (-1142.404) (-1143.103) (-1142.125) -- 0:00:33
471000 -- (-1142.258) (-1142.189) [-1143.660] (-1153.375) * (-1142.305) (-1143.976) [-1143.059] (-1141.772) -- 0:00:33
471500 -- (-1143.046) (-1147.010) [-1142.260] (-1150.587) * (-1143.032) [-1143.439] (-1146.241) (-1143.021) -- 0:00:33
472000 -- (-1142.753) (-1145.025) [-1144.039] (-1143.509) * (-1143.560) (-1145.297) [-1145.136] (-1143.372) -- 0:00:33
472500 -- (-1141.642) (-1143.597) (-1143.066) [-1144.561] * (-1146.630) (-1144.349) [-1142.910] (-1143.231) -- 0:00:33
473000 -- (-1142.209) [-1145.026] (-1143.548) (-1144.442) * (-1144.203) (-1147.283) [-1142.924] (-1143.397) -- 0:00:33
473500 -- (-1143.523) [-1146.137] (-1144.627) (-1145.000) * (-1142.937) (-1141.610) (-1144.944) [-1143.806] -- 0:00:33
474000 -- (-1142.066) (-1144.188) [-1143.265] (-1144.388) * (-1143.868) (-1140.906) [-1142.595] (-1145.863) -- 0:00:33
474500 -- (-1147.744) (-1142.246) (-1144.033) [-1143.787] * (-1142.812) [-1145.178] (-1144.513) (-1143.313) -- 0:00:33
475000 -- (-1141.603) [-1142.228] (-1143.835) (-1143.166) * (-1142.735) (-1142.014) [-1141.890] (-1142.367) -- 0:00:33
Average standard deviation of split frequencies: 0.012819
475500 -- [-1141.977] (-1144.598) (-1143.323) (-1144.614) * (-1146.015) (-1142.761) (-1141.522) [-1143.119] -- 0:00:34
476000 -- (-1143.620) (-1142.771) [-1147.645] (-1146.666) * [-1146.478] (-1143.195) (-1142.818) (-1143.267) -- 0:00:34
476500 -- (-1147.030) (-1144.743) [-1144.613] (-1144.277) * (-1142.008) (-1143.377) (-1150.366) [-1143.351] -- 0:00:34
477000 -- (-1143.013) (-1143.713) (-1141.965) [-1145.480] * (-1141.238) [-1142.622] (-1145.953) (-1143.245) -- 0:00:33
477500 -- (-1147.042) [-1143.951] (-1144.488) (-1143.485) * (-1141.281) (-1147.723) (-1144.215) [-1141.304] -- 0:00:33
478000 -- (-1144.231) (-1143.514) (-1146.814) [-1141.986] * [-1141.401] (-1147.332) (-1144.184) (-1141.837) -- 0:00:33
478500 -- [-1143.390] (-1143.591) (-1145.011) (-1143.236) * (-1141.669) (-1142.925) (-1142.359) [-1141.649] -- 0:00:33
479000 -- (-1145.217) (-1143.889) (-1143.748) [-1145.961] * (-1145.034) (-1144.099) (-1144.017) [-1144.355] -- 0:00:33
479500 -- (-1144.004) (-1143.966) (-1143.773) [-1141.680] * (-1145.467) [-1144.501] (-1143.477) (-1143.859) -- 0:00:33
480000 -- [-1142.926] (-1146.584) (-1143.296) (-1141.928) * (-1142.927) (-1143.543) (-1144.299) [-1141.813] -- 0:00:33
Average standard deviation of split frequencies: 0.012749
480500 -- [-1143.157] (-1144.920) (-1142.937) (-1143.339) * (-1142.140) (-1144.559) [-1141.371] (-1142.031) -- 0:00:33
481000 -- [-1143.803] (-1142.457) (-1142.399) (-1148.227) * [-1141.684] (-1144.182) (-1145.313) (-1141.451) -- 0:00:33
481500 -- [-1142.182] (-1143.088) (-1142.826) (-1147.085) * (-1143.793) [-1142.253] (-1146.948) (-1141.932) -- 0:00:33
482000 -- (-1141.098) [-1142.940] (-1143.038) (-1148.655) * [-1144.011] (-1142.332) (-1144.765) (-1144.231) -- 0:00:33
482500 -- (-1142.584) (-1143.656) [-1142.349] (-1148.823) * [-1145.437] (-1141.719) (-1143.642) (-1145.444) -- 0:00:33
483000 -- (-1141.531) (-1142.321) (-1145.557) [-1142.200] * (-1141.551) (-1142.519) [-1141.933] (-1144.807) -- 0:00:33
483500 -- (-1143.167) (-1144.015) [-1146.232] (-1142.237) * (-1141.494) (-1142.078) (-1141.442) [-1144.262] -- 0:00:33
484000 -- (-1143.632) (-1145.421) [-1148.129] (-1144.387) * [-1143.520] (-1144.354) (-1147.974) (-1146.676) -- 0:00:33
484500 -- [-1142.750] (-1144.776) (-1144.799) (-1147.169) * (-1143.450) (-1144.816) (-1142.007) [-1142.347] -- 0:00:32
485000 -- (-1143.373) [-1143.960] (-1143.664) (-1146.026) * [-1143.949] (-1146.139) (-1142.531) (-1146.941) -- 0:00:32
Average standard deviation of split frequencies: 0.013364
485500 -- (-1143.026) [-1143.606] (-1141.817) (-1150.631) * (-1145.766) (-1143.955) (-1146.355) [-1144.204] -- 0:00:32
486000 -- (-1144.533) (-1143.095) [-1141.528] (-1144.442) * (-1141.811) (-1141.285) [-1144.986] (-1145.830) -- 0:00:32
486500 -- (-1141.844) (-1144.600) [-1142.686] (-1148.798) * (-1147.016) (-1145.881) (-1144.908) [-1145.005] -- 0:00:32
487000 -- (-1146.557) (-1144.684) [-1143.099] (-1150.998) * (-1143.587) [-1142.371] (-1149.714) (-1145.155) -- 0:00:32
487500 -- [-1147.756] (-1144.351) (-1146.164) (-1145.348) * [-1142.831] (-1144.989) (-1143.490) (-1144.487) -- 0:00:32
488000 -- [-1141.846] (-1142.614) (-1142.536) (-1144.847) * (-1142.127) (-1141.801) [-1143.118] (-1142.609) -- 0:00:32
488500 -- (-1143.494) [-1142.505] (-1145.035) (-1143.757) * [-1142.394] (-1144.086) (-1143.257) (-1143.116) -- 0:00:32
489000 -- [-1141.805] (-1142.210) (-1143.831) (-1148.491) * [-1143.911] (-1145.204) (-1142.794) (-1142.583) -- 0:00:32
489500 -- (-1144.648) (-1141.702) [-1145.492] (-1147.393) * (-1142.705) (-1143.284) [-1145.906] (-1143.383) -- 0:00:32
490000 -- (-1143.547) (-1142.834) [-1144.660] (-1142.537) * (-1142.989) (-1145.484) (-1144.002) [-1141.810] -- 0:00:32
Average standard deviation of split frequencies: 0.012917
490500 -- (-1143.984) [-1141.520] (-1143.547) (-1145.676) * (-1142.561) (-1144.134) [-1146.515] (-1142.705) -- 0:00:33
491000 -- (-1142.830) (-1143.127) [-1146.902] (-1145.532) * (-1143.360) (-1145.775) (-1141.934) [-1142.172] -- 0:00:33
491500 -- (-1142.372) (-1142.718) (-1143.943) [-1146.142] * (-1145.151) [-1142.410] (-1143.738) (-1147.420) -- 0:00:33
492000 -- (-1144.803) (-1151.511) (-1142.000) [-1141.966] * [-1143.767] (-1141.243) (-1142.372) (-1145.238) -- 0:00:33
492500 -- (-1144.771) [-1142.758] (-1144.739) (-1145.183) * (-1142.863) (-1141.664) [-1143.303] (-1143.533) -- 0:00:32
493000 -- [-1146.305] (-1142.689) (-1144.224) (-1142.233) * [-1145.603] (-1141.903) (-1141.336) (-1141.769) -- 0:00:32
493500 -- [-1145.864] (-1144.363) (-1144.837) (-1146.556) * (-1142.034) (-1146.765) [-1141.450] (-1141.289) -- 0:00:32
494000 -- (-1144.424) (-1142.594) [-1143.660] (-1144.724) * [-1142.609] (-1147.124) (-1141.332) (-1141.023) -- 0:00:32
494500 -- (-1145.378) (-1142.348) (-1148.248) [-1146.048] * [-1143.203] (-1146.504) (-1141.358) (-1141.912) -- 0:00:32
495000 -- (-1147.370) (-1142.348) [-1143.016] (-1145.182) * (-1144.406) (-1143.439) (-1141.677) [-1146.168] -- 0:00:32
Average standard deviation of split frequencies: 0.013095
495500 -- (-1141.957) (-1143.824) [-1143.635] (-1145.742) * (-1142.713) (-1142.960) (-1141.874) [-1142.926] -- 0:00:32
496000 -- [-1142.097] (-1142.266) (-1142.093) (-1144.535) * [-1142.000] (-1141.602) (-1143.654) (-1148.665) -- 0:00:32
496500 -- (-1149.878) [-1143.205] (-1142.182) (-1142.608) * (-1141.338) [-1142.286] (-1143.938) (-1143.740) -- 0:00:32
497000 -- (-1144.503) [-1145.370] (-1143.434) (-1146.072) * (-1149.330) (-1144.380) (-1145.692) [-1144.523] -- 0:00:32
497500 -- (-1146.198) [-1144.703] (-1144.701) (-1141.950) * (-1142.421) (-1145.982) (-1145.600) [-1144.375] -- 0:00:32
498000 -- [-1147.351] (-1141.970) (-1144.015) (-1141.861) * (-1147.408) (-1142.304) (-1146.321) [-1147.297] -- 0:00:32
498500 -- (-1144.678) (-1145.061) [-1143.538] (-1142.225) * (-1144.788) [-1142.317] (-1147.933) (-1147.481) -- 0:00:32
499000 -- [-1146.452] (-1145.061) (-1143.996) (-1142.327) * (-1145.710) (-1141.880) (-1144.716) [-1145.947] -- 0:00:32
499500 -- (-1147.714) [-1142.866] (-1147.569) (-1141.669) * [-1144.424] (-1148.133) (-1149.246) (-1143.437) -- 0:00:32
500000 -- (-1146.477) [-1141.777] (-1143.687) (-1142.160) * [-1143.129] (-1144.471) (-1142.249) (-1146.869) -- 0:00:32
Average standard deviation of split frequencies: 0.013286
500500 -- (-1144.346) (-1142.149) [-1142.212] (-1143.048) * (-1143.441) [-1144.919] (-1141.960) (-1144.920) -- 0:00:31
501000 -- (-1144.891) (-1142.465) (-1143.364) [-1144.514] * (-1144.740) [-1146.807] (-1145.431) (-1142.208) -- 0:00:31
501500 -- (-1144.552) [-1145.600] (-1144.678) (-1142.315) * [-1144.026] (-1146.595) (-1143.018) (-1142.355) -- 0:00:31
502000 -- [-1141.071] (-1147.353) (-1142.641) (-1143.022) * (-1144.404) (-1144.110) (-1144.723) [-1142.155] -- 0:00:31
502500 -- (-1141.438) (-1147.102) (-1142.315) [-1145.083] * (-1149.515) (-1144.564) (-1144.444) [-1142.578] -- 0:00:31
503000 -- [-1141.895] (-1144.352) (-1145.442) (-1142.451) * (-1143.196) (-1143.903) (-1144.181) [-1141.754] -- 0:00:31
503500 -- (-1141.898) (-1145.067) [-1141.873] (-1142.839) * (-1149.198) (-1149.997) [-1144.237] (-1143.050) -- 0:00:31
504000 -- (-1143.338) (-1145.752) (-1142.320) [-1142.621] * (-1147.235) (-1144.488) (-1143.134) [-1142.959] -- 0:00:31
504500 -- (-1142.251) (-1142.511) (-1141.582) [-1143.776] * [-1141.629] (-1143.029) (-1145.686) (-1143.095) -- 0:00:31
505000 -- (-1147.630) (-1145.589) [-1141.854] (-1143.712) * (-1145.185) [-1142.688] (-1143.432) (-1146.363) -- 0:00:31
Average standard deviation of split frequencies: 0.012681
505500 -- (-1145.557) [-1144.176] (-1143.865) (-1142.633) * (-1141.964) [-1141.131] (-1143.619) (-1144.022) -- 0:00:31
506000 -- (-1144.214) (-1144.535) (-1144.679) [-1141.893] * (-1143.075) (-1144.075) (-1143.635) [-1143.316] -- 0:00:32
506500 -- [-1144.101] (-1144.403) (-1142.745) (-1143.121) * (-1141.483) (-1142.188) [-1142.311] (-1143.939) -- 0:00:32
507000 -- (-1145.010) (-1141.318) [-1143.073] (-1143.492) * (-1141.304) [-1142.192] (-1144.301) (-1143.759) -- 0:00:32
507500 -- (-1145.834) (-1144.744) [-1142.057] (-1144.529) * [-1142.552] (-1142.560) (-1145.421) (-1144.457) -- 0:00:32
508000 -- (-1142.978) [-1143.011] (-1145.973) (-1144.412) * (-1143.284) (-1146.670) (-1146.784) [-1144.518] -- 0:00:31
508500 -- [-1141.774] (-1142.962) (-1142.963) (-1147.630) * [-1143.778] (-1145.699) (-1143.150) (-1141.871) -- 0:00:31
509000 -- (-1142.419) (-1141.215) [-1143.423] (-1148.686) * (-1141.874) (-1144.919) [-1144.032] (-1141.593) -- 0:00:31
509500 -- (-1142.791) (-1142.477) (-1141.946) [-1143.780] * (-1144.098) [-1142.606] (-1142.473) (-1141.587) -- 0:00:31
510000 -- (-1143.816) (-1144.039) (-1141.831) [-1143.399] * (-1143.080) (-1141.970) (-1142.495) [-1143.121] -- 0:00:31
Average standard deviation of split frequencies: 0.012359
510500 -- (-1142.991) [-1142.154] (-1144.759) (-1142.676) * (-1143.012) [-1142.705] (-1142.640) (-1143.869) -- 0:00:31
511000 -- (-1142.377) [-1145.202] (-1143.078) (-1145.157) * (-1142.150) (-1141.503) (-1142.437) [-1143.276] -- 0:00:31
511500 -- (-1142.988) [-1143.866] (-1143.492) (-1142.754) * (-1144.049) (-1142.153) [-1142.375] (-1143.061) -- 0:00:31
512000 -- [-1142.977] (-1145.064) (-1144.488) (-1145.896) * (-1146.372) (-1144.546) (-1142.432) [-1142.539] -- 0:00:31
512500 -- (-1141.786) (-1142.664) (-1145.678) [-1147.094] * [-1143.145] (-1143.177) (-1142.763) (-1142.570) -- 0:00:31
513000 -- (-1141.911) (-1142.927) [-1141.691] (-1143.830) * (-1143.570) (-1143.381) (-1146.737) [-1141.764] -- 0:00:31
513500 -- (-1142.726) [-1144.539] (-1143.435) (-1143.927) * (-1143.716) (-1143.066) (-1145.618) [-1142.393] -- 0:00:31
514000 -- (-1144.876) (-1143.014) [-1143.354] (-1144.333) * (-1145.071) (-1145.608) [-1141.566] (-1143.499) -- 0:00:31
514500 -- (-1143.726) [-1143.221] (-1142.589) (-1143.805) * (-1143.559) (-1149.763) [-1142.677] (-1142.376) -- 0:00:31
515000 -- [-1142.173] (-1144.683) (-1143.288) (-1142.201) * (-1141.832) (-1147.285) (-1142.870) [-1143.211] -- 0:00:31
Average standard deviation of split frequencies: 0.012079
515500 -- (-1141.407) (-1141.614) (-1143.495) [-1144.892] * (-1141.603) (-1145.315) (-1143.923) [-1143.018] -- 0:00:31
516000 -- [-1145.096] (-1141.838) (-1141.627) (-1142.909) * (-1147.426) (-1145.150) [-1142.552] (-1143.737) -- 0:00:30
516500 -- (-1141.953) [-1145.462] (-1144.729) (-1144.510) * (-1141.678) [-1144.503] (-1147.398) (-1142.558) -- 0:00:30
517000 -- (-1142.605) [-1144.139] (-1148.636) (-1145.868) * (-1144.371) (-1143.729) [-1144.522] (-1142.070) -- 0:00:30
517500 -- (-1142.796) (-1143.284) (-1149.734) [-1141.987] * (-1143.141) [-1143.943] (-1142.555) (-1142.571) -- 0:00:30
518000 -- (-1142.780) (-1142.163) (-1144.500) [-1142.349] * (-1145.664) (-1146.261) [-1143.279] (-1143.255) -- 0:00:30
518500 -- [-1142.526] (-1142.754) (-1142.853) (-1142.545) * (-1145.478) (-1143.398) (-1142.179) [-1143.088] -- 0:00:30
519000 -- (-1143.808) (-1145.201) [-1143.416] (-1144.537) * [-1143.698] (-1143.877) (-1142.218) (-1146.176) -- 0:00:30
519500 -- (-1145.617) (-1141.983) (-1141.830) [-1143.644] * (-1147.240) (-1143.274) [-1146.224] (-1143.604) -- 0:00:30
520000 -- [-1142.331] (-1142.727) (-1142.884) (-1143.351) * (-1143.152) (-1143.068) (-1142.371) [-1142.923] -- 0:00:30
Average standard deviation of split frequencies: 0.012122
520500 -- (-1142.149) [-1141.220] (-1142.232) (-1142.151) * (-1143.459) (-1143.437) [-1142.359] (-1146.332) -- 0:00:30
521000 -- (-1145.106) [-1141.649] (-1144.745) (-1143.139) * [-1141.344] (-1144.173) (-1148.030) (-1145.230) -- 0:00:30
521500 -- (-1143.818) [-1141.943] (-1143.653) (-1142.877) * (-1142.671) [-1144.182] (-1145.396) (-1143.446) -- 0:00:30
522000 -- (-1144.109) (-1142.333) (-1146.212) [-1143.154] * (-1141.943) (-1144.659) (-1148.345) [-1142.874] -- 0:00:31
522500 -- (-1141.665) (-1141.658) [-1143.021] (-1143.168) * (-1143.026) (-1143.504) [-1144.973] (-1143.250) -- 0:00:31
523000 -- (-1142.292) [-1142.991] (-1142.451) (-1141.694) * (-1142.124) (-1148.327) [-1141.298] (-1143.382) -- 0:00:31
523500 -- (-1142.462) (-1148.620) [-1142.866] (-1143.490) * (-1142.847) [-1143.226] (-1144.256) (-1146.355) -- 0:00:30
524000 -- [-1142.757] (-1142.133) (-1145.055) (-1141.649) * (-1142.791) [-1143.261] (-1147.120) (-1142.249) -- 0:00:30
524500 -- (-1143.689) [-1143.428] (-1143.125) (-1145.261) * (-1142.524) [-1143.717] (-1147.834) (-1143.385) -- 0:00:30
525000 -- (-1143.961) (-1141.581) [-1141.801] (-1145.249) * [-1143.326] (-1144.484) (-1149.807) (-1143.873) -- 0:00:30
Average standard deviation of split frequencies: 0.012099
525500 -- (-1144.237) [-1142.257] (-1142.968) (-1147.555) * [-1144.429] (-1141.125) (-1142.518) (-1143.508) -- 0:00:30
526000 -- [-1144.131] (-1142.257) (-1141.905) (-1149.977) * (-1146.631) (-1142.116) (-1143.281) [-1144.707] -- 0:00:30
526500 -- (-1143.486) (-1143.476) (-1141.959) [-1146.658] * [-1146.113] (-1142.461) (-1143.625) (-1143.608) -- 0:00:30
527000 -- (-1143.486) (-1143.970) (-1142.075) [-1142.221] * (-1147.585) (-1147.546) [-1141.722] (-1144.049) -- 0:00:30
527500 -- (-1147.189) (-1143.435) [-1141.907] (-1142.819) * (-1144.771) [-1142.645] (-1142.067) (-1144.409) -- 0:00:30
528000 -- (-1142.353) (-1141.744) (-1144.590) [-1141.377] * (-1143.128) (-1143.453) [-1142.653] (-1142.927) -- 0:00:30
528500 -- (-1144.234) [-1144.002] (-1142.519) (-1142.464) * [-1142.286] (-1144.184) (-1142.664) (-1143.458) -- 0:00:30
529000 -- (-1145.229) [-1144.294] (-1142.210) (-1144.890) * (-1141.658) (-1143.174) (-1143.075) [-1144.904] -- 0:00:30
529500 -- (-1143.287) (-1146.050) (-1141.200) [-1145.977] * [-1143.257] (-1147.655) (-1142.857) (-1144.308) -- 0:00:30
530000 -- [-1147.062] (-1143.910) (-1141.200) (-1144.192) * (-1143.252) (-1143.382) (-1141.452) [-1141.400] -- 0:00:30
Average standard deviation of split frequencies: 0.012634
530500 -- (-1143.288) (-1143.409) (-1143.922) [-1151.751] * (-1142.221) (-1143.572) [-1142.887] (-1141.674) -- 0:00:30
531000 -- (-1141.539) [-1142.178] (-1148.324) (-1142.999) * (-1143.557) (-1145.206) [-1142.952] (-1141.617) -- 0:00:30
531500 -- (-1144.879) [-1141.394] (-1141.644) (-1143.811) * [-1143.226] (-1150.698) (-1142.318) (-1142.626) -- 0:00:29
532000 -- [-1145.048] (-1144.091) (-1141.667) (-1142.064) * [-1146.458] (-1145.333) (-1144.661) (-1143.391) -- 0:00:29
532500 -- (-1143.814) (-1144.478) [-1143.079] (-1143.947) * [-1146.167] (-1143.772) (-1143.477) (-1143.692) -- 0:00:29
533000 -- [-1142.499] (-1144.466) (-1145.103) (-1145.843) * (-1142.751) (-1143.756) [-1142.473] (-1143.225) -- 0:00:29
533500 -- (-1142.540) (-1143.785) [-1142.755] (-1141.455) * [-1141.727] (-1143.565) (-1141.576) (-1143.417) -- 0:00:29
534000 -- (-1142.536) (-1142.472) (-1142.939) [-1142.847] * [-1143.750] (-1141.933) (-1141.748) (-1144.939) -- 0:00:29
534500 -- (-1144.296) [-1142.208] (-1143.293) (-1142.956) * (-1143.321) (-1141.667) [-1142.240] (-1144.263) -- 0:00:29
535000 -- (-1142.272) (-1144.268) [-1144.578] (-1142.956) * (-1145.907) (-1143.306) [-1142.211] (-1145.253) -- 0:00:29
Average standard deviation of split frequencies: 0.012362
535500 -- (-1145.606) (-1142.680) [-1142.717] (-1144.352) * (-1144.774) [-1141.526] (-1143.388) (-1143.255) -- 0:00:29
536000 -- (-1144.834) (-1143.979) (-1141.903) [-1145.572] * (-1141.739) [-1143.337] (-1143.305) (-1144.121) -- 0:00:29
536500 -- (-1142.725) (-1145.714) (-1141.509) [-1142.714] * [-1144.281] (-1143.400) (-1142.010) (-1141.911) -- 0:00:29
537000 -- (-1144.047) [-1143.992] (-1141.768) (-1143.187) * (-1143.625) (-1144.020) [-1141.612] (-1141.874) -- 0:00:29
537500 -- (-1142.125) [-1141.813] (-1141.990) (-1142.263) * (-1144.158) [-1142.757] (-1142.926) (-1145.697) -- 0:00:29
538000 -- (-1142.183) (-1142.502) (-1141.986) [-1142.080] * (-1144.546) (-1142.175) (-1143.937) [-1145.402] -- 0:00:30
538500 -- (-1143.705) (-1141.957) [-1142.693] (-1144.675) * (-1146.979) (-1145.628) [-1143.881] (-1147.114) -- 0:00:29
539000 -- (-1143.060) (-1141.742) (-1143.209) [-1141.932] * (-1144.279) [-1142.608] (-1144.797) (-1141.053) -- 0:00:29
539500 -- (-1143.975) [-1143.610] (-1143.424) (-1147.763) * (-1144.054) (-1142.432) (-1143.108) [-1143.804] -- 0:00:29
540000 -- (-1144.590) (-1142.968) [-1143.291] (-1147.241) * (-1142.713) (-1141.551) (-1142.640) [-1147.695] -- 0:00:29
Average standard deviation of split frequencies: 0.012255
540500 -- (-1147.757) [-1142.248] (-1144.506) (-1146.635) * (-1143.007) (-1146.186) [-1142.882] (-1143.521) -- 0:00:29
541000 -- (-1146.505) [-1141.850] (-1142.922) (-1142.118) * [-1142.940] (-1143.165) (-1143.098) (-1142.004) -- 0:00:29
541500 -- (-1143.233) [-1141.630] (-1143.057) (-1141.819) * (-1147.401) (-1142.390) [-1145.437] (-1146.854) -- 0:00:29
542000 -- (-1144.581) [-1141.209] (-1142.558) (-1143.352) * (-1142.605) (-1142.158) (-1145.857) [-1144.723] -- 0:00:29
542500 -- (-1144.234) [-1143.189] (-1143.133) (-1143.242) * (-1141.698) (-1142.951) [-1142.998] (-1147.389) -- 0:00:29
543000 -- (-1144.580) (-1141.943) (-1143.546) [-1142.738] * (-1142.200) (-1143.862) [-1142.751] (-1142.293) -- 0:00:29
543500 -- (-1143.363) (-1142.906) (-1144.996) [-1141.700] * [-1143.829] (-1144.383) (-1144.629) (-1141.820) -- 0:00:29
544000 -- [-1144.663] (-1142.223) (-1145.316) (-1144.077) * (-1142.850) (-1145.246) (-1143.984) [-1141.893] -- 0:00:29
544500 -- (-1147.104) [-1141.878] (-1145.527) (-1145.535) * (-1147.982) (-1142.994) (-1143.612) [-1141.074] -- 0:00:29
545000 -- (-1142.197) (-1143.234) (-1142.989) [-1143.605] * (-1143.001) (-1146.228) [-1142.462] (-1141.074) -- 0:00:29
Average standard deviation of split frequencies: 0.011656
545500 -- [-1141.947] (-1145.525) (-1141.771) (-1145.403) * (-1142.676) (-1142.857) [-1145.026] (-1142.989) -- 0:00:29
546000 -- [-1143.748] (-1143.901) (-1143.998) (-1141.373) * (-1143.985) (-1142.833) [-1142.449] (-1144.023) -- 0:00:29
546500 -- (-1142.395) (-1146.967) (-1146.202) [-1142.066] * (-1145.088) (-1141.067) [-1143.835] (-1145.503) -- 0:00:29
547000 -- (-1141.617) (-1145.402) (-1143.406) [-1143.517] * [-1141.997] (-1144.757) (-1143.842) (-1142.605) -- 0:00:28
547500 -- (-1142.538) (-1143.358) (-1142.835) [-1142.737] * (-1144.060) [-1143.812] (-1142.395) (-1143.573) -- 0:00:28
548000 -- (-1142.976) (-1145.941) (-1144.726) [-1144.811] * [-1143.169] (-1142.343) (-1143.806) (-1142.959) -- 0:00:28
548500 -- [-1142.747] (-1143.282) (-1144.133) (-1143.553) * (-1141.329) [-1146.213] (-1144.794) (-1143.754) -- 0:00:28
549000 -- [-1143.068] (-1144.160) (-1143.286) (-1149.016) * (-1144.318) (-1145.464) [-1145.236] (-1146.261) -- 0:00:28
549500 -- (-1143.201) [-1142.898] (-1142.608) (-1145.876) * [-1143.954] (-1143.235) (-1144.892) (-1144.612) -- 0:00:28
550000 -- (-1145.191) (-1143.193) (-1145.815) [-1144.546] * (-1146.234) (-1144.577) [-1141.721] (-1142.155) -- 0:00:28
Average standard deviation of split frequencies: 0.011034
550500 -- (-1142.962) [-1142.012] (-1144.669) (-1142.536) * (-1142.960) (-1142.299) [-1141.733] (-1145.240) -- 0:00:28
551000 -- (-1143.301) (-1143.783) [-1143.602] (-1141.630) * (-1141.765) [-1141.495] (-1151.384) (-1142.495) -- 0:00:28
551500 -- [-1142.304] (-1145.761) (-1146.424) (-1145.497) * (-1142.096) [-1142.885] (-1142.057) (-1145.273) -- 0:00:28
552000 -- (-1142.363) (-1143.294) [-1143.556] (-1143.114) * [-1142.775] (-1147.138) (-1142.876) (-1143.787) -- 0:00:28
552500 -- (-1141.884) (-1147.387) [-1142.771] (-1142.337) * [-1143.823] (-1147.995) (-1142.875) (-1144.326) -- 0:00:29
553000 -- (-1145.054) (-1145.167) (-1142.346) [-1143.757] * (-1142.013) [-1141.719] (-1142.457) (-1147.782) -- 0:00:29
553500 -- (-1141.593) (-1142.077) [-1142.116] (-1147.241) * (-1143.016) (-1141.704) [-1142.878] (-1143.950) -- 0:00:29
554000 -- (-1142.537) [-1144.673] (-1142.877) (-1146.419) * (-1144.487) (-1142.104) (-1144.198) [-1143.902] -- 0:00:28
554500 -- [-1143.616] (-1147.006) (-1142.184) (-1146.533) * (-1145.902) (-1143.447) [-1143.080] (-1145.097) -- 0:00:28
555000 -- (-1141.719) (-1142.245) (-1143.254) [-1146.452] * (-1142.228) [-1143.523] (-1144.161) (-1145.325) -- 0:00:28
Average standard deviation of split frequencies: 0.011069
555500 -- (-1141.941) [-1141.727] (-1141.940) (-1147.618) * (-1142.496) (-1142.393) [-1142.656] (-1143.944) -- 0:00:28
556000 -- (-1144.550) (-1143.580) [-1141.977] (-1144.811) * [-1142.108] (-1142.070) (-1142.098) (-1144.481) -- 0:00:28
556500 -- (-1143.116) [-1142.818] (-1143.189) (-1142.802) * [-1143.710] (-1141.838) (-1142.404) (-1141.570) -- 0:00:28
557000 -- [-1141.663] (-1143.389) (-1144.316) (-1142.630) * (-1142.489) (-1144.259) [-1143.007] (-1144.047) -- 0:00:28
557500 -- (-1141.942) [-1144.470] (-1145.685) (-1142.886) * [-1144.102] (-1144.213) (-1144.254) (-1152.042) -- 0:00:28
558000 -- (-1143.803) (-1145.719) (-1144.813) [-1146.273] * (-1143.794) (-1145.122) (-1142.275) [-1143.008] -- 0:00:28
558500 -- (-1143.517) [-1143.253] (-1145.924) (-1144.034) * (-1145.485) (-1144.797) (-1141.143) [-1141.679] -- 0:00:28
559000 -- (-1144.462) (-1145.234) (-1142.395) [-1142.755] * (-1145.754) (-1143.063) [-1141.137] (-1141.152) -- 0:00:28
559500 -- (-1142.251) (-1143.001) [-1143.300] (-1141.826) * (-1148.292) (-1148.410) (-1142.745) [-1141.747] -- 0:00:28
560000 -- (-1144.253) (-1146.238) (-1143.954) [-1144.748] * [-1144.807] (-1141.547) (-1142.963) (-1143.946) -- 0:00:28
Average standard deviation of split frequencies: 0.011117
560500 -- [-1144.840] (-1142.866) (-1149.325) (-1144.096) * (-1142.933) [-1141.926] (-1142.980) (-1144.319) -- 0:00:28
561000 -- [-1143.895] (-1144.349) (-1141.642) (-1144.106) * [-1142.924] (-1142.500) (-1141.041) (-1147.422) -- 0:00:28
561500 -- (-1143.338) (-1143.955) [-1143.848] (-1144.531) * (-1144.924) (-1141.754) (-1141.603) [-1141.979] -- 0:00:28
562000 -- [-1142.769] (-1143.654) (-1147.922) (-1148.198) * (-1144.324) [-1143.462] (-1145.493) (-1142.851) -- 0:00:28
562500 -- (-1141.826) [-1142.137] (-1147.067) (-1142.403) * (-1144.765) (-1147.897) (-1142.480) [-1141.972] -- 0:00:28
563000 -- [-1141.922] (-1143.386) (-1148.286) (-1142.337) * [-1143.320] (-1145.759) (-1143.844) (-1142.528) -- 0:00:27
563500 -- [-1144.517] (-1142.417) (-1148.703) (-1141.890) * (-1142.348) (-1144.595) (-1144.269) [-1141.720] -- 0:00:27
564000 -- (-1146.913) (-1147.524) (-1144.854) [-1144.133] * (-1143.600) (-1143.461) [-1142.618] (-1141.758) -- 0:00:27
564500 -- (-1144.399) [-1144.083] (-1142.806) (-1146.431) * (-1142.847) [-1141.502] (-1145.593) (-1143.026) -- 0:00:27
565000 -- (-1144.488) [-1146.627] (-1145.055) (-1144.272) * [-1143.745] (-1141.963) (-1145.446) (-1144.186) -- 0:00:27
Average standard deviation of split frequencies: 0.010827
565500 -- [-1141.127] (-1148.215) (-1142.548) (-1143.337) * (-1146.114) [-1141.880] (-1144.165) (-1143.655) -- 0:00:27
566000 -- (-1144.582) (-1148.232) [-1143.661] (-1144.520) * (-1143.913) [-1142.113] (-1145.340) (-1141.024) -- 0:00:27
566500 -- (-1144.605) (-1145.116) (-1142.357) [-1143.936] * (-1145.409) (-1141.986) (-1145.349) [-1142.531] -- 0:00:27
567000 -- [-1141.832] (-1143.197) (-1141.968) (-1144.277) * (-1143.721) [-1143.307] (-1147.025) (-1142.372) -- 0:00:27
567500 -- (-1142.028) (-1142.339) [-1143.003] (-1144.287) * (-1144.574) (-1146.115) [-1145.676] (-1144.333) -- 0:00:27
568000 -- (-1143.998) (-1144.888) (-1146.341) [-1141.976] * (-1143.029) (-1145.181) [-1141.796] (-1144.099) -- 0:00:27
568500 -- (-1143.160) (-1145.646) (-1146.027) [-1143.438] * (-1141.565) (-1144.121) (-1142.229) [-1144.509] -- 0:00:28
569000 -- [-1142.480] (-1143.268) (-1144.959) (-1142.930) * (-1143.838) [-1143.409] (-1142.083) (-1141.808) -- 0:00:28
569500 -- (-1142.155) (-1143.283) (-1149.722) [-1142.305] * [-1142.272] (-1147.168) (-1145.494) (-1141.913) -- 0:00:27
570000 -- (-1146.218) (-1143.420) (-1144.214) [-1142.310] * (-1142.247) [-1144.549] (-1145.012) (-1143.045) -- 0:00:27
Average standard deviation of split frequencies: 0.011060
570500 -- (-1148.196) (-1142.160) (-1143.281) [-1142.761] * [-1143.136] (-1143.869) (-1145.365) (-1148.008) -- 0:00:27
571000 -- [-1147.177] (-1143.698) (-1142.206) (-1144.898) * (-1147.948) (-1144.323) [-1144.140] (-1143.784) -- 0:00:27
571500 -- (-1141.967) [-1144.385] (-1142.658) (-1143.529) * [-1141.122] (-1142.226) (-1145.976) (-1146.819) -- 0:00:27
572000 -- (-1142.941) (-1145.656) (-1143.773) [-1149.219] * (-1142.191) [-1143.102] (-1145.150) (-1141.631) -- 0:00:27
572500 -- [-1144.611] (-1142.315) (-1146.395) (-1147.891) * (-1141.685) [-1147.759] (-1145.669) (-1143.417) -- 0:00:27
573000 -- (-1145.362) (-1144.668) [-1143.698] (-1142.629) * [-1141.561] (-1143.345) (-1144.306) (-1144.891) -- 0:00:27
573500 -- [-1143.513] (-1143.104) (-1143.765) (-1144.144) * (-1142.586) (-1141.824) [-1143.613] (-1143.423) -- 0:00:27
574000 -- (-1142.472) [-1143.481] (-1143.915) (-1142.431) * (-1143.349) [-1145.035] (-1148.678) (-1144.031) -- 0:00:27
574500 -- (-1141.912) (-1143.147) (-1143.164) [-1142.356] * (-1144.262) (-1144.426) (-1147.310) [-1144.340] -- 0:00:27
575000 -- (-1145.100) (-1142.976) (-1144.007) [-1145.264] * (-1142.831) [-1143.960] (-1145.095) (-1145.467) -- 0:00:27
Average standard deviation of split frequencies: 0.010730
575500 -- (-1144.681) (-1143.707) [-1142.366] (-1145.108) * (-1143.594) [-1142.209] (-1141.726) (-1142.239) -- 0:00:27
576000 -- (-1142.071) (-1144.370) [-1144.984] (-1141.134) * (-1142.295) (-1149.019) [-1141.651] (-1143.388) -- 0:00:27
576500 -- (-1143.291) [-1142.653] (-1146.403) (-1143.957) * (-1142.495) (-1145.316) (-1142.783) [-1142.537] -- 0:00:27
577000 -- (-1142.253) (-1145.081) (-1143.360) [-1142.452] * (-1144.584) [-1144.241] (-1145.060) (-1144.787) -- 0:00:27
577500 -- (-1142.486) [-1145.861] (-1141.726) (-1142.666) * (-1143.606) (-1143.525) (-1142.999) [-1144.331] -- 0:00:27
578000 -- (-1142.888) [-1143.188] (-1141.684) (-1143.975) * (-1143.343) [-1142.491] (-1146.108) (-1142.347) -- 0:00:27
578500 -- (-1145.116) (-1142.958) [-1141.796] (-1141.532) * (-1145.413) (-1142.513) (-1141.603) [-1146.294] -- 0:00:26
579000 -- (-1144.323) (-1142.365) [-1144.139] (-1142.136) * (-1144.877) (-1143.807) (-1145.748) [-1149.883] -- 0:00:26
579500 -- [-1141.428] (-1145.617) (-1144.421) (-1142.298) * [-1144.923] (-1143.212) (-1145.567) (-1151.460) -- 0:00:26
580000 -- (-1145.528) (-1143.592) [-1144.238] (-1144.694) * (-1143.660) [-1143.264] (-1145.060) (-1145.888) -- 0:00:26
Average standard deviation of split frequencies: 0.011140
580500 -- (-1143.485) (-1149.295) (-1143.747) [-1144.951] * (-1144.961) (-1141.221) [-1145.177] (-1145.808) -- 0:00:26
581000 -- (-1143.543) [-1143.241] (-1141.963) (-1141.997) * (-1144.359) (-1144.860) (-1144.179) [-1144.402] -- 0:00:26
581500 -- (-1147.147) [-1144.232] (-1141.455) (-1143.253) * (-1145.670) (-1142.601) (-1143.589) [-1144.034] -- 0:00:26
582000 -- (-1141.930) [-1144.718] (-1142.810) (-1146.095) * (-1144.242) (-1142.500) (-1142.891) [-1142.694] -- 0:00:26
582500 -- (-1142.138) (-1146.904) (-1143.619) [-1143.922] * [-1143.289] (-1142.035) (-1145.195) (-1142.541) -- 0:00:26
583000 -- (-1146.215) [-1142.954] (-1143.318) (-1143.753) * (-1141.330) [-1143.544] (-1146.559) (-1141.163) -- 0:00:26
583500 -- (-1147.013) (-1142.382) [-1144.424] (-1146.069) * (-1142.025) (-1142.228) [-1141.727] (-1141.803) -- 0:00:26
584000 -- (-1144.018) [-1145.890] (-1141.755) (-1144.998) * (-1141.233) (-1148.952) (-1141.022) [-1143.240] -- 0:00:27
584500 -- (-1143.858) (-1144.051) [-1142.753] (-1143.330) * (-1143.653) [-1144.633] (-1145.372) (-1142.857) -- 0:00:27
585000 -- (-1141.751) (-1142.582) [-1144.193] (-1143.343) * (-1144.097) [-1143.280] (-1143.573) (-1145.609) -- 0:00:26
Average standard deviation of split frequencies: 0.011441
585500 -- [-1142.377] (-1144.627) (-1143.081) (-1143.462) * (-1143.253) (-1144.721) (-1142.594) [-1149.602] -- 0:00:26
586000 -- (-1142.955) (-1144.036) [-1144.691] (-1142.438) * (-1142.543) [-1146.102] (-1143.094) (-1145.434) -- 0:00:26
586500 -- (-1153.526) (-1145.620) (-1144.332) [-1143.114] * (-1142.198) (-1142.283) (-1148.338) [-1143.812] -- 0:00:26
587000 -- (-1144.706) (-1144.840) (-1142.674) [-1145.994] * (-1144.245) (-1142.085) (-1141.722) [-1143.121] -- 0:00:26
587500 -- (-1146.314) (-1142.326) [-1142.834] (-1146.057) * (-1142.564) (-1143.649) (-1144.719) [-1144.687] -- 0:00:26
588000 -- [-1143.462] (-1142.016) (-1142.331) (-1144.676) * (-1143.062) (-1144.483) [-1143.931] (-1141.321) -- 0:00:26
588500 -- (-1142.941) (-1144.978) (-1144.623) [-1142.619] * [-1141.965] (-1141.758) (-1143.778) (-1141.749) -- 0:00:26
589000 -- [-1144.474] (-1142.523) (-1143.357) (-1142.595) * (-1142.617) (-1141.650) [-1142.085] (-1144.273) -- 0:00:26
589500 -- (-1143.902) (-1143.475) (-1143.626) [-1142.128] * [-1142.407] (-1146.839) (-1142.183) (-1146.193) -- 0:00:26
590000 -- (-1144.965) (-1145.229) [-1144.470] (-1148.668) * [-1143.770] (-1143.060) (-1146.741) (-1145.502) -- 0:00:26
Average standard deviation of split frequencies: 0.011129
590500 -- (-1142.535) (-1143.022) [-1142.437] (-1144.573) * [-1141.501] (-1143.600) (-1144.143) (-1142.225) -- 0:00:26
591000 -- (-1143.773) (-1145.537) (-1145.753) [-1142.711] * (-1141.803) (-1144.434) (-1142.390) [-1145.895] -- 0:00:26
591500 -- (-1144.589) (-1146.285) [-1147.110] (-1143.027) * (-1141.491) (-1141.769) [-1142.503] (-1149.144) -- 0:00:26
592000 -- (-1142.873) (-1143.732) [-1145.891] (-1142.974) * (-1144.594) [-1141.975] (-1142.446) (-1142.699) -- 0:00:26
592500 -- (-1142.236) (-1144.381) [-1143.323] (-1144.019) * (-1143.015) [-1143.882] (-1144.408) (-1143.352) -- 0:00:26
593000 -- (-1144.817) (-1142.574) (-1143.218) [-1145.467] * (-1142.305) (-1143.563) [-1144.746] (-1146.913) -- 0:00:26
593500 -- [-1143.778] (-1143.905) (-1146.394) (-1142.226) * (-1144.884) (-1144.676) (-1143.065) [-1141.834] -- 0:00:26
594000 -- (-1141.852) (-1142.799) (-1144.418) [-1145.994] * (-1144.395) [-1142.658] (-1144.342) (-1142.146) -- 0:00:25
594500 -- (-1141.640) [-1145.389] (-1143.532) (-1145.152) * [-1145.167] (-1143.027) (-1143.727) (-1143.809) -- 0:00:25
595000 -- [-1143.260] (-1141.393) (-1141.431) (-1144.346) * (-1144.050) (-1141.667) (-1143.628) [-1143.634] -- 0:00:25
Average standard deviation of split frequencies: 0.011029
595500 -- (-1142.184) (-1144.656) [-1142.023] (-1143.473) * (-1144.020) (-1143.871) (-1145.350) [-1142.406] -- 0:00:25
596000 -- (-1142.599) (-1143.519) (-1142.576) [-1146.507] * [-1143.500] (-1142.055) (-1144.974) (-1144.826) -- 0:00:25
596500 -- (-1148.409) (-1142.583) (-1142.664) [-1143.551] * (-1142.885) [-1142.161] (-1142.217) (-1144.202) -- 0:00:25
597000 -- (-1141.775) [-1142.217] (-1142.501) (-1142.189) * [-1143.633] (-1142.343) (-1145.698) (-1144.144) -- 0:00:25
597500 -- [-1141.480] (-1143.907) (-1144.174) (-1143.947) * [-1141.796] (-1142.139) (-1142.696) (-1143.346) -- 0:00:25
598000 -- (-1142.959) (-1141.137) (-1143.902) [-1144.956] * (-1143.210) (-1145.879) [-1142.495] (-1148.840) -- 0:00:25
598500 -- (-1142.139) [-1143.274] (-1143.779) (-1149.679) * [-1141.972] (-1142.513) (-1142.897) (-1143.304) -- 0:00:26
599000 -- [-1142.949] (-1144.774) (-1144.076) (-1145.405) * (-1143.276) [-1143.442] (-1145.432) (-1142.413) -- 0:00:26
599500 -- (-1143.158) (-1143.108) [-1143.185] (-1141.495) * (-1143.208) [-1145.046] (-1146.527) (-1143.311) -- 0:00:26
600000 -- (-1142.168) (-1145.254) (-1143.505) [-1141.502] * (-1143.061) (-1143.030) (-1146.677) [-1141.852] -- 0:00:25
Average standard deviation of split frequencies: 0.010595
600500 -- (-1145.834) (-1149.387) [-1143.177] (-1142.266) * (-1143.790) (-1143.023) (-1147.750) [-1142.245] -- 0:00:25
601000 -- (-1144.779) [-1146.425] (-1141.983) (-1142.697) * (-1145.267) [-1142.133] (-1142.689) (-1141.249) -- 0:00:25
601500 -- (-1145.211) (-1142.626) [-1144.913] (-1142.401) * (-1141.567) [-1143.100] (-1142.275) (-1149.161) -- 0:00:25
602000 -- (-1143.352) (-1143.300) [-1145.516] (-1143.512) * (-1141.169) [-1145.163] (-1143.967) (-1146.650) -- 0:00:25
602500 -- (-1143.508) [-1144.516] (-1145.567) (-1146.164) * (-1146.103) [-1143.414] (-1143.966) (-1149.917) -- 0:00:25
603000 -- (-1142.678) (-1143.781) [-1149.724] (-1148.433) * [-1144.163] (-1142.613) (-1141.269) (-1150.453) -- 0:00:25
603500 -- (-1144.060) (-1142.714) [-1142.987] (-1143.989) * (-1141.562) [-1141.664] (-1144.322) (-1146.238) -- 0:00:25
604000 -- [-1145.199] (-1142.555) (-1144.975) (-1144.321) * (-1142.302) (-1143.818) [-1146.386] (-1144.236) -- 0:00:25
604500 -- (-1143.619) [-1142.366] (-1142.879) (-1143.626) * [-1141.997] (-1143.672) (-1142.676) (-1144.239) -- 0:00:25
605000 -- (-1147.145) (-1146.553) (-1141.307) [-1143.270] * (-1144.211) (-1142.574) (-1143.085) [-1143.877] -- 0:00:25
Average standard deviation of split frequencies: 0.010502
605500 -- [-1142.204] (-1144.463) (-1142.522) (-1146.801) * (-1143.020) [-1142.637] (-1142.942) (-1143.037) -- 0:00:25
606000 -- (-1143.452) (-1143.097) (-1142.431) [-1141.817] * (-1143.902) [-1141.642] (-1144.570) (-1144.782) -- 0:00:25
606500 -- (-1142.295) (-1144.082) (-1144.133) [-1143.308] * (-1141.773) [-1142.123] (-1146.640) (-1143.237) -- 0:00:25
607000 -- [-1141.912] (-1146.130) (-1144.108) (-1143.190) * (-1142.445) (-1143.447) [-1146.935] (-1141.973) -- 0:00:25
607500 -- (-1145.869) (-1144.573) [-1143.240] (-1142.773) * (-1142.381) [-1146.151] (-1145.129) (-1143.449) -- 0:00:25
608000 -- (-1145.306) [-1146.298] (-1141.292) (-1143.268) * [-1141.421] (-1142.402) (-1141.734) (-1142.776) -- 0:00:25
608500 -- (-1145.048) (-1145.280) [-1141.465] (-1143.439) * (-1143.175) (-1142.456) [-1143.606] (-1143.771) -- 0:00:25
609000 -- (-1144.286) [-1143.444] (-1146.865) (-1143.446) * (-1143.024) (-1141.254) [-1143.243] (-1144.793) -- 0:00:25
609500 -- [-1144.145] (-1144.409) (-1145.907) (-1144.197) * (-1143.896) (-1143.772) (-1142.515) [-1144.567] -- 0:00:24
610000 -- (-1142.917) [-1142.684] (-1144.928) (-1143.666) * (-1148.855) (-1148.451) (-1143.026) [-1143.111] -- 0:00:24
Average standard deviation of split frequencies: 0.010121
610500 -- (-1143.399) (-1146.797) (-1145.458) [-1142.922] * (-1145.965) [-1144.525] (-1143.111) (-1142.385) -- 0:00:24
611000 -- (-1143.160) (-1142.792) [-1143.204] (-1146.915) * (-1143.884) (-1142.603) (-1142.593) [-1142.322] -- 0:00:24
611500 -- (-1145.015) [-1141.732] (-1141.605) (-1142.040) * (-1143.130) [-1142.055] (-1142.546) (-1141.488) -- 0:00:24
612000 -- (-1143.236) [-1141.384] (-1143.505) (-1144.721) * [-1141.298] (-1145.452) (-1143.910) (-1141.444) -- 0:00:24
612500 -- [-1145.338] (-1143.987) (-1146.539) (-1143.119) * (-1141.519) (-1143.066) (-1144.224) [-1142.098] -- 0:00:24
613000 -- (-1143.031) (-1141.276) [-1144.595] (-1143.017) * [-1142.805] (-1144.253) (-1144.830) (-1142.719) -- 0:00:25
613500 -- (-1142.476) (-1143.406) [-1144.985] (-1145.265) * (-1143.209) [-1150.466] (-1143.702) (-1145.552) -- 0:00:25
614000 -- [-1142.491] (-1143.299) (-1148.385) (-1144.857) * (-1142.558) (-1143.048) [-1143.008] (-1146.867) -- 0:00:25
614500 -- [-1148.210] (-1144.171) (-1146.581) (-1141.694) * (-1143.580) (-1142.975) (-1143.783) [-1144.896] -- 0:00:25
615000 -- (-1143.625) (-1145.098) (-1143.277) [-1141.657] * [-1144.336] (-1143.597) (-1147.592) (-1144.798) -- 0:00:25
Average standard deviation of split frequencies: 0.010161
615500 -- (-1144.516) (-1142.721) [-1145.774] (-1142.123) * (-1142.110) (-1146.537) (-1152.298) [-1141.854] -- 0:00:24
616000 -- (-1145.741) (-1142.640) (-1146.147) [-1142.269] * (-1146.109) (-1142.518) [-1149.332] (-1146.176) -- 0:00:24
616500 -- (-1145.644) (-1146.050) (-1144.265) [-1145.362] * (-1147.293) (-1142.327) [-1142.140] (-1142.508) -- 0:00:24
617000 -- (-1143.549) [-1142.471] (-1144.758) (-1151.082) * [-1142.624] (-1142.293) (-1143.734) (-1142.651) -- 0:00:24
617500 -- (-1141.835) (-1141.550) (-1141.589) [-1145.700] * [-1143.713] (-1141.911) (-1143.253) (-1142.411) -- 0:00:24
618000 -- (-1141.576) (-1141.657) [-1141.243] (-1144.280) * (-1142.775) [-1142.723] (-1145.514) (-1142.349) -- 0:00:24
618500 -- (-1144.311) [-1142.037] (-1141.549) (-1141.466) * (-1142.010) (-1143.531) (-1142.603) [-1143.129] -- 0:00:24
619000 -- (-1142.454) (-1142.710) [-1142.857] (-1142.628) * (-1143.586) (-1150.625) [-1141.844] (-1143.805) -- 0:00:24
619500 -- (-1143.852) (-1142.913) [-1141.964] (-1141.404) * (-1144.571) (-1146.200) (-1144.124) [-1143.742] -- 0:00:24
620000 -- (-1142.447) [-1142.674] (-1145.471) (-1141.248) * (-1144.922) (-1142.921) (-1143.173) [-1142.566] -- 0:00:24
Average standard deviation of split frequencies: 0.010127
620500 -- [-1141.740] (-1143.456) (-1146.781) (-1141.734) * (-1148.568) (-1143.371) [-1143.393] (-1144.069) -- 0:00:24
621000 -- (-1142.160) [-1143.751] (-1142.171) (-1142.386) * (-1143.477) (-1144.380) (-1142.430) [-1141.186] -- 0:00:24
621500 -- (-1144.893) (-1142.063) (-1141.607) [-1142.849] * (-1142.793) [-1143.313] (-1145.270) (-1142.195) -- 0:00:24
622000 -- (-1146.622) (-1141.675) (-1149.585) [-1141.465] * (-1146.522) [-1141.710] (-1142.192) (-1142.615) -- 0:00:24
622500 -- (-1145.687) (-1144.323) [-1142.515] (-1143.360) * (-1142.733) (-1141.233) (-1141.372) [-1142.019] -- 0:00:24
623000 -- [-1142.220] (-1141.512) (-1141.884) (-1144.303) * (-1141.335) (-1143.457) (-1141.595) [-1141.873] -- 0:00:24
623500 -- [-1144.674] (-1142.108) (-1141.291) (-1145.408) * [-1142.936] (-1144.731) (-1141.701) (-1142.193) -- 0:00:24
624000 -- (-1141.780) (-1142.119) (-1143.821) [-1144.629] * [-1144.457] (-1144.113) (-1145.038) (-1142.712) -- 0:00:24
624500 -- (-1142.924) (-1143.286) (-1142.666) [-1142.103] * (-1143.725) [-1143.828] (-1145.375) (-1142.354) -- 0:00:24
625000 -- (-1143.605) (-1143.524) [-1146.682] (-1144.435) * (-1145.227) (-1143.408) (-1147.968) [-1142.904] -- 0:00:24
Average standard deviation of split frequencies: 0.009455
625500 -- (-1143.264) [-1142.378] (-1144.817) (-1144.693) * [-1143.060] (-1143.080) (-1146.332) (-1146.771) -- 0:00:23
626000 -- (-1146.817) (-1141.632) [-1147.462] (-1143.158) * (-1144.028) (-1148.895) (-1146.362) [-1145.265] -- 0:00:23
626500 -- (-1143.361) (-1142.380) (-1148.720) [-1142.602] * (-1141.618) (-1142.804) (-1146.238) [-1143.719] -- 0:00:23
627000 -- (-1142.570) (-1141.484) (-1142.632) [-1145.196] * (-1141.561) [-1142.403] (-1144.381) (-1145.685) -- 0:00:23
627500 -- (-1144.221) (-1143.212) [-1143.259] (-1142.225) * (-1145.333) (-1142.434) (-1145.061) [-1141.926] -- 0:00:23
628000 -- (-1143.314) (-1142.347) (-1143.099) [-1143.672] * (-1144.425) (-1143.312) [-1142.086] (-1142.539) -- 0:00:24
628500 -- [-1143.204] (-1145.608) (-1142.368) (-1143.202) * (-1144.837) (-1142.693) [-1141.660] (-1142.146) -- 0:00:24
629000 -- (-1144.850) [-1141.329] (-1144.493) (-1142.977) * (-1143.965) [-1142.879] (-1142.063) (-1141.744) -- 0:00:24
629500 -- (-1143.802) [-1142.637] (-1147.120) (-1141.727) * (-1143.658) [-1142.623] (-1142.921) (-1142.407) -- 0:00:24
630000 -- [-1143.589] (-1141.626) (-1141.766) (-1141.828) * (-1143.628) [-1142.409] (-1145.299) (-1142.728) -- 0:00:24
Average standard deviation of split frequencies: 0.009385
630500 -- (-1141.701) [-1142.845] (-1142.840) (-1141.777) * (-1141.924) [-1142.075] (-1145.224) (-1142.754) -- 0:00:24
631000 -- (-1142.713) (-1146.657) (-1145.948) [-1142.903] * (-1142.770) [-1141.298] (-1142.182) (-1144.553) -- 0:00:23
631500 -- [-1144.014] (-1148.872) (-1146.299) (-1146.448) * (-1143.694) (-1143.899) (-1143.515) [-1145.621] -- 0:00:23
632000 -- [-1143.090] (-1146.917) (-1143.058) (-1144.319) * (-1147.746) [-1143.254] (-1143.144) (-1143.199) -- 0:00:23
632500 -- [-1141.443] (-1144.492) (-1144.459) (-1146.631) * (-1144.009) (-1141.515) [-1142.367] (-1144.128) -- 0:00:23
633000 -- (-1142.685) (-1145.503) [-1145.496] (-1147.217) * (-1142.181) [-1141.201] (-1141.298) (-1143.061) -- 0:00:23
633500 -- (-1143.682) (-1144.776) [-1144.030] (-1146.459) * (-1144.120) (-1144.495) [-1142.405] (-1142.293) -- 0:00:23
634000 -- (-1141.995) (-1146.023) [-1145.637] (-1144.427) * (-1149.009) (-1144.107) [-1142.542] (-1143.857) -- 0:00:23
634500 -- (-1141.667) [-1144.425] (-1144.637) (-1144.047) * [-1147.258] (-1142.815) (-1144.891) (-1143.589) -- 0:00:23
635000 -- (-1145.245) (-1144.425) [-1142.161] (-1143.838) * (-1143.683) [-1143.132] (-1144.641) (-1144.599) -- 0:00:23
Average standard deviation of split frequencies: 0.009141
635500 -- (-1143.619) [-1144.577] (-1145.472) (-1142.657) * (-1142.376) (-1142.831) [-1142.781] (-1143.314) -- 0:00:23
636000 -- (-1148.409) (-1142.920) [-1145.882] (-1141.553) * (-1145.206) (-1142.851) [-1141.961] (-1142.913) -- 0:00:23
636500 -- (-1144.464) (-1144.504) [-1141.582] (-1141.684) * (-1146.176) (-1144.191) [-1141.460] (-1144.403) -- 0:00:23
637000 -- (-1142.661) [-1145.041] (-1141.841) (-1141.857) * (-1148.663) (-1145.276) (-1141.223) [-1143.495] -- 0:00:23
637500 -- (-1143.316) [-1142.444] (-1142.611) (-1142.009) * (-1145.392) (-1143.211) [-1141.826] (-1145.872) -- 0:00:23
638000 -- [-1142.015] (-1143.917) (-1144.666) (-1142.372) * (-1142.883) (-1143.167) (-1145.817) [-1144.457] -- 0:00:23
638500 -- (-1142.640) (-1143.733) [-1142.841] (-1142.040) * [-1146.447] (-1143.622) (-1143.288) (-1149.670) -- 0:00:23
639000 -- [-1142.749] (-1145.512) (-1143.793) (-1141.837) * (-1141.575) [-1142.175] (-1141.993) (-1145.414) -- 0:00:23
639500 -- (-1146.779) (-1142.322) (-1144.159) [-1142.747] * (-1142.533) [-1142.551] (-1143.666) (-1144.003) -- 0:00:23
640000 -- (-1143.463) [-1144.043] (-1145.183) (-1142.930) * [-1145.479] (-1143.634) (-1145.262) (-1146.690) -- 0:00:23
Average standard deviation of split frequencies: 0.009279
640500 -- (-1142.778) [-1145.880] (-1141.746) (-1143.527) * (-1143.561) (-1143.975) [-1143.958] (-1142.936) -- 0:00:23
641000 -- (-1145.167) (-1154.067) (-1141.687) [-1146.257] * (-1141.633) (-1144.688) [-1143.222] (-1143.658) -- 0:00:22
641500 -- (-1143.208) (-1143.265) [-1141.634] (-1146.153) * [-1141.633] (-1143.738) (-1144.677) (-1147.549) -- 0:00:22
642000 -- (-1143.434) (-1144.262) (-1143.727) [-1144.055] * (-1142.410) [-1141.265] (-1144.661) (-1144.251) -- 0:00:22
642500 -- (-1146.361) (-1142.479) [-1143.971] (-1141.249) * (-1141.920) [-1141.433] (-1144.219) (-1144.035) -- 0:00:22
643000 -- [-1142.531] (-1145.658) (-1147.676) (-1143.248) * (-1143.333) (-1141.914) [-1143.745] (-1143.395) -- 0:00:23
643500 -- [-1148.713] (-1142.453) (-1146.427) (-1142.850) * (-1143.391) (-1141.465) (-1142.827) [-1143.715] -- 0:00:23
644000 -- (-1144.645) (-1144.125) [-1142.556] (-1143.159) * (-1150.252) (-1141.753) (-1143.478) [-1142.766] -- 0:00:23
644500 -- (-1142.936) (-1144.778) (-1141.369) [-1143.839] * (-1144.623) (-1142.614) [-1142.422] (-1142.809) -- 0:00:23
645000 -- (-1146.050) [-1145.575] (-1141.887) (-1143.996) * [-1143.845] (-1141.986) (-1142.806) (-1146.401) -- 0:00:23
Average standard deviation of split frequencies: 0.009794
645500 -- (-1143.264) (-1144.795) [-1141.288] (-1145.420) * (-1144.799) (-1144.212) [-1142.869] (-1143.215) -- 0:00:23
646000 -- (-1143.384) (-1142.947) [-1143.860] (-1146.260) * (-1142.660) (-1144.755) (-1141.972) [-1145.198] -- 0:00:23
646500 -- [-1146.067] (-1142.779) (-1147.042) (-1144.320) * (-1144.773) (-1144.375) (-1142.384) [-1143.100] -- 0:00:22
647000 -- (-1144.127) (-1144.582) (-1142.552) [-1145.149] * (-1144.477) [-1142.943] (-1146.988) (-1143.963) -- 0:00:22
647500 -- (-1148.786) [-1142.493] (-1144.641) (-1141.292) * (-1144.757) (-1144.234) (-1144.273) [-1141.869] -- 0:00:22
648000 -- (-1146.360) [-1142.008] (-1147.008) (-1145.123) * (-1144.820) [-1143.698] (-1142.137) (-1144.980) -- 0:00:22
648500 -- [-1142.811] (-1142.997) (-1143.679) (-1146.506) * (-1141.836) (-1142.967) (-1144.832) [-1142.696] -- 0:00:22
649000 -- [-1145.420] (-1144.833) (-1142.271) (-1142.808) * (-1145.285) (-1142.603) (-1142.442) [-1145.062] -- 0:00:22
649500 -- (-1149.825) (-1143.986) (-1141.585) [-1144.826] * (-1142.728) [-1143.786] (-1145.181) (-1144.835) -- 0:00:22
650000 -- (-1146.139) (-1144.346) (-1147.072) [-1142.508] * (-1142.693) [-1149.436] (-1142.631) (-1145.394) -- 0:00:22
Average standard deviation of split frequencies: 0.009781
650500 -- (-1144.255) [-1146.108] (-1143.355) (-1142.692) * (-1144.028) [-1144.319] (-1148.031) (-1142.057) -- 0:00:22
651000 -- (-1142.197) [-1144.172] (-1143.663) (-1142.295) * [-1144.209] (-1145.160) (-1145.884) (-1142.277) -- 0:00:22
651500 -- (-1144.450) (-1147.068) (-1143.657) [-1142.247] * (-1143.365) [-1142.266] (-1142.537) (-1141.871) -- 0:00:22
652000 -- (-1144.215) (-1143.878) [-1142.857] (-1144.563) * (-1146.077) [-1144.022] (-1144.691) (-1141.885) -- 0:00:22
652500 -- [-1144.073] (-1143.872) (-1143.222) (-1143.213) * (-1144.392) (-1141.957) (-1142.596) [-1141.841] -- 0:00:22
653000 -- (-1146.854) (-1147.475) [-1143.259] (-1143.419) * (-1146.805) (-1142.176) [-1148.287] (-1141.211) -- 0:00:22
653500 -- (-1143.727) (-1146.967) [-1141.429] (-1147.645) * (-1145.167) (-1141.532) (-1144.021) [-1141.814] -- 0:00:22
654000 -- (-1146.539) [-1143.265] (-1140.993) (-1146.965) * (-1143.363) (-1144.080) (-1141.968) [-1143.275] -- 0:00:22
654500 -- [-1142.237] (-1143.897) (-1141.910) (-1143.418) * [-1141.975] (-1142.138) (-1142.222) (-1142.659) -- 0:00:22
655000 -- (-1141.889) (-1143.389) [-1143.181] (-1146.829) * (-1142.837) (-1142.947) (-1144.714) [-1142.421] -- 0:00:22
Average standard deviation of split frequencies: 0.010100
655500 -- (-1144.763) (-1147.273) (-1144.363) [-1144.808] * (-1142.060) (-1141.998) [-1141.831] (-1142.527) -- 0:00:22
656000 -- (-1143.020) [-1146.407] (-1142.398) (-1144.614) * (-1143.564) (-1144.684) (-1143.698) [-1148.500] -- 0:00:22
656500 -- [-1141.770] (-1147.693) (-1143.956) (-1145.569) * (-1141.398) (-1142.062) (-1148.977) [-1147.949] -- 0:00:21
657000 -- (-1142.114) (-1143.561) [-1144.231] (-1145.781) * (-1143.049) [-1143.201] (-1152.009) (-1144.563) -- 0:00:21
657500 -- (-1142.112) (-1143.804) [-1145.022] (-1146.185) * [-1144.179] (-1141.504) (-1147.541) (-1143.795) -- 0:00:21
658000 -- (-1143.698) [-1142.705] (-1148.750) (-1143.174) * (-1143.939) [-1144.893] (-1142.744) (-1142.755) -- 0:00:21
658500 -- (-1145.938) (-1144.062) (-1141.397) [-1146.490] * (-1142.575) (-1141.639) (-1143.425) [-1142.634] -- 0:00:22
659000 -- (-1143.524) (-1144.062) [-1142.825] (-1143.554) * (-1141.184) (-1141.688) (-1144.372) [-1142.535] -- 0:00:22
659500 -- (-1145.060) (-1144.130) (-1143.039) [-1143.709] * [-1144.285] (-1143.976) (-1143.721) (-1142.380) -- 0:00:22
660000 -- (-1143.877) (-1142.787) (-1143.920) [-1142.333] * (-1151.014) (-1146.130) [-1142.596] (-1143.900) -- 0:00:22
Average standard deviation of split frequencies: 0.009989
660500 -- (-1143.142) (-1146.684) (-1141.953) [-1142.296] * (-1144.635) (-1144.694) [-1141.194] (-1142.194) -- 0:00:22
661000 -- (-1144.755) [-1142.368] (-1144.177) (-1142.698) * (-1141.612) (-1151.920) [-1144.015] (-1144.549) -- 0:00:22
661500 -- (-1142.246) (-1143.991) (-1148.100) [-1144.436] * (-1142.616) [-1144.454] (-1143.109) (-1147.251) -- 0:00:22
662000 -- (-1143.395) (-1143.909) [-1143.586] (-1142.867) * (-1143.286) (-1147.898) (-1141.440) [-1141.459] -- 0:00:21
662500 -- (-1144.980) (-1143.770) (-1146.845) [-1145.911] * [-1141.849] (-1146.178) (-1142.635) (-1142.323) -- 0:00:21
663000 -- (-1145.696) (-1143.284) [-1142.109] (-1141.981) * (-1144.341) (-1141.313) [-1143.435] (-1141.409) -- 0:00:21
663500 -- (-1143.575) (-1141.538) (-1143.083) [-1143.076] * (-1142.897) [-1143.228] (-1146.398) (-1141.905) -- 0:00:21
664000 -- (-1144.594) [-1145.874] (-1142.308) (-1141.466) * (-1141.449) [-1142.421] (-1145.614) (-1147.768) -- 0:00:21
664500 -- (-1147.475) (-1147.464) (-1141.239) [-1142.269] * (-1141.385) (-1142.924) [-1145.075] (-1148.617) -- 0:00:21
665000 -- (-1152.899) [-1141.531] (-1143.847) (-1143.761) * (-1141.900) (-1142.759) (-1144.013) [-1146.864] -- 0:00:21
Average standard deviation of split frequencies: 0.009368
665500 -- (-1145.200) (-1143.740) [-1141.147] (-1143.758) * (-1141.869) (-1142.343) [-1144.884] (-1143.097) -- 0:00:21
666000 -- (-1145.178) (-1143.207) (-1144.138) [-1142.369] * (-1144.352) (-1142.610) (-1143.830) [-1143.247] -- 0:00:21
666500 -- (-1142.192) [-1143.957] (-1142.042) (-1142.416) * (-1143.233) (-1145.827) (-1145.374) [-1142.421] -- 0:00:21
667000 -- (-1142.820) [-1144.206] (-1142.701) (-1142.718) * (-1143.261) [-1147.761] (-1146.456) (-1142.226) -- 0:00:21
667500 -- (-1145.807) (-1144.472) [-1142.246] (-1146.163) * [-1143.342] (-1146.032) (-1147.004) (-1145.280) -- 0:00:21
668000 -- (-1146.426) (-1144.408) (-1144.249) [-1142.645] * (-1145.768) [-1143.303] (-1148.236) (-1141.625) -- 0:00:21
668500 -- (-1143.186) (-1142.067) [-1144.889] (-1145.692) * [-1142.493] (-1145.035) (-1147.747) (-1143.046) -- 0:00:21
669000 -- [-1144.249] (-1143.705) (-1145.303) (-1145.037) * (-1142.144) (-1142.318) [-1143.220] (-1143.705) -- 0:00:21
669500 -- [-1142.191] (-1147.154) (-1143.796) (-1142.887) * [-1141.111] (-1142.286) (-1143.038) (-1144.455) -- 0:00:21
670000 -- [-1141.687] (-1144.373) (-1147.604) (-1141.744) * (-1142.687) (-1141.489) [-1142.213] (-1144.806) -- 0:00:21
Average standard deviation of split frequencies: 0.009427
670500 -- (-1142.410) [-1142.994] (-1142.894) (-1142.383) * (-1142.250) (-1142.474) (-1142.262) [-1145.689] -- 0:00:21
671000 -- (-1142.456) (-1142.153) [-1143.003] (-1145.967) * (-1142.617) (-1144.388) (-1142.102) [-1143.619] -- 0:00:21
671500 -- [-1142.208] (-1141.742) (-1148.620) (-1146.742) * (-1143.326) (-1141.223) (-1145.171) [-1141.964] -- 0:00:21
672000 -- (-1143.439) (-1142.467) (-1149.427) [-1142.688] * (-1143.234) (-1141.165) [-1147.329] (-1143.718) -- 0:00:20
672500 -- (-1146.654) (-1144.395) (-1144.964) [-1142.619] * [-1141.867] (-1141.126) (-1150.674) (-1142.319) -- 0:00:20
673000 -- (-1144.539) (-1142.167) [-1141.334] (-1146.365) * (-1141.717) [-1142.301] (-1144.551) (-1143.388) -- 0:00:20
673500 -- (-1144.893) [-1142.846] (-1143.710) (-1147.462) * (-1141.717) (-1142.630) [-1142.678] (-1148.109) -- 0:00:20
674000 -- [-1141.840] (-1145.961) (-1145.223) (-1142.044) * (-1141.905) [-1141.684] (-1141.777) (-1148.224) -- 0:00:21
674500 -- [-1141.842] (-1143.135) (-1144.756) (-1142.942) * (-1141.588) [-1142.848] (-1146.610) (-1143.718) -- 0:00:21
675000 -- (-1141.495) [-1144.297] (-1143.137) (-1143.808) * [-1141.842] (-1143.025) (-1143.235) (-1148.008) -- 0:00:21
Average standard deviation of split frequencies: 0.008532
675500 -- [-1145.335] (-1145.351) (-1145.132) (-1146.483) * (-1141.746) (-1143.516) [-1145.224] (-1147.201) -- 0:00:21
676000 -- (-1144.128) [-1142.591] (-1146.416) (-1145.547) * (-1144.490) (-1142.000) (-1144.097) [-1145.879] -- 0:00:21
676500 -- (-1142.941) (-1145.590) [-1143.723] (-1145.386) * (-1147.535) [-1146.072] (-1142.303) (-1142.441) -- 0:00:21
677000 -- (-1141.486) (-1141.463) (-1143.684) [-1148.217] * [-1142.680] (-1142.397) (-1144.533) (-1144.866) -- 0:00:20
677500 -- (-1144.003) [-1142.688] (-1144.543) (-1148.852) * (-1144.171) [-1141.813] (-1144.140) (-1143.852) -- 0:00:20
678000 -- (-1151.666) (-1145.593) [-1144.470] (-1142.697) * (-1143.058) [-1144.984] (-1143.702) (-1146.094) -- 0:00:20
678500 -- (-1145.564) (-1143.687) [-1142.633] (-1143.742) * (-1143.778) (-1141.726) (-1143.488) [-1144.817] -- 0:00:20
679000 -- (-1143.237) (-1143.317) (-1142.823) [-1141.485] * (-1143.669) (-1142.874) [-1143.466] (-1143.045) -- 0:00:20
679500 -- (-1142.753) [-1142.442] (-1144.126) (-1142.593) * (-1143.039) (-1145.258) (-1141.798) [-1143.339] -- 0:00:20
680000 -- (-1143.976) (-1145.687) [-1141.294] (-1141.980) * (-1142.855) (-1143.553) [-1142.643] (-1142.433) -- 0:00:20
Average standard deviation of split frequencies: 0.008474
680500 -- (-1143.244) [-1145.476] (-1143.128) (-1142.524) * (-1144.170) (-1142.831) [-1143.331] (-1142.093) -- 0:00:20
681000 -- (-1141.266) (-1146.235) [-1144.496] (-1145.460) * (-1147.801) (-1142.498) [-1142.911] (-1141.260) -- 0:00:20
681500 -- (-1141.807) (-1147.616) (-1141.124) [-1142.679] * (-1142.248) [-1143.021] (-1142.802) (-1141.366) -- 0:00:20
682000 -- (-1143.828) (-1147.297) [-1141.957] (-1144.226) * (-1143.219) [-1143.216] (-1143.424) (-1146.727) -- 0:00:20
682500 -- (-1148.688) (-1142.971) [-1141.881] (-1142.789) * (-1143.555) (-1143.832) (-1146.624) [-1145.756] -- 0:00:20
683000 -- (-1142.024) (-1146.084) [-1144.332] (-1143.047) * (-1144.889) (-1144.701) (-1146.697) [-1146.822] -- 0:00:20
683500 -- (-1142.901) (-1145.816) [-1144.552] (-1141.563) * (-1142.151) (-1141.670) [-1141.613] (-1146.627) -- 0:00:20
684000 -- (-1142.453) [-1142.870] (-1143.947) (-1141.771) * [-1141.687] (-1142.737) (-1143.675) (-1142.624) -- 0:00:20
684500 -- (-1144.909) [-1144.084] (-1142.117) (-1145.222) * [-1142.496] (-1145.434) (-1142.251) (-1143.267) -- 0:00:20
685000 -- (-1145.127) (-1143.008) [-1141.900] (-1144.050) * (-1143.691) (-1143.704) [-1141.811] (-1143.518) -- 0:00:20
Average standard deviation of split frequencies: 0.008448
685500 -- (-1144.085) (-1144.049) [-1142.998] (-1147.254) * (-1143.236) [-1142.624] (-1142.276) (-1141.650) -- 0:00:20
686000 -- (-1144.002) [-1142.427] (-1144.108) (-1145.313) * (-1142.592) (-1143.845) (-1142.171) [-1143.707] -- 0:00:20
686500 -- (-1146.728) [-1143.803] (-1143.294) (-1142.413) * (-1143.523) [-1145.871] (-1142.103) (-1143.191) -- 0:00:20
687000 -- (-1145.411) (-1147.237) (-1143.191) [-1142.192] * (-1144.241) [-1142.125] (-1143.713) (-1144.459) -- 0:00:20
687500 -- (-1144.607) (-1146.563) [-1141.653] (-1145.598) * (-1141.531) [-1144.843] (-1145.923) (-1144.804) -- 0:00:20
688000 -- (-1144.156) [-1143.033] (-1144.804) (-1145.660) * (-1141.814) (-1144.177) (-1141.626) [-1143.883] -- 0:00:19
688500 -- (-1146.442) (-1142.299) [-1141.991] (-1143.908) * (-1144.923) (-1146.518) [-1148.984] (-1142.005) -- 0:00:19
689000 -- (-1145.824) (-1142.067) (-1141.107) [-1145.797] * (-1144.138) [-1148.904] (-1148.339) (-1145.392) -- 0:00:20
689500 -- [-1143.323] (-1142.073) (-1141.728) (-1142.733) * (-1143.909) (-1143.234) [-1141.955] (-1141.946) -- 0:00:20
690000 -- (-1143.042) (-1142.753) (-1145.493) [-1142.615] * (-1143.391) (-1142.706) [-1143.377] (-1145.823) -- 0:00:20
Average standard deviation of split frequencies: 0.008311
690500 -- (-1142.781) [-1142.402] (-1142.916) (-1143.337) * [-1147.000] (-1144.106) (-1142.012) (-1142.508) -- 0:00:20
691000 -- (-1142.544) [-1142.353] (-1142.647) (-1141.975) * (-1143.802) (-1143.287) [-1142.737] (-1142.612) -- 0:00:20
691500 -- (-1147.724) (-1146.551) (-1145.647) [-1144.807] * (-1142.292) (-1141.856) [-1142.409] (-1142.531) -- 0:00:20
692000 -- [-1141.363] (-1145.521) (-1145.932) (-1142.443) * (-1143.068) (-1142.640) (-1141.456) [-1144.313] -- 0:00:20
692500 -- (-1143.597) (-1142.916) [-1142.744] (-1141.431) * (-1141.915) (-1145.087) (-1142.499) [-1143.739] -- 0:00:19
693000 -- (-1146.978) [-1145.393] (-1142.030) (-1142.072) * (-1145.316) [-1145.871] (-1144.686) (-1142.580) -- 0:00:19
693500 -- [-1145.594] (-1144.108) (-1143.840) (-1143.487) * (-1145.079) (-1146.993) [-1144.106] (-1147.103) -- 0:00:19
694000 -- (-1146.067) [-1143.087] (-1143.983) (-1144.657) * (-1143.376) [-1142.314] (-1145.638) (-1144.406) -- 0:00:19
694500 -- (-1145.384) [-1142.014] (-1145.195) (-1143.729) * [-1142.633] (-1142.440) (-1144.808) (-1141.758) -- 0:00:19
695000 -- (-1144.239) (-1141.817) (-1144.206) [-1143.796] * (-1142.369) [-1142.679] (-1145.353) (-1141.862) -- 0:00:19
Average standard deviation of split frequencies: 0.008526
695500 -- (-1144.024) (-1143.213) [-1142.192] (-1143.327) * (-1142.092) [-1141.961] (-1148.504) (-1144.409) -- 0:00:19
696000 -- (-1145.806) (-1143.813) [-1143.200] (-1146.225) * [-1142.227] (-1146.729) (-1146.380) (-1145.672) -- 0:00:19
696500 -- (-1145.288) (-1142.926) [-1141.752] (-1141.114) * (-1144.097) [-1142.837] (-1146.107) (-1142.723) -- 0:00:19
697000 -- (-1144.387) (-1142.467) [-1141.830] (-1141.220) * [-1141.500] (-1143.532) (-1147.929) (-1142.921) -- 0:00:19
697500 -- (-1141.554) [-1143.989] (-1143.235) (-1142.847) * (-1143.542) (-1147.004) (-1145.007) [-1143.250] -- 0:00:19
698000 -- (-1141.968) [-1142.869] (-1143.061) (-1142.192) * (-1143.027) (-1141.883) [-1144.597] (-1141.720) -- 0:00:19
698500 -- [-1143.527] (-1142.908) (-1146.134) (-1142.824) * (-1142.781) (-1142.457) (-1142.116) [-1143.142] -- 0:00:19
699000 -- [-1142.725] (-1142.484) (-1141.659) (-1144.649) * (-1146.221) (-1143.643) [-1144.621] (-1143.049) -- 0:00:19
699500 -- [-1144.558] (-1142.486) (-1142.947) (-1142.239) * (-1144.775) (-1142.106) [-1143.681] (-1144.536) -- 0:00:19
700000 -- (-1145.934) [-1142.700] (-1141.487) (-1142.872) * [-1142.561] (-1142.235) (-1143.206) (-1148.305) -- 0:00:19
Average standard deviation of split frequencies: 0.008628
700500 -- (-1143.042) [-1144.937] (-1142.905) (-1142.664) * (-1141.711) (-1146.273) (-1143.000) [-1143.235] -- 0:00:19
701000 -- (-1142.388) (-1147.393) [-1142.655] (-1148.935) * [-1142.627] (-1143.973) (-1144.674) (-1146.835) -- 0:00:19
701500 -- (-1142.557) (-1146.130) (-1143.925) [-1144.206] * [-1143.318] (-1143.845) (-1142.533) (-1146.556) -- 0:00:19
702000 -- (-1143.537) (-1147.882) [-1142.144] (-1146.116) * (-1145.501) [-1143.892] (-1141.024) (-1145.969) -- 0:00:19
702500 -- [-1144.793] (-1144.526) (-1141.377) (-1148.675) * (-1146.765) [-1142.509] (-1142.509) (-1145.125) -- 0:00:19
703000 -- (-1143.308) [-1142.038] (-1145.458) (-1146.729) * (-1148.893) [-1142.562] (-1142.460) (-1144.301) -- 0:00:19
703500 -- (-1143.362) [-1145.919] (-1142.300) (-1141.843) * (-1143.339) [-1143.808] (-1145.235) (-1142.425) -- 0:00:18
704000 -- [-1143.302] (-1145.568) (-1143.320) (-1142.936) * (-1143.951) (-1149.282) [-1143.384] (-1144.841) -- 0:00:18
704500 -- (-1143.016) (-1144.133) (-1142.862) [-1143.415] * (-1145.766) (-1142.944) [-1142.444] (-1146.626) -- 0:00:18
705000 -- (-1142.736) [-1141.584] (-1145.218) (-1143.506) * [-1146.769] (-1141.385) (-1141.670) (-1146.385) -- 0:00:19
Average standard deviation of split frequencies: 0.008248
705500 -- (-1147.973) (-1144.592) (-1143.756) [-1143.005] * (-1144.125) (-1141.685) (-1141.830) [-1141.854] -- 0:00:19
706000 -- [-1145.643] (-1142.634) (-1142.642) (-1143.435) * (-1143.888) (-1141.584) [-1141.547] (-1145.294) -- 0:00:19
706500 -- (-1142.349) (-1143.980) [-1142.847] (-1141.988) * (-1145.529) (-1142.979) (-1143.780) [-1143.087] -- 0:00:19
707000 -- (-1142.938) (-1145.929) (-1141.367) [-1141.979] * (-1143.053) (-1141.540) (-1143.153) [-1141.561] -- 0:00:19
707500 -- (-1142.365) (-1147.915) [-1143.341] (-1142.223) * (-1143.455) [-1144.341] (-1146.582) (-1144.213) -- 0:00:19
708000 -- [-1142.177] (-1146.281) (-1143.434) (-1143.016) * (-1144.675) (-1142.370) [-1142.083] (-1144.127) -- 0:00:18
708500 -- [-1143.341] (-1143.113) (-1143.540) (-1142.283) * (-1147.657) [-1142.949] (-1144.010) (-1141.612) -- 0:00:18
709000 -- (-1141.575) (-1141.392) (-1144.167) [-1142.495] * [-1142.123] (-1142.204) (-1144.205) (-1141.423) -- 0:00:18
709500 -- (-1141.563) (-1141.331) [-1141.889] (-1142.328) * [-1142.164] (-1142.449) (-1141.369) (-1142.638) -- 0:00:18
710000 -- (-1141.308) (-1142.747) (-1143.097) [-1144.327] * (-1142.555) (-1143.188) (-1144.706) [-1146.372] -- 0:00:18
Average standard deviation of split frequencies: 0.008623
710500 -- [-1143.165] (-1144.345) (-1146.411) (-1147.026) * (-1145.837) [-1141.785] (-1143.137) (-1146.869) -- 0:00:18
711000 -- (-1145.281) (-1145.211) (-1143.141) [-1145.749] * (-1142.467) [-1141.872] (-1142.643) (-1145.109) -- 0:00:18
711500 -- [-1147.022] (-1143.491) (-1144.811) (-1148.211) * (-1145.724) [-1142.093] (-1146.272) (-1141.796) -- 0:00:18
712000 -- [-1143.836] (-1144.542) (-1143.681) (-1146.033) * (-1144.990) (-1143.400) [-1141.485] (-1144.161) -- 0:00:18
712500 -- [-1142.023] (-1144.147) (-1143.317) (-1142.851) * (-1144.310) (-1141.870) (-1143.618) [-1141.873] -- 0:00:18
713000 -- (-1143.986) (-1142.926) [-1143.345] (-1142.450) * (-1143.899) (-1141.405) [-1141.344] (-1144.498) -- 0:00:18
713500 -- (-1143.193) (-1145.118) (-1144.453) [-1141.911] * (-1143.776) (-1142.190) (-1142.159) [-1142.525] -- 0:00:18
714000 -- (-1142.325) [-1144.893] (-1143.195) (-1141.942) * (-1143.816) [-1142.026] (-1142.428) (-1147.366) -- 0:00:18
714500 -- (-1145.343) (-1147.060) (-1142.186) [-1141.764] * (-1143.690) (-1142.980) (-1142.367) [-1143.952] -- 0:00:18
715000 -- [-1141.227] (-1145.029) (-1142.144) (-1143.151) * (-1142.389) (-1144.027) (-1141.361) [-1145.084] -- 0:00:18
Average standard deviation of split frequencies: 0.008946
715500 -- (-1144.816) (-1143.119) [-1142.517] (-1142.716) * (-1142.642) [-1141.997] (-1141.950) (-1142.219) -- 0:00:18
716000 -- (-1145.722) (-1145.192) (-1142.272) [-1141.772] * (-1143.295) (-1145.267) [-1142.750] (-1143.088) -- 0:00:18
716500 -- [-1146.650] (-1142.928) (-1142.446) (-1143.364) * (-1145.710) (-1145.075) [-1143.615] (-1145.132) -- 0:00:18
717000 -- (-1145.838) (-1142.838) [-1143.797] (-1144.945) * (-1145.786) [-1142.764] (-1144.197) (-1144.394) -- 0:00:18
717500 -- (-1147.161) (-1143.985) [-1142.136] (-1142.635) * (-1146.378) (-1145.208) (-1143.324) [-1141.718] -- 0:00:18
718000 -- (-1144.030) (-1144.945) (-1142.835) [-1145.834] * (-1147.097) (-1141.533) (-1145.005) [-1142.076] -- 0:00:18
718500 -- (-1143.331) (-1144.860) [-1144.988] (-1146.670) * (-1149.711) (-1143.483) [-1143.957] (-1145.397) -- 0:00:18
719000 -- (-1144.011) (-1142.480) [-1144.754] (-1144.870) * (-1145.694) [-1142.099] (-1141.001) (-1142.752) -- 0:00:17
719500 -- [-1142.870] (-1142.344) (-1145.907) (-1145.158) * (-1143.894) (-1147.198) (-1142.720) [-1143.241] -- 0:00:17
720000 -- (-1142.717) (-1142.750) (-1142.750) [-1145.487] * (-1142.871) [-1141.664] (-1142.791) (-1144.082) -- 0:00:17
Average standard deviation of split frequencies: 0.007675
720500 -- (-1142.632) (-1143.138) [-1143.439] (-1142.580) * (-1142.391) (-1146.336) (-1142.324) [-1145.196] -- 0:00:17
721000 -- (-1145.195) (-1146.348) [-1146.589] (-1144.063) * [-1141.731] (-1141.677) (-1144.620) (-1144.811) -- 0:00:18
721500 -- (-1144.143) (-1143.796) [-1144.647] (-1141.094) * (-1142.355) (-1143.779) (-1143.363) [-1142.355] -- 0:00:18
722000 -- [-1141.304] (-1142.342) (-1141.432) (-1140.941) * (-1142.080) (-1145.989) (-1142.834) [-1143.605] -- 0:00:18
722500 -- (-1147.268) (-1141.570) [-1144.693] (-1144.708) * (-1143.360) (-1143.296) [-1145.551] (-1148.913) -- 0:00:18
723000 -- (-1147.967) (-1145.570) [-1143.636] (-1144.532) * [-1142.851] (-1146.486) (-1143.397) (-1153.430) -- 0:00:18
723500 -- (-1144.855) [-1143.184] (-1144.798) (-1143.458) * (-1141.625) (-1142.755) (-1142.731) [-1145.047] -- 0:00:17
724000 -- (-1143.540) (-1144.718) (-1141.672) [-1142.782] * (-1144.738) [-1144.200] (-1145.542) (-1143.198) -- 0:00:17
724500 -- (-1143.270) (-1143.570) [-1145.430] (-1142.974) * (-1144.062) (-1143.863) (-1144.098) [-1142.999] -- 0:00:17
725000 -- (-1141.336) (-1143.198) (-1145.261) [-1142.048] * (-1143.312) (-1143.399) [-1142.868] (-1141.388) -- 0:00:17
Average standard deviation of split frequencies: 0.008747
725500 -- (-1148.539) (-1141.938) (-1141.462) [-1142.811] * [-1142.913] (-1142.128) (-1145.849) (-1143.182) -- 0:00:17
726000 -- [-1144.091] (-1141.949) (-1143.737) (-1142.986) * (-1142.104) (-1144.569) [-1142.628] (-1142.648) -- 0:00:17
726500 -- (-1142.549) (-1144.512) (-1145.041) [-1145.409] * (-1143.147) [-1143.195] (-1142.513) (-1144.296) -- 0:00:17
727000 -- [-1142.052] (-1146.093) (-1142.606) (-1146.376) * (-1143.965) [-1143.450] (-1142.624) (-1147.137) -- 0:00:17
727500 -- (-1142.967) (-1142.052) [-1142.751] (-1142.776) * (-1143.957) [-1142.644] (-1143.183) (-1142.810) -- 0:00:17
728000 -- (-1141.458) (-1143.711) (-1143.842) [-1145.711] * [-1145.716] (-1143.391) (-1143.792) (-1141.900) -- 0:00:17
728500 -- [-1142.602] (-1143.443) (-1142.928) (-1143.458) * [-1145.905] (-1143.476) (-1141.227) (-1145.470) -- 0:00:17
729000 -- (-1143.236) (-1148.823) [-1143.450] (-1144.017) * [-1145.303] (-1141.457) (-1145.204) (-1142.849) -- 0:00:17
729500 -- (-1142.480) (-1148.583) [-1144.491] (-1146.328) * (-1142.132) (-1142.218) [-1142.960] (-1141.736) -- 0:00:17
730000 -- (-1146.586) [-1142.544] (-1147.314) (-1149.137) * (-1142.133) (-1145.533) [-1146.034] (-1143.097) -- 0:00:17
Average standard deviation of split frequencies: 0.009032
730500 -- (-1141.486) (-1147.812) (-1143.749) [-1145.852] * (-1145.542) (-1142.777) (-1145.371) [-1148.995] -- 0:00:17
731000 -- [-1141.486] (-1145.765) (-1143.268) (-1142.313) * [-1142.152] (-1143.238) (-1142.988) (-1141.721) -- 0:00:17
731500 -- [-1142.351] (-1144.266) (-1143.234) (-1143.274) * (-1141.495) (-1144.657) (-1142.881) [-1143.084] -- 0:00:17
732000 -- (-1143.783) (-1146.259) (-1143.935) [-1142.106] * [-1143.693] (-1143.284) (-1143.855) (-1142.946) -- 0:00:17
732500 -- (-1141.429) (-1143.819) [-1143.416] (-1146.616) * (-1142.261) (-1145.609) (-1146.282) [-1142.158] -- 0:00:17
733000 -- (-1143.648) (-1144.609) [-1143.044] (-1141.805) * (-1143.957) (-1146.627) (-1144.239) [-1142.767] -- 0:00:17
733500 -- (-1147.062) (-1143.663) (-1143.158) [-1144.720] * (-1143.639) [-1147.079] (-1144.472) (-1142.779) -- 0:00:17
734000 -- (-1144.081) (-1147.023) [-1142.678] (-1141.707) * (-1142.911) (-1149.676) (-1142.720) [-1145.227] -- 0:00:17
734500 -- (-1143.631) [-1143.291] (-1142.433) (-1142.124) * (-1143.669) (-1148.625) [-1142.351] (-1143.082) -- 0:00:16
735000 -- [-1145.767] (-1142.835) (-1141.677) (-1141.936) * (-1142.901) [-1145.971] (-1146.591) (-1144.432) -- 0:00:16
Average standard deviation of split frequencies: 0.008807
735500 -- (-1143.192) (-1143.876) [-1142.118] (-1144.077) * (-1145.267) [-1142.919] (-1145.769) (-1143.455) -- 0:00:16
736000 -- (-1142.711) (-1144.350) [-1141.913] (-1141.289) * (-1142.665) (-1143.937) [-1144.498] (-1146.390) -- 0:00:16
736500 -- (-1141.883) (-1144.408) (-1145.115) [-1141.287] * (-1144.000) [-1142.269] (-1141.753) (-1143.567) -- 0:00:16
737000 -- (-1142.653) (-1142.235) (-1145.088) [-1142.629] * (-1143.164) [-1144.590] (-1142.368) (-1143.460) -- 0:00:17
737500 -- [-1142.557] (-1142.305) (-1143.129) (-1147.270) * (-1142.596) (-1149.472) (-1143.227) [-1143.425] -- 0:00:17
738000 -- (-1144.782) [-1142.042] (-1144.954) (-1146.276) * (-1142.612) [-1145.853] (-1141.642) (-1143.840) -- 0:00:17
738500 -- [-1145.396] (-1141.264) (-1143.583) (-1147.968) * (-1142.019) (-1143.786) [-1144.148] (-1142.696) -- 0:00:16
739000 -- (-1142.625) (-1146.101) [-1141.784] (-1143.185) * (-1142.126) [-1143.863] (-1149.303) (-1146.801) -- 0:00:16
739500 -- [-1145.328] (-1145.260) (-1141.784) (-1143.334) * [-1142.006] (-1143.079) (-1147.148) (-1144.590) -- 0:00:16
740000 -- [-1142.556] (-1141.654) (-1143.237) (-1144.172) * (-1143.865) (-1141.757) (-1144.269) [-1142.600] -- 0:00:16
Average standard deviation of split frequencies: 0.008791
740500 -- (-1146.354) (-1147.895) [-1141.541] (-1146.833) * (-1142.243) [-1142.497] (-1143.249) (-1142.063) -- 0:00:16
741000 -- (-1143.885) (-1150.614) (-1141.438) [-1141.700] * (-1142.341) (-1146.445) (-1144.322) [-1140.948] -- 0:00:16
741500 -- (-1144.558) (-1147.068) (-1141.664) [-1144.345] * (-1143.105) [-1143.105] (-1141.503) (-1141.775) -- 0:00:16
742000 -- (-1145.005) [-1143.102] (-1143.271) (-1143.311) * (-1143.685) (-1142.837) [-1142.743] (-1143.448) -- 0:00:16
742500 -- (-1144.744) [-1141.630] (-1141.912) (-1143.152) * (-1141.519) [-1143.961] (-1142.924) (-1144.200) -- 0:00:16
743000 -- (-1143.645) (-1141.627) (-1141.941) [-1142.601] * [-1143.978] (-1143.976) (-1144.312) (-1143.622) -- 0:00:16
743500 -- (-1144.605) (-1143.658) [-1141.732] (-1142.433) * (-1149.442) (-1144.785) [-1143.332] (-1143.037) -- 0:00:16
744000 -- (-1142.607) [-1142.338] (-1143.415) (-1143.285) * [-1143.088] (-1145.538) (-1142.437) (-1145.112) -- 0:00:16
744500 -- [-1143.312] (-1142.018) (-1143.191) (-1145.920) * [-1143.193] (-1145.209) (-1144.518) (-1146.296) -- 0:00:16
745000 -- (-1143.450) (-1142.611) (-1142.708) [-1143.323] * (-1143.530) [-1143.382] (-1144.145) (-1142.930) -- 0:00:16
Average standard deviation of split frequencies: 0.009776
745500 -- (-1142.764) (-1143.611) [-1144.023] (-1144.791) * (-1143.455) (-1141.813) (-1143.666) [-1142.772] -- 0:00:16
746000 -- [-1141.767] (-1142.680) (-1145.305) (-1143.781) * (-1143.895) (-1143.120) [-1142.996] (-1145.397) -- 0:00:16
746500 -- [-1141.386] (-1142.255) (-1151.394) (-1143.404) * (-1142.402) (-1143.986) [-1148.820] (-1144.648) -- 0:00:16
747000 -- (-1141.469) [-1142.730] (-1148.454) (-1142.237) * [-1142.863] (-1142.979) (-1147.774) (-1142.884) -- 0:00:16
747500 -- [-1144.403] (-1145.375) (-1142.977) (-1143.661) * (-1144.656) (-1143.600) (-1141.947) [-1143.465] -- 0:00:16
748000 -- (-1141.516) [-1144.297] (-1143.535) (-1142.734) * (-1145.151) [-1147.310] (-1141.865) (-1143.895) -- 0:00:16
748500 -- (-1143.478) [-1144.325] (-1146.022) (-1142.090) * [-1146.303] (-1152.468) (-1143.599) (-1144.530) -- 0:00:16
749000 -- [-1141.462] (-1144.607) (-1145.259) (-1141.942) * (-1143.416) (-1144.189) [-1145.456] (-1144.397) -- 0:00:16
749500 -- (-1143.030) [-1145.039] (-1143.308) (-1142.292) * (-1145.400) [-1143.013] (-1142.719) (-1143.365) -- 0:00:16
750000 -- (-1144.998) [-1144.834] (-1147.074) (-1141.505) * (-1144.806) (-1144.633) (-1148.026) [-1142.309] -- 0:00:16
Average standard deviation of split frequencies: 0.008988
750500 -- [-1141.373] (-1141.681) (-1146.405) (-1146.121) * [-1146.889] (-1143.620) (-1143.480) (-1145.992) -- 0:00:15
751000 -- (-1143.278) [-1143.507] (-1143.515) (-1143.015) * (-1142.438) (-1142.520) (-1143.321) [-1147.462] -- 0:00:15
751500 -- [-1143.219] (-1145.200) (-1142.297) (-1143.684) * (-1142.493) [-1143.024] (-1145.236) (-1146.067) -- 0:00:15
752000 -- (-1141.435) (-1144.210) [-1142.435] (-1141.821) * (-1143.219) (-1142.312) (-1142.504) [-1143.027] -- 0:00:15
752500 -- (-1141.750) (-1141.957) [-1142.633] (-1144.975) * (-1145.347) (-1143.887) [-1144.676] (-1143.103) -- 0:00:15
753000 -- (-1142.690) (-1142.438) [-1144.405] (-1145.367) * [-1141.915] (-1145.317) (-1142.334) (-1142.410) -- 0:00:16
753500 -- (-1142.546) [-1142.600] (-1143.172) (-1144.164) * (-1143.787) (-1144.441) [-1144.438] (-1143.286) -- 0:00:16
754000 -- [-1146.490] (-1142.611) (-1142.352) (-1143.009) * [-1141.704] (-1145.293) (-1143.278) (-1147.346) -- 0:00:15
754500 -- [-1145.357] (-1148.501) (-1142.273) (-1145.583) * (-1142.288) (-1147.846) (-1144.605) [-1143.119] -- 0:00:15
755000 -- (-1144.699) (-1144.516) [-1142.376] (-1148.152) * (-1143.409) [-1143.259] (-1143.385) (-1145.919) -- 0:00:15
Average standard deviation of split frequencies: 0.008847
755500 -- (-1146.484) (-1146.720) (-1143.177) [-1143.063] * [-1142.169] (-1141.787) (-1144.558) (-1143.566) -- 0:00:15
756000 -- (-1144.098) (-1143.766) [-1144.333] (-1143.097) * [-1142.920] (-1142.673) (-1141.828) (-1143.961) -- 0:00:15
756500 -- (-1142.653) [-1143.803] (-1141.884) (-1143.297) * (-1142.578) (-1144.498) [-1142.394] (-1146.360) -- 0:00:15
757000 -- (-1146.082) [-1144.925] (-1142.772) (-1141.822) * (-1143.548) (-1146.173) [-1148.156] (-1147.855) -- 0:00:15
757500 -- (-1144.025) [-1141.534] (-1141.809) (-1142.468) * (-1145.782) (-1146.030) [-1145.758] (-1145.517) -- 0:00:15
758000 -- [-1144.152] (-1143.962) (-1142.613) (-1141.785) * (-1151.105) (-1142.827) [-1141.967] (-1145.938) -- 0:00:15
758500 -- (-1141.791) [-1142.867] (-1142.333) (-1143.689) * (-1145.002) (-1142.755) (-1143.916) [-1143.531] -- 0:00:15
759000 -- (-1142.888) (-1144.759) (-1144.506) [-1142.485] * (-1142.260) (-1142.506) (-1144.623) [-1144.348] -- 0:00:15
759500 -- (-1142.215) (-1147.989) (-1145.499) [-1142.587] * (-1142.128) (-1141.658) (-1142.511) [-1141.139] -- 0:00:15
760000 -- (-1142.041) [-1141.425] (-1146.270) (-1143.953) * (-1142.221) (-1141.589) (-1146.885) [-1141.631] -- 0:00:15
Average standard deviation of split frequencies: 0.008968
760500 -- (-1144.947) [-1146.301] (-1144.396) (-1141.983) * [-1145.452] (-1142.797) (-1144.220) (-1143.062) -- 0:00:15
761000 -- (-1145.326) [-1142.899] (-1146.439) (-1142.765) * (-1146.492) [-1142.967] (-1142.427) (-1142.246) -- 0:00:15
761500 -- (-1145.891) [-1143.318] (-1142.509) (-1142.261) * (-1142.920) (-1144.887) (-1144.209) [-1142.319] -- 0:00:15
762000 -- [-1143.786] (-1142.378) (-1142.663) (-1142.105) * [-1145.525] (-1144.959) (-1145.342) (-1145.038) -- 0:00:15
762500 -- (-1146.765) [-1142.858] (-1144.633) (-1146.027) * (-1143.434) (-1144.402) (-1141.675) [-1143.808] -- 0:00:15
763000 -- [-1146.090] (-1142.651) (-1145.614) (-1144.627) * (-1142.780) (-1143.597) [-1142.113] (-1144.231) -- 0:00:15
763500 -- (-1147.435) (-1143.420) (-1143.074) [-1143.094] * (-1146.296) (-1146.401) (-1143.489) [-1143.094] -- 0:00:15
764000 -- (-1146.470) (-1143.708) (-1142.639) [-1142.654] * (-1143.306) (-1143.346) [-1144.276] (-1142.278) -- 0:00:15
764500 -- (-1147.855) (-1143.030) (-1144.551) [-1143.593] * (-1144.806) (-1143.000) (-1142.391) [-1142.423] -- 0:00:15
765000 -- (-1145.646) (-1149.558) (-1148.159) [-1144.628] * (-1142.932) (-1144.176) [-1143.847] (-1144.945) -- 0:00:15
Average standard deviation of split frequencies: 0.009050
765500 -- [-1146.212] (-1143.164) (-1142.962) (-1143.609) * (-1142.726) (-1147.599) (-1144.170) [-1145.298] -- 0:00:15
766000 -- (-1146.323) (-1141.409) [-1145.307] (-1142.300) * (-1146.535) [-1146.412] (-1146.527) (-1142.771) -- 0:00:14
766500 -- [-1144.920] (-1143.969) (-1144.524) (-1141.877) * (-1144.887) (-1145.062) [-1145.218] (-1143.839) -- 0:00:14
767000 -- (-1142.697) [-1142.460] (-1142.683) (-1143.752) * (-1146.374) (-1144.319) (-1142.884) [-1141.591] -- 0:00:14
767500 -- (-1145.411) (-1142.251) (-1143.573) [-1142.433] * [-1145.271] (-1143.715) (-1151.361) (-1141.891) -- 0:00:14
768000 -- [-1144.360] (-1147.627) (-1142.686) (-1143.654) * [-1145.455] (-1144.249) (-1148.751) (-1142.265) -- 0:00:14
768500 -- [-1144.950] (-1144.241) (-1143.176) (-1143.674) * (-1142.414) (-1142.779) (-1145.097) [-1144.119] -- 0:00:14
769000 -- (-1142.797) (-1146.279) [-1145.713] (-1143.346) * (-1144.035) (-1143.361) (-1149.150) [-1141.702] -- 0:00:15
769500 -- [-1142.921] (-1147.615) (-1142.109) (-1143.287) * (-1143.479) (-1143.450) (-1147.179) [-1141.410] -- 0:00:14
770000 -- (-1142.777) (-1145.511) [-1141.710] (-1142.919) * (-1147.211) (-1145.168) [-1142.296] (-1141.782) -- 0:00:14
Average standard deviation of split frequencies: 0.009103
770500 -- [-1141.724] (-1142.665) (-1143.564) (-1145.528) * (-1144.511) (-1142.470) (-1142.698) [-1144.336] -- 0:00:14
771000 -- (-1141.653) [-1144.219] (-1145.519) (-1145.217) * (-1143.731) (-1144.828) (-1146.378) [-1143.642] -- 0:00:14
771500 -- (-1141.475) (-1145.842) [-1143.004] (-1145.879) * (-1143.870) [-1143.921] (-1145.501) (-1142.024) -- 0:00:14
772000 -- (-1142.366) [-1141.963] (-1147.897) (-1142.501) * (-1147.984) (-1141.226) (-1145.060) [-1148.860] -- 0:00:14
772500 -- (-1142.912) (-1142.518) (-1143.134) [-1144.780] * (-1145.771) (-1141.371) [-1143.321] (-1144.124) -- 0:00:14
773000 -- [-1143.382] (-1141.184) (-1142.876) (-1145.046) * (-1148.066) (-1142.079) [-1143.375] (-1144.331) -- 0:00:14
773500 -- [-1143.723] (-1142.341) (-1141.910) (-1141.640) * (-1142.482) (-1142.697) [-1144.603] (-1142.092) -- 0:00:14
774000 -- (-1145.367) [-1142.822] (-1143.234) (-1143.011) * (-1142.927) (-1142.934) (-1142.323) [-1142.317] -- 0:00:14
774500 -- (-1144.455) [-1141.463] (-1143.346) (-1147.378) * (-1141.522) [-1141.351] (-1143.154) (-1143.901) -- 0:00:14
775000 -- (-1141.583) [-1141.353] (-1145.321) (-1141.950) * (-1143.262) [-1144.773] (-1142.700) (-1143.646) -- 0:00:14
Average standard deviation of split frequencies: 0.008733
775500 -- (-1142.210) (-1141.466) (-1148.559) [-1141.968] * [-1141.580] (-1144.085) (-1142.354) (-1142.173) -- 0:00:14
776000 -- (-1143.314) (-1142.112) (-1142.499) [-1143.015] * (-1141.357) (-1145.198) (-1142.289) [-1144.280] -- 0:00:14
776500 -- (-1142.966) (-1145.531) (-1143.323) [-1143.494] * (-1143.320) [-1143.914] (-1143.141) (-1144.994) -- 0:00:14
777000 -- (-1143.060) (-1142.161) [-1144.374] (-1143.668) * (-1142.627) (-1142.587) (-1144.730) [-1143.015] -- 0:00:14
777500 -- [-1144.309] (-1143.246) (-1144.585) (-1141.660) * (-1144.460) [-1141.397] (-1143.091) (-1143.305) -- 0:00:14
778000 -- (-1141.509) (-1143.757) (-1142.955) [-1142.724] * (-1144.263) [-1145.746] (-1145.303) (-1143.625) -- 0:00:14
778500 -- [-1142.181] (-1144.633) (-1142.257) (-1141.973) * [-1142.730] (-1142.443) (-1141.798) (-1143.400) -- 0:00:14
779000 -- [-1143.799] (-1143.669) (-1145.465) (-1144.031) * (-1145.155) (-1142.777) [-1141.193] (-1144.987) -- 0:00:14
779500 -- (-1146.227) (-1146.046) [-1141.552] (-1141.498) * (-1143.511) [-1143.966] (-1143.770) (-1143.422) -- 0:00:14
780000 -- (-1144.831) (-1142.837) [-1145.620] (-1143.117) * (-1141.730) (-1143.979) [-1143.298] (-1141.605) -- 0:00:14
Average standard deviation of split frequencies: 0.008051
780500 -- (-1145.192) (-1147.060) [-1143.282] (-1141.431) * [-1145.840] (-1145.167) (-1144.096) (-1145.250) -- 0:00:14
781000 -- [-1143.413] (-1148.862) (-1145.269) (-1142.335) * (-1144.751) (-1142.783) (-1142.697) [-1142.947] -- 0:00:14
781500 -- (-1144.283) (-1148.748) [-1144.680] (-1142.991) * (-1146.744) (-1142.784) [-1142.771] (-1141.506) -- 0:00:13
782000 -- (-1142.200) (-1146.791) (-1142.442) [-1142.472] * (-1145.617) (-1148.459) [-1141.751] (-1142.330) -- 0:00:13
782500 -- (-1145.977) (-1142.827) [-1144.451] (-1141.922) * (-1142.560) (-1150.464) (-1142.218) [-1141.805] -- 0:00:13
783000 -- [-1143.173] (-1142.469) (-1145.231) (-1143.234) * [-1141.524] (-1147.180) (-1145.047) (-1146.615) -- 0:00:13
783500 -- (-1141.323) (-1142.374) (-1146.066) [-1142.681] * (-1144.771) [-1140.970] (-1143.029) (-1145.035) -- 0:00:13
784000 -- (-1142.218) [-1142.614] (-1144.711) (-1143.403) * [-1142.835] (-1143.034) (-1142.561) (-1144.915) -- 0:00:13
784500 -- [-1142.150] (-1142.722) (-1144.253) (-1144.150) * (-1142.194) [-1146.358] (-1142.605) (-1142.516) -- 0:00:14
785000 -- (-1141.307) (-1150.812) [-1141.485] (-1143.040) * [-1142.756] (-1150.633) (-1145.321) (-1142.938) -- 0:00:13
Average standard deviation of split frequencies: 0.008509
785500 -- [-1143.239] (-1142.828) (-1146.645) (-1143.673) * (-1142.837) (-1150.916) (-1142.319) [-1141.118] -- 0:00:13
786000 -- (-1142.572) (-1147.142) (-1142.981) [-1144.771] * (-1143.306) (-1146.712) (-1142.168) [-1142.765] -- 0:00:13
786500 -- (-1151.478) (-1142.349) (-1142.367) [-1144.163] * (-1142.329) (-1142.491) [-1141.911] (-1144.077) -- 0:00:13
787000 -- [-1147.824] (-1142.830) (-1142.536) (-1144.576) * (-1144.301) (-1142.914) (-1143.545) [-1141.543] -- 0:00:13
787500 -- (-1144.035) (-1143.205) (-1143.526) [-1141.755] * (-1147.985) [-1143.353] (-1143.745) (-1141.434) -- 0:00:13
788000 -- (-1145.917) (-1144.255) [-1142.161] (-1142.109) * (-1145.386) (-1149.727) (-1143.627) [-1144.009] -- 0:00:13
788500 -- (-1142.686) [-1145.258] (-1143.819) (-1142.156) * (-1147.120) [-1143.842] (-1142.530) (-1145.270) -- 0:00:13
789000 -- (-1142.864) [-1142.752] (-1146.944) (-1141.671) * (-1143.448) [-1141.530] (-1142.876) (-1142.001) -- 0:00:13
789500 -- (-1147.377) [-1143.236] (-1146.989) (-1142.330) * (-1144.318) (-1145.436) (-1142.285) [-1141.376] -- 0:00:13
790000 -- [-1141.801] (-1142.837) (-1145.023) (-1143.698) * (-1143.465) (-1143.718) [-1143.855] (-1142.589) -- 0:00:13
Average standard deviation of split frequencies: 0.007592
790500 -- (-1142.077) (-1142.904) (-1142.757) [-1142.689] * [-1143.994] (-1141.609) (-1146.559) (-1142.962) -- 0:00:13
791000 -- (-1145.210) [-1142.305] (-1142.394) (-1143.958) * (-1144.456) (-1143.859) [-1141.383] (-1143.353) -- 0:00:13
791500 -- [-1144.023] (-1143.752) (-1142.574) (-1141.407) * (-1146.330) (-1142.419) [-1141.785] (-1145.554) -- 0:00:13
792000 -- (-1146.073) (-1143.146) [-1143.701] (-1142.054) * (-1144.002) (-1142.195) (-1141.269) [-1143.196] -- 0:00:13
792500 -- (-1141.381) (-1141.918) [-1142.065] (-1142.307) * (-1142.626) (-1141.591) [-1141.445] (-1143.553) -- 0:00:13
793000 -- (-1141.999) (-1143.595) (-1146.693) [-1142.940] * [-1141.373] (-1145.095) (-1141.581) (-1148.744) -- 0:00:13
793500 -- (-1141.775) (-1144.327) [-1143.115] (-1145.262) * [-1142.067] (-1143.490) (-1142.040) (-1141.765) -- 0:00:13
794000 -- (-1142.525) (-1145.391) (-1142.250) [-1142.110] * (-1143.621) [-1145.139] (-1141.745) (-1142.525) -- 0:00:13
794500 -- [-1144.312] (-1145.595) (-1142.990) (-1143.575) * (-1143.480) [-1141.125] (-1142.033) (-1142.943) -- 0:00:13
795000 -- [-1141.539] (-1142.955) (-1143.695) (-1142.887) * (-1144.308) [-1143.659] (-1143.335) (-1145.026) -- 0:00:13
Average standard deviation of split frequencies: 0.007738
795500 -- (-1146.752) (-1142.622) [-1143.952] (-1142.899) * [-1144.744] (-1142.366) (-1144.656) (-1144.497) -- 0:00:13
796000 -- (-1145.167) (-1141.993) [-1147.076] (-1143.277) * (-1148.032) [-1145.756] (-1144.877) (-1142.559) -- 0:00:13
796500 -- (-1142.136) [-1141.508] (-1145.069) (-1144.118) * (-1144.583) [-1142.938] (-1143.921) (-1145.137) -- 0:00:13
797000 -- [-1142.758] (-1143.640) (-1145.442) (-1144.377) * (-1145.418) (-1145.121) (-1143.406) [-1142.420] -- 0:00:12
797500 -- [-1141.101] (-1142.724) (-1148.156) (-1143.036) * [-1144.272] (-1143.737) (-1143.881) (-1143.532) -- 0:00:12
798000 -- (-1141.545) (-1143.397) (-1143.118) [-1143.606] * (-1142.785) (-1145.985) [-1144.108] (-1143.952) -- 0:00:12
798500 -- (-1149.460) [-1141.690] (-1142.105) (-1142.373) * [-1142.006] (-1146.276) (-1148.791) (-1146.059) -- 0:00:12
799000 -- (-1146.042) (-1141.512) (-1143.173) [-1141.820] * (-1142.613) (-1143.673) (-1147.955) [-1143.494] -- 0:00:12
799500 -- (-1145.194) (-1148.233) [-1141.568] (-1146.787) * [-1143.657] (-1148.301) (-1148.048) (-1142.651) -- 0:00:12
800000 -- (-1145.964) (-1143.638) (-1144.636) [-1143.554] * (-1146.383) [-1143.930] (-1148.094) (-1145.922) -- 0:00:12
Average standard deviation of split frequencies: 0.008096
800500 -- (-1142.537) [-1142.966] (-1144.043) (-1143.751) * (-1142.959) [-1144.670] (-1144.787) (-1143.614) -- 0:00:12
801000 -- [-1142.015] (-1141.564) (-1142.695) (-1144.937) * (-1142.558) (-1144.246) (-1142.693) [-1142.124] -- 0:00:12
801500 -- (-1142.080) (-1143.519) [-1142.511] (-1143.524) * (-1143.277) (-1143.928) [-1143.457] (-1141.789) -- 0:00:12
802000 -- [-1143.473] (-1142.341) (-1142.790) (-1143.218) * [-1141.742] (-1146.028) (-1147.087) (-1144.979) -- 0:00:12
802500 -- (-1142.397) (-1143.087) (-1142.977) [-1146.826] * (-1141.405) [-1143.685] (-1148.580) (-1147.475) -- 0:00:12
803000 -- (-1144.130) (-1143.905) (-1143.547) [-1143.880] * (-1141.477) (-1143.783) (-1142.762) [-1143.962] -- 0:00:12
803500 -- (-1143.816) [-1141.691] (-1141.808) (-1141.928) * (-1147.924) [-1142.583] (-1145.225) (-1143.074) -- 0:00:12
804000 -- [-1141.348] (-1143.002) (-1143.072) (-1142.335) * (-1145.629) [-1145.785] (-1145.066) (-1142.637) -- 0:00:12
804500 -- (-1143.015) (-1141.432) (-1142.777) [-1143.189] * [-1147.581] (-1144.352) (-1147.454) (-1143.520) -- 0:00:12
805000 -- [-1143.265] (-1141.428) (-1143.354) (-1146.024) * (-1146.895) [-1142.606] (-1144.842) (-1145.389) -- 0:00:12
Average standard deviation of split frequencies: 0.008371
805500 -- (-1143.663) [-1146.821] (-1142.641) (-1142.881) * (-1144.593) (-1144.879) [-1143.165] (-1144.974) -- 0:00:12
806000 -- (-1141.606) (-1145.561) (-1145.642) [-1142.219] * (-1145.517) (-1146.831) (-1143.443) [-1146.653] -- 0:00:12
806500 -- (-1142.152) (-1146.521) (-1141.634) [-1142.841] * (-1142.524) (-1143.795) (-1141.717) [-1142.863] -- 0:00:12
807000 -- (-1143.494) (-1142.836) [-1143.753] (-1142.583) * (-1147.277) [-1146.404] (-1145.569) (-1143.582) -- 0:00:12
807500 -- (-1143.467) [-1141.986] (-1146.086) (-1142.724) * (-1146.962) [-1147.348] (-1142.644) (-1143.673) -- 0:00:12
808000 -- (-1146.524) (-1143.315) [-1147.026] (-1144.008) * [-1142.872] (-1144.452) (-1142.563) (-1143.640) -- 0:00:12
808500 -- [-1144.348] (-1144.269) (-1146.581) (-1141.485) * (-1143.823) (-1141.780) (-1144.845) [-1143.208] -- 0:00:12
809000 -- (-1143.551) (-1141.827) (-1143.519) [-1142.453] * (-1141.670) [-1143.209] (-1144.793) (-1146.233) -- 0:00:12
809500 -- (-1145.352) (-1141.281) (-1143.518) [-1142.542] * (-1145.964) [-1142.504] (-1145.285) (-1144.488) -- 0:00:12
810000 -- [-1142.926] (-1143.336) (-1143.197) (-1142.606) * (-1144.870) [-1146.355] (-1145.243) (-1143.321) -- 0:00:12
Average standard deviation of split frequencies: 0.008063
810500 -- (-1141.299) (-1145.676) (-1143.673) [-1142.448] * (-1146.131) (-1146.246) (-1144.644) [-1143.524] -- 0:00:12
811000 -- (-1141.400) [-1146.840] (-1144.116) (-1143.238) * (-1145.361) [-1144.087] (-1144.159) (-1142.975) -- 0:00:12
811500 -- (-1142.814) (-1144.102) (-1143.334) [-1144.010] * (-1142.305) (-1142.627) [-1143.458] (-1141.748) -- 0:00:12
812000 -- [-1143.017] (-1144.601) (-1144.048) (-1144.901) * (-1145.928) (-1145.389) [-1142.071] (-1141.847) -- 0:00:12
812500 -- (-1141.393) (-1143.664) (-1143.975) [-1143.872] * (-1142.669) (-1143.062) [-1141.646] (-1145.922) -- 0:00:12
813000 -- [-1142.623] (-1141.249) (-1147.179) (-1143.869) * (-1146.256) [-1144.104] (-1141.677) (-1142.812) -- 0:00:11
813500 -- (-1141.459) (-1143.288) (-1142.064) [-1142.705] * (-1142.515) [-1142.901] (-1143.411) (-1142.182) -- 0:00:11
814000 -- (-1143.700) (-1142.434) [-1142.455] (-1142.511) * [-1143.934] (-1145.894) (-1148.280) (-1142.427) -- 0:00:11
814500 -- [-1144.862] (-1144.308) (-1143.184) (-1143.911) * (-1143.937) [-1142.960] (-1142.840) (-1143.593) -- 0:00:11
815000 -- [-1144.411] (-1144.107) (-1141.879) (-1143.806) * (-1143.587) (-1141.655) [-1142.373] (-1141.941) -- 0:00:11
Average standard deviation of split frequencies: 0.008521
815500 -- [-1142.798] (-1142.389) (-1145.457) (-1143.827) * [-1141.354] (-1141.658) (-1144.989) (-1145.159) -- 0:00:11
816000 -- [-1144.734] (-1145.594) (-1142.653) (-1142.761) * (-1144.034) [-1141.630] (-1143.951) (-1141.657) -- 0:00:11
816500 -- (-1144.501) [-1142.735] (-1144.644) (-1143.981) * (-1144.711) [-1141.967] (-1142.455) (-1143.462) -- 0:00:11
817000 -- (-1147.111) (-1145.261) [-1141.725] (-1146.181) * [-1143.818] (-1145.173) (-1146.579) (-1141.990) -- 0:00:11
817500 -- (-1157.611) (-1143.222) [-1143.485] (-1143.254) * [-1143.583] (-1144.032) (-1146.735) (-1142.972) -- 0:00:11
818000 -- [-1144.468] (-1142.941) (-1143.378) (-1142.621) * (-1143.216) (-1144.839) (-1146.031) [-1141.915] -- 0:00:11
818500 -- (-1144.737) (-1141.876) [-1142.267] (-1145.967) * (-1143.424) [-1144.078] (-1147.483) (-1144.306) -- 0:00:11
819000 -- [-1144.935] (-1145.828) (-1142.324) (-1145.023) * (-1142.660) (-1144.678) (-1147.760) [-1144.225] -- 0:00:11
819500 -- [-1144.963] (-1144.387) (-1148.234) (-1145.904) * [-1142.636] (-1146.958) (-1145.508) (-1142.553) -- 0:00:11
820000 -- (-1143.378) (-1142.456) [-1143.353] (-1143.719) * [-1141.801] (-1147.344) (-1145.167) (-1142.916) -- 0:00:11
Average standard deviation of split frequencies: 0.008868
820500 -- [-1142.108] (-1142.820) (-1143.259) (-1141.883) * (-1143.787) (-1149.377) [-1143.367] (-1143.239) -- 0:00:11
821000 -- (-1144.680) (-1143.838) [-1142.002] (-1142.381) * (-1145.343) (-1146.825) [-1145.240] (-1144.763) -- 0:00:11
821500 -- (-1144.732) [-1144.228] (-1146.015) (-1143.995) * (-1146.456) (-1146.695) [-1143.950] (-1143.254) -- 0:00:11
822000 -- (-1144.373) (-1142.976) [-1142.121] (-1143.489) * (-1149.689) (-1145.700) (-1142.483) [-1142.726] -- 0:00:11
822500 -- (-1143.834) (-1144.681) (-1144.310) [-1141.450] * (-1143.874) [-1141.754] (-1141.635) (-1143.636) -- 0:00:11
823000 -- (-1144.861) (-1142.313) [-1143.511] (-1144.137) * (-1142.034) [-1143.663] (-1143.629) (-1142.839) -- 0:00:11
823500 -- (-1143.594) [-1144.186] (-1143.869) (-1142.746) * [-1141.984] (-1142.954) (-1142.379) (-1142.876) -- 0:00:11
824000 -- [-1141.613] (-1145.455) (-1144.088) (-1143.936) * (-1144.760) (-1141.830) (-1142.700) [-1143.015] -- 0:00:11
824500 -- (-1141.164) (-1145.066) (-1145.153) [-1143.544] * [-1141.867] (-1142.548) (-1142.384) (-1142.191) -- 0:00:11
825000 -- (-1141.515) (-1142.310) [-1142.993] (-1142.989) * (-1141.998) [-1144.754] (-1147.409) (-1141.481) -- 0:00:11
Average standard deviation of split frequencies: 0.009433
825500 -- (-1141.727) (-1141.397) (-1143.094) [-1143.036] * (-1145.938) [-1142.595] (-1143.902) (-1142.547) -- 0:00:11
826000 -- (-1143.178) (-1144.922) (-1141.704) [-1146.647] * (-1145.410) [-1143.579] (-1142.101) (-1142.464) -- 0:00:11
826500 -- [-1142.248] (-1144.738) (-1143.259) (-1145.514) * (-1143.588) (-1143.088) [-1142.847] (-1144.528) -- 0:00:11
827000 -- (-1145.042) [-1142.086] (-1144.994) (-1144.658) * [-1143.685] (-1142.498) (-1142.317) (-1145.546) -- 0:00:11
827500 -- (-1142.598) (-1142.224) (-1143.045) [-1143.523] * [-1145.365] (-1142.212) (-1141.770) (-1144.020) -- 0:00:11
828000 -- (-1143.230) (-1141.394) (-1142.126) [-1142.331] * (-1141.731) (-1142.637) (-1142.517) [-1142.785] -- 0:00:11
828500 -- (-1144.268) [-1141.074] (-1144.081) (-1143.741) * (-1142.880) [-1146.537] (-1145.392) (-1143.289) -- 0:00:10
829000 -- (-1143.983) [-1141.877] (-1146.077) (-1144.216) * (-1142.448) (-1147.530) (-1144.738) [-1142.107] -- 0:00:10
829500 -- [-1141.690] (-1149.238) (-1142.070) (-1144.148) * [-1142.365] (-1141.556) (-1149.254) (-1143.509) -- 0:00:10
830000 -- [-1144.204] (-1146.019) (-1148.997) (-1143.430) * (-1141.459) (-1144.710) (-1152.714) [-1143.939] -- 0:00:10
Average standard deviation of split frequencies: 0.008406
830500 -- (-1142.170) (-1142.285) [-1142.849] (-1144.274) * (-1142.956) (-1142.990) (-1142.759) [-1143.600] -- 0:00:10
831000 -- (-1143.893) (-1142.408) (-1141.834) [-1142.911] * [-1145.409] (-1143.829) (-1144.841) (-1143.047) -- 0:00:10
831500 -- (-1143.218) (-1142.793) [-1142.671] (-1145.711) * (-1145.895) (-1145.892) (-1147.980) [-1142.348] -- 0:00:10
832000 -- (-1145.384) (-1142.286) (-1147.095) [-1143.375] * (-1150.861) [-1142.471] (-1145.492) (-1143.574) -- 0:00:10
832500 -- (-1143.800) (-1142.748) (-1149.383) [-1145.926] * (-1142.952) (-1142.041) [-1145.418] (-1145.650) -- 0:00:10
833000 -- [-1143.603] (-1141.967) (-1143.656) (-1143.779) * (-1144.466) [-1143.311] (-1142.012) (-1143.220) -- 0:00:10
833500 -- [-1145.178] (-1141.530) (-1144.560) (-1147.652) * (-1141.922) [-1143.054] (-1141.652) (-1142.740) -- 0:00:10
834000 -- (-1144.589) [-1142.144] (-1142.678) (-1143.797) * (-1141.968) (-1143.150) [-1143.920] (-1143.340) -- 0:00:10
834500 -- [-1144.130] (-1142.920) (-1144.934) (-1143.567) * (-1141.953) (-1143.948) [-1143.486] (-1144.067) -- 0:00:10
835000 -- (-1141.577) [-1143.017] (-1145.153) (-1142.779) * (-1141.926) (-1141.725) [-1145.390] (-1144.844) -- 0:00:10
Average standard deviation of split frequencies: 0.008176
835500 -- (-1142.172) (-1143.013) (-1144.114) [-1142.010] * (-1143.031) (-1142.346) [-1144.246] (-1143.873) -- 0:00:10
836000 -- [-1141.584] (-1144.293) (-1141.933) (-1142.053) * (-1143.618) (-1144.925) [-1142.716] (-1141.756) -- 0:00:10
836500 -- [-1144.409] (-1143.275) (-1144.009) (-1142.441) * [-1141.905] (-1142.894) (-1143.355) (-1145.101) -- 0:00:10
837000 -- (-1143.772) (-1145.348) (-1141.725) [-1141.853] * (-1145.521) (-1146.178) [-1142.194] (-1143.947) -- 0:00:10
837500 -- (-1142.431) (-1144.677) [-1144.333] (-1144.199) * [-1142.904] (-1146.748) (-1144.273) (-1146.729) -- 0:00:10
838000 -- (-1148.851) [-1143.875] (-1142.133) (-1142.063) * [-1143.572] (-1143.546) (-1144.293) (-1151.243) -- 0:00:10
838500 -- (-1145.680) (-1142.280) [-1142.981] (-1144.086) * [-1144.493] (-1144.231) (-1149.375) (-1145.033) -- 0:00:10
839000 -- (-1141.664) [-1144.231] (-1141.765) (-1141.210) * (-1146.034) (-1147.206) (-1142.343) [-1141.871] -- 0:00:10
839500 -- (-1142.597) (-1147.540) [-1142.051] (-1141.309) * (-1147.133) (-1147.203) (-1143.170) [-1141.646] -- 0:00:10
840000 -- [-1142.021] (-1144.120) (-1142.039) (-1143.369) * [-1141.158] (-1142.705) (-1142.160) (-1143.840) -- 0:00:10
Average standard deviation of split frequencies: 0.008446
840500 -- (-1142.181) (-1145.371) [-1141.438] (-1143.791) * (-1143.562) (-1144.602) (-1141.891) [-1146.816] -- 0:00:10
841000 -- [-1142.350] (-1142.898) (-1143.169) (-1143.321) * [-1144.115] (-1143.467) (-1142.959) (-1146.274) -- 0:00:10
841500 -- (-1146.005) (-1142.633) (-1144.134) [-1141.981] * (-1142.094) (-1143.449) [-1142.929] (-1146.744) -- 0:00:10
842000 -- [-1143.611] (-1141.336) (-1144.488) (-1145.155) * (-1145.112) (-1144.073) (-1143.446) [-1143.133] -- 0:00:10
842500 -- [-1141.618] (-1142.745) (-1143.648) (-1143.229) * (-1148.549) (-1141.565) (-1144.728) [-1143.587] -- 0:00:10
843000 -- (-1141.215) (-1142.345) [-1141.749] (-1147.889) * (-1144.546) [-1143.716] (-1144.217) (-1143.673) -- 0:00:10
843500 -- (-1141.948) (-1144.351) (-1141.893) [-1143.138] * (-1142.537) [-1142.185] (-1146.014) (-1143.914) -- 0:00:10
844000 -- [-1142.551] (-1144.196) (-1142.101) (-1148.258) * [-1143.496] (-1144.453) (-1143.657) (-1143.001) -- 0:00:09
844500 -- [-1143.195] (-1144.365) (-1144.053) (-1144.555) * (-1141.436) [-1142.718] (-1143.181) (-1143.522) -- 0:00:09
845000 -- (-1141.702) [-1141.804] (-1143.523) (-1143.165) * (-1142.273) (-1143.556) [-1146.155] (-1141.518) -- 0:00:09
Average standard deviation of split frequencies: 0.008428
845500 -- [-1143.733] (-1144.046) (-1144.660) (-1144.954) * (-1142.475) [-1142.959] (-1144.297) (-1143.936) -- 0:00:09
846000 -- (-1141.330) (-1142.881) (-1143.004) [-1141.825] * (-1144.252) (-1144.107) [-1143.840] (-1146.972) -- 0:00:09
846500 -- [-1141.192] (-1143.427) (-1141.805) (-1145.212) * (-1144.753) (-1142.570) (-1144.159) [-1142.076] -- 0:00:09
847000 -- [-1143.239] (-1144.411) (-1142.136) (-1143.215) * (-1144.655) [-1142.794] (-1144.143) (-1144.675) -- 0:00:09
847500 -- [-1142.307] (-1144.742) (-1142.015) (-1148.019) * (-1144.225) (-1142.535) (-1143.526) [-1144.099] -- 0:00:09
848000 -- (-1144.067) (-1148.578) (-1141.924) [-1151.288] * (-1142.592) (-1142.565) [-1141.402] (-1143.741) -- 0:00:09
848500 -- (-1144.634) (-1143.803) [-1142.107] (-1144.437) * (-1141.534) (-1142.469) [-1143.486] (-1142.252) -- 0:00:09
849000 -- [-1142.346] (-1149.096) (-1143.006) (-1142.119) * (-1142.236) [-1143.157] (-1142.234) (-1142.123) -- 0:00:09
849500 -- (-1142.452) (-1148.839) [-1142.045] (-1146.943) * (-1143.532) (-1142.879) [-1143.128] (-1142.124) -- 0:00:09
850000 -- [-1144.504] (-1147.059) (-1143.671) (-1142.827) * (-1144.212) (-1144.280) (-1142.630) [-1141.854] -- 0:00:09
Average standard deviation of split frequencies: 0.008312
850500 -- (-1146.110) (-1148.358) (-1146.315) [-1142.360] * (-1141.899) [-1142.488] (-1145.004) (-1141.442) -- 0:00:09
851000 -- (-1142.728) [-1146.742] (-1142.819) (-1143.775) * (-1142.087) [-1141.771] (-1145.040) (-1142.121) -- 0:00:09
851500 -- (-1144.959) (-1147.296) (-1142.033) [-1142.715] * (-1142.531) [-1141.636] (-1143.855) (-1145.764) -- 0:00:09
852000 -- (-1144.573) (-1147.428) (-1141.910) [-1142.465] * (-1143.240) [-1143.615] (-1143.190) (-1143.523) -- 0:00:09
852500 -- (-1145.587) (-1141.646) [-1143.234] (-1145.122) * (-1144.261) (-1142.881) [-1142.665] (-1144.586) -- 0:00:09
853000 -- (-1145.434) (-1141.898) [-1145.459] (-1146.009) * (-1141.317) (-1142.543) [-1143.384] (-1141.954) -- 0:00:09
853500 -- (-1142.791) (-1147.252) (-1142.583) [-1143.956] * (-1141.317) (-1142.802) (-1143.342) [-1141.856] -- 0:00:09
854000 -- (-1144.350) (-1145.037) [-1142.154] (-1142.238) * (-1145.444) (-1145.229) [-1141.594] (-1142.706) -- 0:00:09
854500 -- (-1143.035) (-1147.898) (-1141.867) [-1143.882] * (-1142.541) [-1143.022] (-1142.041) (-1143.792) -- 0:00:09
855000 -- (-1146.532) [-1143.303] (-1143.261) (-1144.577) * (-1146.037) (-1143.784) (-1143.699) [-1142.764] -- 0:00:09
Average standard deviation of split frequencies: 0.008088
855500 -- (-1147.261) (-1145.234) (-1143.402) [-1144.202] * (-1144.546) (-1143.240) [-1144.316] (-1143.583) -- 0:00:09
856000 -- (-1146.256) (-1142.993) [-1141.619] (-1143.585) * (-1144.642) (-1143.116) [-1142.805] (-1142.575) -- 0:00:09
856500 -- (-1144.417) [-1142.929] (-1141.933) (-1144.208) * (-1143.669) (-1142.217) (-1142.062) [-1141.605] -- 0:00:09
857000 -- [-1141.882] (-1142.104) (-1143.670) (-1144.103) * (-1141.730) [-1141.848] (-1144.674) (-1141.937) -- 0:00:09
857500 -- (-1142.007) (-1143.715) (-1142.628) [-1145.537] * (-1141.546) (-1142.752) (-1144.216) [-1141.801] -- 0:00:09
858000 -- (-1144.860) (-1144.351) (-1142.515) [-1143.194] * (-1142.069) (-1144.315) [-1141.885] (-1143.871) -- 0:00:09
858500 -- [-1141.784] (-1143.485) (-1143.161) (-1143.040) * (-1144.727) (-1142.341) [-1144.143] (-1144.050) -- 0:00:09
859000 -- [-1148.572] (-1141.814) (-1142.018) (-1141.977) * [-1142.867] (-1141.720) (-1142.242) (-1142.123) -- 0:00:09
859500 -- (-1142.973) (-1142.938) (-1141.925) [-1142.386] * (-1142.275) [-1143.821] (-1141.946) (-1145.261) -- 0:00:08
860000 -- [-1143.117] (-1142.022) (-1143.344) (-1145.707) * (-1144.413) (-1142.431) [-1142.572] (-1144.532) -- 0:00:08
Average standard deviation of split frequencies: 0.007376
860500 -- (-1145.018) (-1145.243) [-1144.829] (-1143.713) * (-1143.470) (-1142.926) (-1145.528) [-1141.641] -- 0:00:08
861000 -- (-1144.639) [-1141.664] (-1141.526) (-1142.552) * (-1144.857) (-1143.297) (-1145.558) [-1141.378] -- 0:00:08
861500 -- (-1143.268) [-1141.468] (-1142.597) (-1142.599) * (-1145.870) [-1142.859] (-1141.877) (-1141.951) -- 0:00:08
862000 -- (-1146.095) (-1141.419) (-1143.053) [-1142.005] * (-1145.603) (-1142.064) (-1144.175) [-1142.364] -- 0:00:08
862500 -- (-1147.188) [-1141.772] (-1142.655) (-1147.285) * (-1143.180) (-1142.755) [-1143.031] (-1142.740) -- 0:00:08
863000 -- (-1142.355) (-1145.598) (-1143.862) [-1142.881] * (-1145.078) (-1143.283) [-1143.737] (-1145.826) -- 0:00:08
863500 -- (-1145.739) (-1142.956) [-1142.354] (-1149.828) * [-1147.218] (-1143.740) (-1143.385) (-1146.443) -- 0:00:08
864000 -- (-1148.817) (-1141.867) [-1142.045] (-1144.802) * [-1143.458] (-1143.350) (-1143.544) (-1144.551) -- 0:00:08
864500 -- [-1146.188] (-1143.768) (-1142.853) (-1143.142) * [-1143.347] (-1142.380) (-1142.689) (-1143.481) -- 0:00:08
865000 -- (-1142.490) (-1143.284) [-1144.939] (-1145.180) * (-1147.528) [-1142.372] (-1143.234) (-1145.346) -- 0:00:08
Average standard deviation of split frequencies: 0.007585
865500 -- (-1149.952) [-1142.974] (-1146.610) (-1143.611) * (-1144.421) (-1145.018) (-1142.273) [-1144.911] -- 0:00:08
866000 -- [-1141.513] (-1143.787) (-1145.144) (-1141.252) * (-1144.768) [-1142.636] (-1141.706) (-1142.457) -- 0:00:08
866500 -- [-1142.672] (-1147.000) (-1142.198) (-1144.204) * (-1144.145) [-1141.392] (-1141.675) (-1143.216) -- 0:00:08
867000 -- (-1144.138) [-1143.131] (-1142.579) (-1142.927) * [-1144.244] (-1142.879) (-1141.675) (-1144.731) -- 0:00:08
867500 -- (-1143.180) (-1143.854) [-1141.762] (-1149.755) * (-1142.148) (-1144.671) (-1141.597) [-1142.149] -- 0:00:08
868000 -- (-1144.905) (-1142.387) [-1142.548] (-1141.617) * (-1143.669) (-1141.482) [-1142.709] (-1146.283) -- 0:00:08
868500 -- (-1142.108) [-1141.770] (-1143.445) (-1141.667) * (-1141.741) (-1145.306) [-1142.358] (-1147.166) -- 0:00:08
869000 -- (-1141.441) (-1144.480) [-1141.941] (-1145.046) * [-1141.419] (-1148.165) (-1143.622) (-1146.808) -- 0:00:08
869500 -- [-1141.547] (-1143.777) (-1142.230) (-1141.686) * (-1143.230) [-1149.271] (-1142.723) (-1143.877) -- 0:00:08
870000 -- (-1144.313) [-1144.006] (-1143.219) (-1142.922) * [-1141.770] (-1141.584) (-1143.300) (-1143.738) -- 0:00:08
Average standard deviation of split frequencies: 0.007039
870500 -- (-1144.270) (-1143.675) [-1141.909] (-1142.872) * (-1143.550) [-1143.039] (-1144.417) (-1142.512) -- 0:00:08
871000 -- (-1141.226) (-1144.490) [-1141.817] (-1142.670) * [-1143.788] (-1145.334) (-1143.534) (-1143.735) -- 0:00:08
871500 -- [-1141.649] (-1144.685) (-1142.100) (-1143.305) * (-1143.664) (-1145.998) [-1142.334] (-1143.532) -- 0:00:08
872000 -- (-1144.628) (-1141.859) [-1143.506] (-1141.225) * (-1142.736) [-1142.519] (-1142.802) (-1142.271) -- 0:00:08
872500 -- (-1142.311) [-1143.837] (-1143.108) (-1141.809) * (-1143.044) (-1143.020) (-1142.383) [-1141.950] -- 0:00:08
873000 -- (-1146.884) (-1144.856) [-1142.022] (-1143.212) * (-1143.047) [-1142.566] (-1145.508) (-1143.854) -- 0:00:08
873500 -- (-1146.635) (-1143.388) [-1143.426] (-1142.215) * (-1141.252) [-1141.787] (-1142.720) (-1141.384) -- 0:00:08
874000 -- (-1145.692) (-1142.460) (-1141.655) [-1143.008] * (-1141.325) [-1145.050] (-1144.781) (-1144.180) -- 0:00:08
874500 -- [-1145.525] (-1144.646) (-1144.343) (-1142.725) * (-1141.913) [-1142.812] (-1142.979) (-1144.582) -- 0:00:08
875000 -- (-1146.037) [-1144.589] (-1141.854) (-1143.764) * [-1142.430] (-1142.791) (-1144.521) (-1146.142) -- 0:00:08
Average standard deviation of split frequencies: 0.007937
875500 -- [-1146.672] (-1143.668) (-1142.810) (-1145.047) * (-1148.632) (-1145.213) [-1144.140] (-1144.111) -- 0:00:07
876000 -- (-1146.621) [-1142.947] (-1142.012) (-1142.940) * (-1143.321) [-1142.861] (-1148.615) (-1142.659) -- 0:00:07
876500 -- [-1145.913] (-1141.839) (-1141.201) (-1147.763) * [-1143.295] (-1141.908) (-1141.889) (-1145.678) -- 0:00:07
877000 -- [-1143.724] (-1142.019) (-1143.490) (-1144.842) * (-1143.378) [-1141.778] (-1143.662) (-1143.499) -- 0:00:07
877500 -- (-1144.918) (-1142.600) [-1142.541] (-1141.741) * (-1145.434) [-1141.597] (-1143.939) (-1142.312) -- 0:00:07
878000 -- (-1143.216) (-1141.599) [-1142.503] (-1141.370) * [-1143.228] (-1146.671) (-1143.921) (-1141.883) -- 0:00:07
878500 -- (-1141.386) (-1141.627) (-1145.786) [-1143.653] * (-1143.166) (-1142.205) [-1143.836] (-1143.289) -- 0:00:07
879000 -- [-1147.110] (-1141.865) (-1143.832) (-1142.492) * [-1142.047] (-1144.323) (-1143.348) (-1142.134) -- 0:00:07
879500 -- (-1144.327) [-1143.200] (-1142.561) (-1146.958) * (-1146.789) (-1143.485) (-1142.260) [-1142.191] -- 0:00:07
880000 -- (-1143.342) (-1147.024) [-1141.351] (-1144.677) * (-1148.555) (-1141.601) (-1144.146) [-1142.759] -- 0:00:07
Average standard deviation of split frequencies: 0.007929
880500 -- (-1147.042) (-1143.072) (-1141.358) [-1146.176] * (-1142.144) (-1141.550) (-1143.938) [-1144.124] -- 0:00:07
881000 -- (-1144.095) [-1142.399] (-1143.613) (-1142.290) * [-1143.667] (-1141.786) (-1143.820) (-1141.335) -- 0:00:07
881500 -- [-1145.653] (-1144.518) (-1145.672) (-1141.253) * (-1145.764) (-1148.284) [-1144.658] (-1142.205) -- 0:00:07
882000 -- (-1146.117) (-1146.695) [-1144.949] (-1141.347) * [-1148.909] (-1147.696) (-1144.809) (-1141.325) -- 0:00:07
882500 -- (-1142.652) [-1144.986] (-1142.647) (-1141.418) * (-1146.829) [-1142.434] (-1145.444) (-1141.325) -- 0:00:07
883000 -- (-1142.853) (-1143.241) (-1142.014) [-1141.062] * [-1146.402] (-1143.041) (-1149.259) (-1146.455) -- 0:00:07
883500 -- (-1142.528) (-1141.286) (-1142.535) [-1142.471] * [-1143.793] (-1141.926) (-1143.827) (-1145.078) -- 0:00:07
884000 -- (-1141.887) (-1142.494) (-1142.726) [-1144.544] * [-1141.197] (-1141.794) (-1144.701) (-1143.708) -- 0:00:07
884500 -- (-1144.715) (-1143.759) (-1144.634) [-1141.933] * (-1141.386) (-1142.575) (-1148.181) [-1143.452] -- 0:00:07
885000 -- [-1145.493] (-1143.317) (-1144.351) (-1142.181) * (-1143.576) [-1149.752] (-1143.833) (-1144.453) -- 0:00:07
Average standard deviation of split frequencies: 0.008826
885500 -- (-1146.506) [-1143.642] (-1146.669) (-1143.931) * (-1143.102) (-1144.683) (-1145.507) [-1143.859] -- 0:00:07
886000 -- [-1142.807] (-1142.187) (-1145.817) (-1144.033) * (-1142.910) (-1148.941) [-1141.289] (-1142.281) -- 0:00:07
886500 -- (-1142.285) (-1144.188) (-1142.864) [-1141.202] * [-1147.276] (-1143.082) (-1147.129) (-1145.818) -- 0:00:07
887000 -- (-1142.193) (-1144.374) [-1142.528] (-1141.136) * (-1142.981) (-1143.662) [-1146.049] (-1141.649) -- 0:00:07
887500 -- (-1143.174) [-1147.343] (-1146.745) (-1145.592) * (-1142.997) [-1142.193] (-1147.264) (-1143.213) -- 0:00:07
888000 -- (-1143.198) (-1145.898) [-1142.041] (-1147.754) * [-1143.503] (-1142.651) (-1147.760) (-1145.942) -- 0:00:07
888500 -- [-1141.643] (-1143.799) (-1143.096) (-1145.680) * (-1142.881) (-1145.259) (-1142.934) [-1143.647] -- 0:00:07
889000 -- (-1143.275) (-1142.121) [-1143.046] (-1144.478) * (-1148.110) (-1141.982) [-1142.286] (-1142.022) -- 0:00:07
889500 -- (-1149.579) (-1146.294) (-1154.192) [-1142.860] * (-1144.424) [-1141.172] (-1143.096) (-1142.071) -- 0:00:07
890000 -- (-1149.151) [-1146.930] (-1144.277) (-1145.310) * (-1142.201) [-1141.269] (-1144.540) (-1145.006) -- 0:00:07
Average standard deviation of split frequencies: 0.008749
890500 -- (-1142.593) [-1144.265] (-1145.303) (-1146.636) * (-1142.032) (-1141.374) (-1142.407) [-1141.859] -- 0:00:07
891000 -- (-1146.552) [-1147.114] (-1143.814) (-1144.460) * [-1142.437] (-1141.818) (-1143.175) (-1142.780) -- 0:00:06
891500 -- (-1142.850) (-1144.069) [-1144.084] (-1143.747) * (-1144.735) (-1144.644) (-1142.941) [-1141.842] -- 0:00:06
892000 -- (-1141.663) [-1145.439] (-1145.538) (-1146.056) * (-1143.587) (-1146.890) [-1141.969] (-1142.528) -- 0:00:06
892500 -- (-1142.358) (-1145.830) [-1142.337] (-1142.775) * (-1146.123) (-1144.773) [-1144.059] (-1141.849) -- 0:00:06
893000 -- (-1145.591) (-1145.282) (-1141.397) [-1143.905] * (-1141.973) (-1143.533) (-1141.644) [-1142.090] -- 0:00:06
893500 -- (-1142.332) [-1145.883] (-1143.716) (-1144.139) * (-1142.038) (-1142.959) (-1145.724) [-1142.160] -- 0:00:06
894000 -- (-1142.880) (-1142.761) (-1143.949) [-1146.603] * (-1142.685) [-1142.374] (-1145.331) (-1144.001) -- 0:00:06
894500 -- (-1144.103) (-1141.931) [-1142.323] (-1148.389) * (-1144.098) [-1144.702] (-1143.032) (-1142.957) -- 0:00:06
895000 -- (-1143.543) (-1143.867) [-1144.341] (-1143.939) * (-1144.535) (-1144.963) [-1142.733] (-1143.997) -- 0:00:06
Average standard deviation of split frequencies: 0.008221
895500 -- (-1141.568) (-1142.650) (-1142.917) [-1143.825] * (-1148.498) [-1144.615] (-1143.950) (-1144.360) -- 0:00:06
896000 -- (-1142.526) [-1141.338] (-1143.635) (-1143.585) * (-1141.938) [-1141.352] (-1145.161) (-1144.978) -- 0:00:06
896500 -- (-1143.970) [-1141.687] (-1142.333) (-1144.928) * (-1142.907) (-1144.148) (-1145.870) [-1142.139] -- 0:00:06
897000 -- [-1142.774] (-1141.674) (-1143.526) (-1142.780) * (-1143.703) (-1143.708) [-1142.561] (-1141.753) -- 0:00:06
897500 -- (-1143.777) [-1141.484] (-1146.386) (-1144.074) * (-1142.765) (-1143.440) (-1145.584) [-1141.368] -- 0:00:06
898000 -- (-1143.376) [-1143.173] (-1143.347) (-1142.864) * (-1142.352) (-1143.162) (-1144.627) [-1142.784] -- 0:00:06
898500 -- [-1145.714] (-1146.108) (-1147.720) (-1142.542) * (-1146.931) (-1143.102) (-1143.762) [-1141.941] -- 0:00:06
899000 -- (-1143.316) (-1144.478) (-1143.217) [-1145.116] * (-1143.177) (-1143.420) (-1146.355) [-1141.846] -- 0:00:06
899500 -- (-1141.991) [-1141.816] (-1143.769) (-1147.842) * (-1142.746) (-1146.587) [-1145.543] (-1144.675) -- 0:00:06
900000 -- (-1143.916) [-1145.716] (-1141.721) (-1145.465) * (-1142.485) (-1143.223) (-1145.326) [-1144.842] -- 0:00:06
Average standard deviation of split frequencies: 0.008211
900500 -- [-1144.936] (-1146.400) (-1143.880) (-1145.163) * (-1144.302) (-1143.020) (-1148.939) [-1143.377] -- 0:00:06
901000 -- (-1148.484) (-1145.230) [-1143.130] (-1142.680) * (-1145.765) (-1142.265) (-1148.157) [-1142.374] -- 0:00:06
901500 -- [-1143.592] (-1142.834) (-1145.845) (-1146.920) * (-1141.396) (-1149.175) (-1143.876) [-1145.220] -- 0:00:06
902000 -- (-1142.729) (-1142.314) (-1150.034) [-1145.855] * (-1143.078) (-1146.908) [-1144.827] (-1148.355) -- 0:00:06
902500 -- (-1141.611) (-1146.285) [-1147.651] (-1144.667) * (-1143.053) [-1142.819] (-1144.144) (-1149.471) -- 0:00:06
903000 -- (-1142.886) (-1141.485) (-1141.477) [-1142.448] * (-1145.710) (-1141.780) (-1142.952) [-1143.373] -- 0:00:06
903500 -- (-1144.198) [-1143.663] (-1143.070) (-1143.941) * [-1144.179] (-1141.585) (-1146.026) (-1145.472) -- 0:00:06
904000 -- (-1143.275) [-1143.528] (-1144.522) (-1142.589) * [-1144.153] (-1141.340) (-1145.093) (-1143.626) -- 0:00:06
904500 -- (-1147.982) (-1145.328) (-1143.533) [-1145.599] * (-1144.090) (-1141.576) (-1143.632) [-1142.644] -- 0:00:06
905000 -- [-1146.002] (-1147.046) (-1141.786) (-1142.907) * (-1142.432) [-1142.613] (-1144.801) (-1143.519) -- 0:00:06
Average standard deviation of split frequencies: 0.008260
905500 -- (-1148.046) (-1153.344) (-1143.771) [-1143.077] * (-1144.196) [-1143.216] (-1143.121) (-1142.317) -- 0:00:06
906000 -- (-1144.399) (-1142.400) [-1142.800] (-1142.562) * [-1143.594] (-1152.701) (-1142.982) (-1141.740) -- 0:00:06
906500 -- (-1143.964) [-1143.023] (-1142.304) (-1142.357) * (-1143.471) (-1143.195) (-1141.340) [-1142.000] -- 0:00:05
907000 -- [-1145.182] (-1146.822) (-1142.718) (-1143.119) * (-1143.632) (-1142.639) [-1141.471] (-1143.080) -- 0:00:05
907500 -- (-1142.588) [-1143.459] (-1149.595) (-1143.007) * (-1144.893) (-1141.738) [-1141.944] (-1143.229) -- 0:00:05
908000 -- (-1143.129) [-1142.891] (-1141.845) (-1142.645) * (-1145.328) (-1143.679) (-1146.926) [-1141.931] -- 0:00:05
908500 -- (-1145.492) (-1142.346) [-1143.381] (-1143.424) * (-1143.403) (-1142.428) (-1143.787) [-1143.991] -- 0:00:05
909000 -- [-1144.903] (-1142.516) (-1144.533) (-1142.265) * (-1144.664) (-1141.998) [-1144.309] (-1144.907) -- 0:00:05
909500 -- (-1143.626) [-1143.190] (-1143.520) (-1141.857) * (-1147.447) [-1145.069] (-1144.081) (-1143.988) -- 0:00:05
910000 -- (-1142.932) (-1144.220) [-1145.624] (-1142.269) * (-1143.508) (-1142.061) [-1143.112] (-1143.485) -- 0:00:05
Average standard deviation of split frequencies: 0.008121
910500 -- (-1144.515) (-1142.245) (-1147.152) [-1143.436] * (-1148.115) (-1144.607) (-1145.409) [-1143.300] -- 0:00:05
911000 -- (-1144.804) (-1142.702) (-1143.083) [-1143.110] * (-1142.734) [-1146.258] (-1141.430) (-1142.684) -- 0:00:05
911500 -- (-1143.553) [-1146.125] (-1145.237) (-1143.114) * [-1142.809] (-1146.511) (-1146.858) (-1144.146) -- 0:00:05
912000 -- (-1145.953) [-1145.547] (-1142.252) (-1143.634) * [-1144.459] (-1143.118) (-1143.485) (-1141.244) -- 0:00:05
912500 -- (-1142.454) (-1144.952) [-1143.432] (-1146.788) * (-1144.122) (-1141.801) (-1142.958) [-1141.189] -- 0:00:05
913000 -- (-1141.976) (-1144.378) [-1142.644] (-1144.020) * (-1142.946) [-1142.940] (-1143.614) (-1141.222) -- 0:00:05
913500 -- (-1142.806) [-1142.819] (-1142.509) (-1143.716) * (-1146.151) (-1143.432) (-1145.259) [-1141.382] -- 0:00:05
914000 -- (-1143.023) (-1143.052) [-1145.914] (-1143.619) * [-1147.189] (-1143.738) (-1145.301) (-1142.375) -- 0:00:05
914500 -- [-1142.634] (-1143.626) (-1141.842) (-1141.767) * (-1144.322) [-1142.444] (-1142.898) (-1142.060) -- 0:00:05
915000 -- (-1145.203) (-1144.070) [-1144.311] (-1142.895) * [-1148.897] (-1147.703) (-1142.320) (-1143.083) -- 0:00:05
Average standard deviation of split frequencies: 0.008266
915500 -- (-1142.234) [-1143.414] (-1145.377) (-1142.753) * [-1144.546] (-1145.795) (-1143.935) (-1141.740) -- 0:00:05
916000 -- (-1141.292) (-1141.951) (-1145.160) [-1142.529] * [-1147.100] (-1142.244) (-1145.647) (-1142.889) -- 0:00:05
916500 -- (-1141.770) [-1143.456] (-1143.586) (-1142.124) * (-1145.946) [-1143.082] (-1141.883) (-1146.234) -- 0:00:05
917000 -- (-1142.804) (-1142.088) (-1145.410) [-1141.744] * (-1144.576) (-1142.299) [-1141.793] (-1143.121) -- 0:00:05
917500 -- [-1142.891] (-1143.140) (-1143.575) (-1141.974) * [-1142.513] (-1144.849) (-1142.862) (-1145.539) -- 0:00:05
918000 -- (-1141.650) (-1145.265) [-1143.721] (-1141.561) * [-1143.049] (-1141.372) (-1141.909) (-1142.768) -- 0:00:05
918500 -- (-1143.687) (-1144.175) (-1145.250) [-1142.973] * (-1145.414) [-1141.113] (-1143.028) (-1142.243) -- 0:00:05
919000 -- (-1147.676) (-1143.221) (-1142.777) [-1142.922] * (-1144.231) (-1141.336) [-1142.147] (-1144.705) -- 0:00:05
919500 -- [-1145.171] (-1146.837) (-1141.880) (-1142.115) * [-1142.175] (-1141.066) (-1143.805) (-1143.224) -- 0:00:05
920000 -- (-1145.542) (-1144.549) [-1142.857] (-1145.599) * (-1142.340) (-1142.059) (-1141.211) [-1143.347] -- 0:00:05
Average standard deviation of split frequencies: 0.008800
920500 -- [-1142.793] (-1145.013) (-1149.707) (-1141.399) * [-1141.673] (-1145.362) (-1141.488) (-1144.043) -- 0:00:05
921000 -- [-1143.311] (-1142.257) (-1143.022) (-1149.141) * (-1141.855) (-1144.751) [-1141.083] (-1144.537) -- 0:00:05
921500 -- (-1147.273) (-1142.735) [-1143.021] (-1146.424) * [-1143.133] (-1143.292) (-1148.771) (-1142.767) -- 0:00:05
922000 -- (-1150.478) (-1143.424) [-1144.979] (-1144.465) * (-1143.909) [-1142.681] (-1141.855) (-1146.948) -- 0:00:05
922500 -- (-1144.737) [-1143.112] (-1147.112) (-1142.208) * [-1142.497] (-1141.390) (-1142.704) (-1141.986) -- 0:00:05
923000 -- (-1145.107) (-1143.974) (-1144.849) [-1141.702] * (-1142.925) (-1142.454) (-1143.041) [-1141.771] -- 0:00:05
923500 -- (-1144.610) (-1144.951) (-1145.220) [-1142.065] * [-1145.358] (-1142.820) (-1144.279) (-1144.009) -- 0:00:04
924000 -- (-1150.114) (-1146.118) (-1143.064) [-1143.425] * (-1149.306) [-1143.694] (-1143.518) (-1141.414) -- 0:00:04
924500 -- (-1146.399) (-1147.008) [-1142.327] (-1142.899) * (-1144.914) (-1142.922) (-1143.486) [-1141.972] -- 0:00:04
925000 -- (-1144.845) (-1145.677) [-1143.438] (-1144.923) * [-1142.401] (-1141.856) (-1142.461) (-1146.723) -- 0:00:04
Average standard deviation of split frequencies: 0.009132
925500 -- (-1145.098) (-1144.617) [-1141.672] (-1142.951) * [-1141.775] (-1141.757) (-1144.684) (-1145.373) -- 0:00:04
926000 -- (-1142.293) (-1145.779) (-1142.456) [-1142.907] * (-1142.216) [-1146.919] (-1145.817) (-1145.613) -- 0:00:04
926500 -- (-1143.628) [-1142.344] (-1144.021) (-1145.893) * (-1143.008) (-1144.648) (-1145.379) [-1142.588] -- 0:00:04
927000 -- (-1141.651) (-1142.420) (-1142.422) [-1142.849] * (-1141.673) [-1142.296] (-1141.626) (-1146.693) -- 0:00:04
927500 -- (-1143.831) [-1145.310] (-1142.713) (-1145.756) * [-1144.233] (-1143.533) (-1141.626) (-1143.780) -- 0:00:04
928000 -- (-1144.702) [-1146.892] (-1143.310) (-1143.516) * (-1144.191) (-1142.001) [-1141.298] (-1141.682) -- 0:00:04
928500 -- (-1143.158) (-1144.489) [-1144.180] (-1147.480) * (-1145.270) (-1142.870) (-1142.220) [-1144.619] -- 0:00:04
929000 -- (-1145.040) [-1142.739] (-1148.470) (-1142.850) * [-1142.991] (-1142.490) (-1146.694) (-1143.466) -- 0:00:04
929500 -- [-1144.876] (-1145.151) (-1142.013) (-1148.247) * [-1143.046] (-1143.732) (-1141.370) (-1142.267) -- 0:00:04
930000 -- (-1141.338) [-1142.576] (-1143.778) (-1141.547) * (-1142.983) (-1147.424) (-1143.511) [-1143.289] -- 0:00:04
Average standard deviation of split frequencies: 0.008814
930500 -- (-1141.517) [-1141.356] (-1143.945) (-1142.121) * (-1142.750) (-1148.860) [-1147.668] (-1142.097) -- 0:00:04
931000 -- (-1141.485) (-1142.846) (-1149.097) [-1142.216] * (-1142.684) [-1141.906] (-1142.756) (-1142.975) -- 0:00:04
931500 -- [-1142.110] (-1141.479) (-1146.793) (-1144.997) * (-1142.461) [-1144.464] (-1142.686) (-1144.149) -- 0:00:04
932000 -- (-1143.386) [-1142.723] (-1144.828) (-1143.826) * (-1146.993) (-1143.037) [-1145.558] (-1142.348) -- 0:00:04
932500 -- (-1141.750) [-1145.592] (-1143.496) (-1142.559) * (-1147.693) (-1145.047) [-1143.237] (-1143.755) -- 0:00:04
933000 -- (-1145.433) (-1144.821) (-1146.819) [-1143.345] * [-1144.004] (-1144.076) (-1143.928) (-1142.614) -- 0:00:04
933500 -- (-1144.073) [-1141.987] (-1143.167) (-1149.372) * (-1143.019) (-1143.153) [-1143.438] (-1141.499) -- 0:00:04
934000 -- (-1145.860) [-1141.261] (-1142.482) (-1143.665) * (-1143.921) (-1143.026) [-1142.625] (-1144.130) -- 0:00:04
934500 -- (-1144.107) (-1141.448) [-1141.880] (-1146.362) * (-1147.921) [-1143.077] (-1145.581) (-1142.312) -- 0:00:04
935000 -- (-1144.728) (-1141.672) (-1143.310) [-1145.273] * (-1151.308) (-1143.997) (-1141.755) [-1141.898] -- 0:00:04
Average standard deviation of split frequencies: 0.008595
935500 -- [-1143.970] (-1144.124) (-1144.286) (-1143.313) * [-1143.322] (-1143.917) (-1142.022) (-1142.409) -- 0:00:04
936000 -- (-1150.396) (-1143.628) (-1147.273) [-1144.814] * (-1142.699) (-1145.180) (-1141.980) [-1144.646] -- 0:00:04
936500 -- (-1149.876) (-1142.433) (-1145.424) [-1143.321] * [-1143.158] (-1143.149) (-1145.524) (-1143.739) -- 0:00:04
937000 -- (-1143.036) [-1143.576] (-1142.861) (-1142.672) * (-1144.096) (-1141.451) [-1146.498] (-1145.370) -- 0:00:04
937500 -- [-1144.589] (-1149.722) (-1148.338) (-1144.701) * (-1144.128) [-1144.193] (-1143.555) (-1141.505) -- 0:00:04
938000 -- (-1141.969) (-1145.445) (-1146.706) [-1142.831] * (-1142.101) (-1143.258) [-1146.261] (-1142.466) -- 0:00:04
938500 -- (-1143.193) [-1142.663] (-1142.036) (-1143.847) * (-1143.134) (-1143.474) (-1141.182) [-1145.409] -- 0:00:03
939000 -- (-1141.368) (-1143.314) (-1142.009) [-1142.184] * (-1143.134) [-1143.112] (-1143.760) (-1144.416) -- 0:00:03
939500 -- (-1145.087) (-1142.916) [-1143.169] (-1143.633) * (-1147.189) (-1141.845) (-1148.233) [-1142.875] -- 0:00:03
940000 -- (-1143.117) (-1141.476) [-1142.230] (-1143.977) * (-1149.334) (-1144.337) (-1145.253) [-1141.875] -- 0:00:03
Average standard deviation of split frequencies: 0.008519
940500 -- (-1145.556) [-1142.350] (-1143.345) (-1148.928) * (-1143.746) (-1141.991) [-1144.007] (-1145.196) -- 0:00:03
941000 -- (-1142.420) (-1144.895) [-1143.274] (-1148.319) * [-1141.732] (-1142.710) (-1142.560) (-1142.613) -- 0:00:03
941500 -- [-1144.673] (-1143.776) (-1143.664) (-1143.952) * (-1143.603) (-1142.315) (-1145.255) [-1144.027] -- 0:00:03
942000 -- (-1143.822) (-1143.177) [-1141.995] (-1147.945) * (-1142.080) [-1143.844] (-1142.175) (-1142.674) -- 0:00:03
942500 -- [-1142.094] (-1142.718) (-1141.923) (-1148.974) * (-1143.642) (-1144.447) (-1141.538) [-1142.237] -- 0:00:03
943000 -- (-1144.275) (-1143.615) (-1141.707) [-1142.327] * [-1146.230] (-1141.626) (-1142.621) (-1146.917) -- 0:00:03
943500 -- [-1141.775] (-1143.958) (-1142.113) (-1146.485) * [-1141.954] (-1143.135) (-1141.631) (-1146.493) -- 0:00:03
944000 -- [-1142.052] (-1142.794) (-1144.131) (-1147.609) * [-1141.769] (-1141.306) (-1144.541) (-1147.387) -- 0:00:03
944500 -- [-1142.145] (-1142.875) (-1142.124) (-1143.990) * (-1142.583) [-1141.222] (-1143.558) (-1149.068) -- 0:00:03
945000 -- (-1141.409) [-1142.167] (-1141.400) (-1142.590) * [-1142.222] (-1146.432) (-1144.825) (-1144.530) -- 0:00:03
Average standard deviation of split frequencies: 0.008907
945500 -- (-1147.906) (-1143.728) [-1144.083] (-1141.547) * (-1142.091) (-1145.378) (-1142.809) [-1143.031] -- 0:00:03
946000 -- (-1145.575) (-1146.216) [-1143.315] (-1143.656) * (-1144.073) (-1146.760) [-1141.857] (-1145.420) -- 0:00:03
946500 -- (-1143.862) [-1142.568] (-1142.720) (-1147.074) * (-1143.346) [-1143.105] (-1141.473) (-1143.091) -- 0:00:03
947000 -- (-1142.826) (-1142.603) [-1142.632] (-1143.492) * [-1143.111] (-1143.870) (-1142.731) (-1145.679) -- 0:00:03
947500 -- (-1141.983) (-1146.966) [-1142.562] (-1142.470) * (-1146.701) (-1144.721) (-1147.721) [-1141.964] -- 0:00:03
948000 -- (-1141.633) (-1143.676) (-1142.077) [-1141.841] * [-1144.293] (-1143.863) (-1142.668) (-1143.425) -- 0:00:03
948500 -- (-1143.706) (-1142.598) (-1143.524) [-1142.177] * (-1142.680) [-1142.101] (-1143.153) (-1145.227) -- 0:00:03
949000 -- (-1141.929) (-1141.974) (-1144.429) [-1143.531] * (-1142.932) (-1142.523) [-1142.140] (-1144.055) -- 0:00:03
949500 -- (-1145.354) [-1144.924] (-1143.403) (-1143.285) * (-1143.493) [-1142.467] (-1141.818) (-1143.379) -- 0:00:03
950000 -- (-1148.138) [-1142.160] (-1142.910) (-1141.093) * (-1142.579) (-1144.287) (-1142.535) [-1143.307] -- 0:00:03
Average standard deviation of split frequencies: 0.008833
950500 -- (-1144.503) (-1146.267) (-1143.847) [-1141.093] * (-1142.059) [-1141.725] (-1144.565) (-1142.022) -- 0:00:03
951000 -- (-1144.683) (-1146.274) (-1143.178) [-1141.344] * (-1141.609) (-1141.502) (-1142.848) [-1141.533] -- 0:00:03
951500 -- (-1144.760) [-1144.833] (-1146.454) (-1142.617) * [-1142.281] (-1148.213) (-1142.329) (-1141.519) -- 0:00:03
952000 -- (-1143.246) (-1142.854) [-1145.139] (-1142.229) * (-1144.501) (-1146.759) [-1142.383] (-1141.657) -- 0:00:03
952500 -- [-1143.191] (-1141.567) (-1146.167) (-1144.808) * (-1143.939) (-1143.154) [-1142.705] (-1141.796) -- 0:00:03
953000 -- (-1146.105) (-1144.828) (-1145.662) [-1144.716] * (-1143.054) (-1142.707) [-1142.321] (-1143.191) -- 0:00:03
953500 -- (-1144.968) [-1141.728] (-1144.234) (-1144.022) * (-1141.721) (-1143.228) (-1143.807) [-1143.670] -- 0:00:03
954000 -- [-1141.240] (-1145.573) (-1144.125) (-1143.315) * (-1141.553) (-1144.361) (-1144.450) [-1142.154] -- 0:00:02
954500 -- (-1142.930) [-1144.124] (-1142.830) (-1142.565) * (-1142.053) [-1142.126] (-1146.216) (-1142.478) -- 0:00:02
955000 -- [-1142.217] (-1142.118) (-1141.924) (-1143.496) * (-1144.655) [-1144.321] (-1144.340) (-1144.821) -- 0:00:02
Average standard deviation of split frequencies: 0.009137
955500 -- (-1141.814) (-1142.201) [-1142.611] (-1145.946) * (-1145.299) (-1143.546) (-1146.969) [-1144.399] -- 0:00:02
956000 -- (-1146.113) [-1141.776] (-1143.437) (-1144.031) * [-1142.871] (-1143.844) (-1145.189) (-1144.105) -- 0:00:02
956500 -- [-1142.414] (-1144.684) (-1142.673) (-1144.685) * [-1141.935] (-1144.087) (-1143.672) (-1145.256) -- 0:00:02
957000 -- (-1142.990) (-1143.487) [-1142.459] (-1144.857) * (-1145.723) [-1143.993] (-1144.012) (-1148.512) -- 0:00:02
957500 -- (-1143.130) [-1144.492] (-1144.120) (-1142.472) * [-1145.533] (-1146.188) (-1143.140) (-1144.511) -- 0:00:02
958000 -- (-1145.974) (-1141.602) [-1142.637] (-1143.123) * (-1145.561) (-1145.729) [-1142.145] (-1142.955) -- 0:00:02
958500 -- (-1143.317) (-1144.749) (-1147.257) [-1143.255] * [-1144.186] (-1144.477) (-1142.816) (-1141.988) -- 0:00:02
959000 -- (-1143.887) (-1143.888) (-1143.068) [-1142.075] * (-1145.733) (-1148.067) [-1143.168] (-1142.212) -- 0:00:02
959500 -- (-1148.366) (-1145.474) (-1146.353) [-1142.909] * (-1144.813) [-1144.816] (-1142.581) (-1143.961) -- 0:00:02
960000 -- (-1144.815) (-1142.370) (-1145.237) [-1142.574] * [-1142.866] (-1147.241) (-1143.108) (-1144.892) -- 0:00:02
Average standard deviation of split frequencies: 0.008925
960500 -- (-1143.001) (-1143.336) (-1143.825) [-1143.695] * (-1144.390) (-1144.085) (-1142.495) [-1144.131] -- 0:00:02
961000 -- (-1143.452) (-1141.942) [-1143.614] (-1142.561) * (-1142.030) (-1145.919) [-1141.914] (-1144.183) -- 0:00:02
961500 -- (-1145.023) (-1146.327) [-1145.776] (-1145.442) * (-1143.906) (-1144.487) (-1143.555) [-1142.667] -- 0:00:02
962000 -- (-1142.394) (-1145.453) [-1145.387] (-1142.459) * (-1143.610) (-1141.725) [-1142.221] (-1143.246) -- 0:00:02
962500 -- [-1144.052] (-1144.087) (-1141.326) (-1142.654) * (-1142.216) (-1148.200) (-1145.971) [-1144.834] -- 0:00:02
963000 -- (-1142.086) (-1143.933) (-1142.349) [-1146.251] * (-1143.656) (-1143.423) (-1145.750) [-1142.883] -- 0:00:02
963500 -- [-1141.790] (-1142.162) (-1142.342) (-1145.505) * [-1142.371] (-1143.024) (-1147.010) (-1141.596) -- 0:00:02
964000 -- [-1143.631] (-1142.164) (-1143.567) (-1141.556) * (-1143.907) [-1143.421] (-1148.212) (-1145.201) -- 0:00:02
964500 -- (-1145.486) (-1143.498) [-1145.166] (-1141.422) * (-1142.848) (-1146.077) (-1143.179) [-1142.329] -- 0:00:02
965000 -- [-1142.776] (-1144.102) (-1142.223) (-1141.602) * (-1145.101) (-1142.953) (-1146.922) [-1145.152] -- 0:00:02
Average standard deviation of split frequencies: 0.009180
965500 -- (-1142.013) (-1144.809) (-1142.248) [-1142.328] * (-1145.657) (-1142.669) [-1144.520] (-1142.922) -- 0:00:02
966000 -- [-1144.542] (-1141.767) (-1143.062) (-1141.177) * [-1142.552] (-1144.151) (-1145.432) (-1143.662) -- 0:00:02
966500 -- (-1143.363) (-1144.927) [-1142.874] (-1143.431) * [-1142.417] (-1143.293) (-1144.486) (-1146.061) -- 0:00:02
967000 -- (-1144.139) (-1142.123) [-1143.771] (-1142.102) * (-1148.809) [-1143.375] (-1146.910) (-1145.153) -- 0:00:02
967500 -- (-1142.022) (-1143.916) [-1143.087] (-1146.242) * (-1146.263) [-1144.592] (-1144.359) (-1143.677) -- 0:00:02
968000 -- [-1146.589] (-1143.581) (-1144.105) (-1144.530) * (-1142.040) (-1143.748) [-1143.154] (-1143.450) -- 0:00:02
968500 -- [-1149.271] (-1144.031) (-1147.707) (-1141.812) * [-1142.014] (-1141.695) (-1142.813) (-1142.058) -- 0:00:02
969000 -- [-1144.913] (-1142.908) (-1146.414) (-1141.450) * [-1142.023] (-1142.305) (-1144.924) (-1141.501) -- 0:00:02
969500 -- (-1145.118) (-1142.578) [-1144.075] (-1141.866) * (-1146.288) [-1148.310] (-1145.057) (-1142.557) -- 0:00:01
970000 -- [-1143.692] (-1142.600) (-1146.000) (-1148.444) * (-1142.774) (-1141.949) [-1148.521] (-1141.976) -- 0:00:01
Average standard deviation of split frequencies: 0.009379
970500 -- (-1142.451) (-1143.619) [-1142.621] (-1143.184) * (-1142.795) [-1145.062] (-1142.832) (-1143.342) -- 0:00:01
971000 -- [-1143.128] (-1144.125) (-1141.818) (-1143.704) * (-1142.262) (-1142.845) (-1143.916) [-1144.489] -- 0:00:01
971500 -- [-1142.426] (-1144.432) (-1141.975) (-1142.857) * (-1142.763) [-1143.637] (-1142.429) (-1144.802) -- 0:00:01
972000 -- (-1145.079) (-1143.835) [-1141.563] (-1142.908) * (-1142.862) [-1143.070] (-1141.317) (-1143.944) -- 0:00:01
972500 -- [-1141.908] (-1143.455) (-1142.986) (-1145.304) * [-1142.546] (-1141.550) (-1142.313) (-1143.972) -- 0:00:01
973000 -- (-1141.637) [-1141.340] (-1144.005) (-1143.818) * [-1142.645] (-1146.262) (-1141.818) (-1141.021) -- 0:00:01
973500 -- (-1144.613) (-1141.875) [-1143.798] (-1143.462) * (-1142.289) (-1147.958) (-1142.575) [-1142.428] -- 0:00:01
974000 -- (-1143.462) [-1141.630] (-1142.575) (-1143.164) * [-1142.465] (-1147.522) (-1144.650) (-1142.585) -- 0:00:01
974500 -- (-1143.901) (-1146.467) [-1146.005] (-1142.578) * (-1144.181) (-1143.429) [-1142.742] (-1148.276) -- 0:00:01
975000 -- (-1144.139) [-1144.648] (-1145.680) (-1143.029) * [-1143.861] (-1146.439) (-1143.550) (-1145.029) -- 0:00:01
Average standard deviation of split frequencies: 0.009298
975500 -- (-1144.715) [-1145.354] (-1145.670) (-1141.610) * (-1145.395) [-1146.336] (-1143.830) (-1148.416) -- 0:00:01
976000 -- (-1141.764) (-1145.049) (-1145.533) [-1145.615] * [-1142.481] (-1144.248) (-1144.411) (-1146.842) -- 0:00:01
976500 -- (-1144.365) (-1143.337) [-1143.896] (-1143.521) * (-1146.463) [-1145.247] (-1142.503) (-1143.611) -- 0:00:01
977000 -- (-1142.318) (-1145.422) (-1147.933) [-1141.884] * (-1146.483) (-1143.586) [-1141.827] (-1143.237) -- 0:00:01
977500 -- [-1142.269] (-1143.004) (-1143.434) (-1147.253) * (-1145.823) (-1145.489) [-1141.951] (-1142.136) -- 0:00:01
978000 -- (-1146.436) [-1146.292] (-1143.942) (-1142.283) * (-1141.337) (-1143.299) (-1143.184) [-1142.590] -- 0:00:01
978500 -- (-1142.468) [-1141.320] (-1144.978) (-1141.453) * (-1143.982) (-1143.696) [-1145.539] (-1145.495) -- 0:00:01
979000 -- (-1142.554) (-1142.074) (-1144.774) [-1141.328] * [-1142.295] (-1145.007) (-1147.699) (-1145.657) -- 0:00:01
979500 -- (-1142.003) (-1142.107) [-1144.627] (-1142.719) * [-1144.343] (-1142.831) (-1144.097) (-1150.480) -- 0:00:01
980000 -- (-1149.002) (-1142.675) [-1142.960] (-1144.101) * (-1144.346) [-1145.608] (-1142.923) (-1145.200) -- 0:00:01
Average standard deviation of split frequencies: 0.009013
980500 -- (-1145.797) [-1144.717] (-1142.657) (-1146.349) * (-1143.329) (-1142.914) (-1145.022) [-1142.547] -- 0:00:01
981000 -- (-1141.932) (-1141.390) (-1142.529) [-1141.741] * [-1142.822] (-1142.378) (-1145.486) (-1143.671) -- 0:00:01
981500 -- (-1142.757) (-1143.673) [-1145.152] (-1143.016) * (-1146.374) [-1144.739] (-1145.308) (-1141.553) -- 0:00:01
982000 -- (-1145.754) (-1143.056) [-1143.579] (-1144.183) * [-1146.190] (-1144.031) (-1143.977) (-1144.169) -- 0:00:01
982500 -- (-1141.655) (-1144.416) [-1142.003] (-1143.337) * (-1144.732) [-1142.524] (-1144.774) (-1144.554) -- 0:00:01
983000 -- (-1141.682) (-1148.321) (-1141.025) [-1142.098] * (-1144.483) (-1142.156) [-1142.551] (-1151.090) -- 0:00:01
983500 -- [-1142.383] (-1145.915) (-1144.030) (-1142.866) * (-1144.415) (-1144.030) [-1142.568] (-1144.218) -- 0:00:01
984000 -- (-1146.510) [-1147.394] (-1142.192) (-1141.821) * (-1148.069) [-1143.136] (-1141.574) (-1142.115) -- 0:00:01
984500 -- (-1144.209) (-1145.113) [-1142.125] (-1148.122) * (-1144.044) (-1141.884) [-1142.560] (-1142.467) -- 0:00:01
985000 -- (-1142.202) (-1144.363) [-1144.583] (-1143.972) * (-1143.330) (-1141.759) [-1143.928] (-1145.265) -- 0:00:00
Average standard deviation of split frequencies: 0.009144
985500 -- (-1141.897) (-1146.504) (-1143.029) [-1146.135] * (-1143.828) [-1141.737] (-1142.484) (-1143.308) -- 0:00:00
986000 -- [-1142.755] (-1147.113) (-1142.534) (-1143.172) * [-1143.519] (-1141.512) (-1142.591) (-1145.276) -- 0:00:00
986500 -- (-1142.614) (-1144.495) (-1144.299) [-1142.230] * (-1143.900) [-1144.017] (-1143.915) (-1146.103) -- 0:00:00
987000 -- (-1142.640) [-1144.525] (-1142.393) (-1143.798) * (-1143.378) [-1144.032] (-1144.129) (-1145.884) -- 0:00:00
987500 -- (-1141.653) (-1142.959) (-1141.811) [-1143.731] * (-1142.901) (-1143.430) (-1141.752) [-1143.317] -- 0:00:00
988000 -- (-1143.682) (-1143.339) (-1142.008) [-1141.598] * (-1141.438) [-1142.331] (-1142.203) (-1141.682) -- 0:00:00
988500 -- [-1143.824] (-1143.688) (-1142.021) (-1141.668) * (-1150.360) (-1144.737) [-1144.733] (-1141.278) -- 0:00:00
989000 -- (-1142.842) (-1144.250) (-1145.939) [-1143.116] * (-1143.738) (-1145.513) (-1142.935) [-1141.285] -- 0:00:00
989500 -- (-1144.510) (-1143.206) (-1142.025) [-1141.762] * [-1143.061] (-1144.597) (-1143.554) (-1142.275) -- 0:00:00
990000 -- [-1142.926] (-1146.013) (-1141.144) (-1141.130) * (-1142.307) (-1143.071) (-1142.914) [-1141.636] -- 0:00:00
Average standard deviation of split frequencies: 0.009071
990500 -- (-1146.377) (-1145.027) (-1142.991) [-1143.435] * (-1144.765) (-1146.694) (-1145.096) [-1142.779] -- 0:00:00
991000 -- (-1144.126) [-1143.405] (-1143.496) (-1142.654) * (-1142.477) [-1143.058] (-1142.250) (-1143.910) -- 0:00:00
991500 -- (-1142.068) (-1143.426) [-1145.600] (-1145.018) * (-1141.820) (-1144.804) (-1144.501) [-1144.326] -- 0:00:00
992000 -- [-1143.326] (-1144.941) (-1145.243) (-1141.828) * [-1143.349] (-1145.645) (-1144.890) (-1144.027) -- 0:00:00
992500 -- (-1142.112) [-1143.538] (-1151.045) (-1143.167) * (-1142.390) [-1144.379] (-1146.438) (-1141.883) -- 0:00:00
993000 -- [-1142.664] (-1143.086) (-1145.800) (-1142.645) * [-1142.237] (-1143.338) (-1144.559) (-1141.147) -- 0:00:00
993500 -- (-1144.778) [-1145.364] (-1146.067) (-1143.097) * [-1145.336] (-1146.802) (-1143.283) (-1147.240) -- 0:00:00
994000 -- [-1143.966] (-1142.973) (-1146.250) (-1141.992) * (-1147.956) [-1144.258] (-1143.584) (-1144.392) -- 0:00:00
994500 -- (-1144.148) (-1142.830) (-1142.809) [-1143.954] * (-1143.458) [-1144.345] (-1143.608) (-1142.583) -- 0:00:00
995000 -- [-1145.979] (-1144.115) (-1142.222) (-1145.235) * (-1143.785) (-1145.456) (-1141.339) [-1141.399] -- 0:00:00
Average standard deviation of split frequencies: 0.009141
995500 -- (-1144.410) [-1147.040] (-1143.238) (-1143.651) * (-1144.569) [-1142.909] (-1141.995) (-1141.713) -- 0:00:00
996000 -- (-1141.703) (-1142.553) [-1142.021] (-1146.175) * (-1144.646) (-1146.714) [-1142.570] (-1141.334) -- 0:00:00
996500 -- [-1146.908] (-1141.624) (-1143.494) (-1142.141) * (-1144.860) [-1141.409] (-1144.571) (-1141.320) -- 0:00:00
997000 -- [-1142.962] (-1144.516) (-1144.604) (-1144.822) * (-1145.115) (-1143.105) (-1142.167) [-1141.309] -- 0:00:00
997500 -- (-1142.319) (-1147.677) (-1143.338) [-1143.262] * (-1143.038) [-1142.832] (-1145.615) (-1141.308) -- 0:00:00
998000 -- (-1142.660) (-1143.664) (-1141.881) [-1142.442] * (-1141.609) (-1152.989) [-1142.721] (-1146.048) -- 0:00:00
998500 -- (-1142.540) (-1144.582) [-1142.108] (-1142.686) * (-1142.038) (-1144.199) (-1143.183) [-1144.367] -- 0:00:00
999000 -- [-1146.151] (-1144.546) (-1145.735) (-1142.789) * (-1145.003) [-1144.170] (-1141.890) (-1142.288) -- 0:00:00
999500 -- (-1145.522) (-1145.813) (-1142.963) [-1146.718] * (-1141.554) (-1142.823) [-1146.774] (-1142.949) -- 0:00:00
1000000 -- (-1144.374) (-1145.387) [-1142.220] (-1143.251) * (-1141.117) [-1141.356] (-1146.396) (-1143.329) -- 0:00:00
Average standard deviation of split frequencies: 0.009068
Analysis completed in 1 mins 5 seconds
Analysis used 63.21 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1140.92
Likelihood of best state for "cold" chain of run 2 was -1140.92
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.9 % ( 33 %) Dirichlet(Pi{all})
28.2 % ( 24 %) Slider(Pi{all})
78.8 % ( 64 %) Multiplier(Alpha{1,2})
77.5 % ( 61 %) Multiplier(Alpha{3})
19.2 % ( 24 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.8 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 25 %) Dirichlet(Pi{all})
28.9 % ( 26 %) Slider(Pi{all})
79.0 % ( 48 %) Multiplier(Alpha{1,2})
77.7 % ( 44 %) Multiplier(Alpha{3})
18.7 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166292 0.82 0.67
3 | 166467 166510 0.84
4 | 166513 167161 167057
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166701 0.82 0.67
3 | 166855 166270 0.84
4 | 166295 167056 166823
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1142.50
| 2 2 |
| 1 12 |
| 2 2 1 1 1 1 |
|12 2 1 2 2 1 |
| 2 * 2 2 1 2* |
|2 1 1 2 * 2 2 1 1 1 * 2|
| 1* 22 2*12 2 2 2 2 2 1 |
| 21 2 11 * 21 1 1 1 |
| 2 2 12 1 1 1 1 2 1 1 2 2 2 |
| * 2 2 2 1 1 21 2 *1 |
| 1 2 1 11 11 2 2 1 1|
| 1 2 2 2 21 |
| 1 2 |
| 1 2 |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1144.37
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1142.67 -1146.93
2 -1142.59 -1145.54
--------------------------------------
TOTAL -1142.63 -1146.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902623 0.092882 0.338260 1.481872 0.866229 1491.17 1496.09 1.000
r(A<->C){all} 0.166079 0.017745 0.000070 0.424695 0.133625 160.21 213.93 1.003
r(A<->G){all} 0.165586 0.020117 0.000084 0.454654 0.127678 181.04 252.45 1.000
r(A<->T){all} 0.168173 0.019518 0.000097 0.448653 0.130654 239.10 265.06 1.002
r(C<->G){all} 0.163814 0.019007 0.000004 0.438611 0.131341 254.10 286.63 1.000
r(C<->T){all} 0.161809 0.018535 0.000015 0.446895 0.126397 175.45 226.66 1.000
r(G<->T){all} 0.174540 0.021992 0.000067 0.480947 0.134218 171.30 175.13 1.000
pi(A){all} 0.210318 0.000190 0.182302 0.236827 0.209865 1405.05 1418.04 1.000
pi(C){all} 0.296409 0.000244 0.264128 0.325182 0.296460 1106.65 1126.28 1.000
pi(G){all} 0.316621 0.000251 0.287801 0.349513 0.316308 1219.62 1228.95 1.000
pi(T){all} 0.176653 0.000171 0.151377 0.201796 0.176510 1249.10 1323.81 1.000
alpha{1,2} 0.427800 0.235244 0.000102 1.418501 0.252252 1282.42 1299.71 1.000
alpha{3} 0.462521 0.246342 0.000342 1.436230 0.304922 949.34 1016.57 1.004
pinvar{all} 0.998160 0.000005 0.994026 0.999998 0.998861 981.81 1147.55 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ....**
9 -- ...**.
10 -- .****.
11 -- .**...
12 -- .*.*..
13 -- ...*.*
14 -- ..**..
15 -- .*..*.
16 -- .***.*
17 -- ..*.*.
18 -- ..****
19 -- ..*..*
20 -- .*...*
21 -- .**.**
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.012248 0.145237 0.162558 2
8 458 0.152565 0.009422 0.145903 0.159227 2
9 443 0.147568 0.008009 0.141905 0.153231 2
10 443 0.147568 0.003298 0.145237 0.149900 2
11 439 0.146236 0.009893 0.139241 0.153231 2
12 437 0.145570 0.006124 0.141239 0.149900 2
13 434 0.144570 0.021670 0.129247 0.159893 2
14 423 0.140906 0.013662 0.131246 0.150566 2
15 422 0.140573 0.005653 0.136576 0.144570 2
16 419 0.139574 0.008009 0.133911 0.145237 2
17 417 0.138907 0.002355 0.137242 0.140573 2
18 413 0.137575 0.002355 0.135909 0.139241 2
19 411 0.136909 0.018373 0.123917 0.149900 2
20 410 0.136576 0.008480 0.130580 0.142572 2
21 399 0.132911 0.002355 0.131246 0.134577 2
22 278 0.092605 0.013191 0.083278 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103417 0.010849 0.000000 0.310198 0.072479 1.000 2
length{all}[2] 0.102655 0.010074 0.000063 0.305036 0.073979 1.000 2
length{all}[3] 0.097223 0.009837 0.000026 0.295809 0.066542 1.000 2
length{all}[4] 0.098016 0.009500 0.000029 0.299839 0.069074 1.000 2
length{all}[5] 0.099061 0.010038 0.000062 0.302961 0.069137 1.000 2
length{all}[6] 0.100557 0.009598 0.000010 0.293637 0.072725 1.000 2
length{all}[7] 0.099391 0.008406 0.000047 0.281961 0.075386 0.999 2
length{all}[8] 0.105148 0.011050 0.000103 0.299639 0.070513 0.998 2
length{all}[9] 0.107004 0.011665 0.000194 0.347528 0.071923 0.998 2
length{all}[10] 0.093110 0.008957 0.000301 0.269915 0.062738 0.998 2
length{all}[11] 0.105054 0.011413 0.000556 0.337003 0.068053 0.998 2
length{all}[12] 0.106048 0.010692 0.000452 0.325927 0.073759 0.998 2
length{all}[13] 0.101313 0.009594 0.000009 0.299961 0.073678 1.007 2
length{all}[14] 0.095338 0.008741 0.000019 0.281330 0.064179 1.000 2
length{all}[15] 0.094640 0.009180 0.000761 0.306873 0.063185 1.000 2
length{all}[16] 0.100545 0.008446 0.001652 0.280158 0.076712 0.998 2
length{all}[17] 0.091138 0.007794 0.000442 0.243913 0.069012 0.999 2
length{all}[18] 0.110785 0.012733 0.000149 0.322891 0.075575 1.000 2
length{all}[19] 0.104791 0.012707 0.000009 0.290674 0.074182 0.998 2
length{all}[20] 0.105488 0.010941 0.000496 0.325668 0.072897 0.999 2
length{all}[21] 0.100080 0.009695 0.000317 0.301189 0.069107 0.999 2
length{all}[22] 0.101107 0.011094 0.000100 0.298710 0.073672 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009068
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 840
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 280 / 280 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 280 / 280 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069082 0.047942 0.033102 0.044291 0.086057 0.019384 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1184.506802
Iterating by ming2
Initial: fx= 1184.506802
x= 0.06908 0.04794 0.03310 0.04429 0.08606 0.01938 0.30000 1.30000
1 h-m-p 0.0000 0.0001 669.2125 ++ 1152.853122 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0022 122.7096 ++ 1137.200722 m 0.0022 24 | 2/8
3 h-m-p 0.0000 0.0001 319.3550 ++ 1132.980824 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0001 533.2115 ++ 1128.650638 m 0.0001 46 | 4/8
5 h-m-p 0.0001 0.0004 164.3523 ++ 1125.633400 m 0.0004 57 | 5/8
6 h-m-p 0.0002 0.0010 37.2040 ++ 1118.012787 m 0.0010 68 | 6/8
7 h-m-p 0.0068 0.9900 5.0008 -------------.. | 6/8
8 h-m-p 0.0000 0.0002 271.2687 +++ 1102.306957 m 0.0002 102 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 +Y 1102.306957 0 6.4000 114 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 ---C 1102.306957 0 0.0001 129
Out..
lnL = -1102.306957
130 lfun, 130 eigenQcodon, 780 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030323 0.074474 0.073610 0.060058 0.087300 0.052568 0.000100 0.501165 0.181697
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.217638
np = 9
lnL0 = -1200.468992
Iterating by ming2
Initial: fx= 1200.468992
x= 0.03032 0.07447 0.07361 0.06006 0.08730 0.05257 0.00011 0.50116 0.18170
1 h-m-p 0.0000 0.0000 597.7346 ++ 1199.955223 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 430.7827 +++ 1153.568729 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0001 481.3385 ++ 1127.426657 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0003 106.0972 ++ 1122.884574 m 0.0003 51 | 4/9
5 h-m-p 0.0003 0.0014 84.8026 ++ 1116.517505 m 0.0014 63 | 5/9
6 h-m-p 0.0000 0.0000 3182.8264 ++ 1113.885193 m 0.0000 75 | 6/9
7 h-m-p 0.0002 0.0011 43.3620 ++ 1112.531353 m 0.0011 87 | 7/9
8 h-m-p 0.0148 0.3569 2.8914 -------------.. | 7/9
9 h-m-p 0.0000 0.0001 264.9971 ++ 1102.307017 m 0.0001 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 1102.307017 m 8.0000 134 | 7/9
11 h-m-p 0.0000 0.0000 0.0013
h-m-p: 5.33780597e-16 2.66890298e-15 1.34847165e-03 1102.307017
.. | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 1102.307017 m 8.0000 161 | 7/9
13 h-m-p 0.0076 3.7904 0.2022 +++++ 1102.306969 m 3.7904 178 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 1102.306969 0 1.6000 192 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 N 1102.306969 0 0.0160 205
Out..
lnL = -1102.306969
206 lfun, 618 eigenQcodon, 2472 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057129 0.079492 0.071534 0.023800 0.091710 0.108723 0.000100 1.508401 0.360702 0.434673 1.666086
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.281582
np = 11
lnL0 = -1214.866316
Iterating by ming2
Initial: fx= 1214.866316
x= 0.05713 0.07949 0.07153 0.02380 0.09171 0.10872 0.00011 1.50840 0.36070 0.43467 1.66609
1 h-m-p 0.0000 0.0000 606.1945 ++ 1214.347922 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 450.9061 +++ 1177.044707 m 0.0003 31 | 2/11
3 h-m-p 0.0001 0.0003 256.6631 ++ 1137.950389 m 0.0003 45 | 3/11
4 h-m-p 0.0005 0.0026 64.1909 ++ 1116.369824 m 0.0026 59 | 4/11
5 h-m-p 0.0000 0.0000 2266.2035 ++ 1109.983164 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 3215.3700 ++ 1107.517725 m 0.0000 87 | 6/11
7 h-m-p 0.0006 0.0031 10.6413 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 382.1448 ++ 1104.974361 m 0.0000 124 | 7/11
9 h-m-p 0.0160 8.0000 2.3722 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 272.8181 ++ 1102.307011 m 0.0000 163 | 8/11
11 h-m-p 0.0178 8.0000 0.0000 +++++ 1102.307011 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0419 ----------N 1102.307011 0 0.0000 207 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1102.307011 m 8.0000 227 | 8/11
14 h-m-p 0.0011 0.5663 2.6598 +++++ 1102.306987 m 0.5663 247 | 8/11
15 h-m-p -0.0000 -0.0000 0.4823
h-m-p: -0.00000000e+00 -0.00000000e+00 4.82302892e-01 1102.306987
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1102.306987 m 8.0000 278 | 8/11
17 h-m-p 0.0160 8.0000 0.8341 ++++Y 1102.306956 0 5.7878 299 | 8/11
18 h-m-p 1.6000 8.0000 0.0775 ++ 1102.306956 m 8.0000 316 | 8/11
19 h-m-p 1.6000 8.0000 0.0612 Y 1102.306956 0 0.8905 333 | 8/11
20 h-m-p 1.6000 8.0000 0.0004 ++ 1102.306956 m 8.0000 350 | 8/11
21 h-m-p 0.0189 8.0000 0.1825 +++C 1102.306956 0 1.3123 370 | 8/11
22 h-m-p 1.6000 8.0000 0.0165 ++ 1102.306956 m 8.0000 387 | 8/11
23 h-m-p 0.0407 2.5307 3.2433 ++Y 1102.306950 0 0.6516 406 | 8/11
24 h-m-p 1.6000 8.0000 1.0750 ++ 1102.306931 m 8.0000 420 | 8/11
25 h-m-p 1.6000 8.0000 0.8425 ++ 1102.306929 m 8.0000 434 | 8/11
26 h-m-p 1.6000 8.0000 2.4128 ++ 1102.306927 m 8.0000 451 | 8/11
27 h-m-p 1.3238 8.0000 14.5804 ++ 1102.306926 m 8.0000 465 | 8/11
28 h-m-p 0.8411 4.2056 10.8162 ++ 1102.306926 m 4.2056 479 | 8/11
29 h-m-p 1.6000 8.0000 12.7013 --------C 1102.306926 0 0.0000 501 | 8/11
30 h-m-p 0.2667 1.3333 0.0001 --------------N 1102.306926 0 0.0000 529 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 -----N 1102.306926 0 0.0000 551
Out..
lnL = -1102.306926
552 lfun, 2208 eigenQcodon, 9936 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1102.300475 S = -1102.300376 -0.000038
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016731 0.016262 0.104513 0.108446 0.055152 0.029438 0.000100 1.062023 1.064731
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.888207
np = 9
lnL0 = -1190.244155
Iterating by ming2
Initial: fx= 1190.244155
x= 0.01673 0.01626 0.10451 0.10845 0.05515 0.02944 0.00011 1.06202 1.06473
1 h-m-p 0.0000 0.0000 631.6162 ++ 1189.584320 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0130 68.6925 +++++ 1145.228169 m 0.0130 29 | 2/9
3 h-m-p 0.0000 0.0000 276.8350 ++ 1144.884502 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0024 51.8655 ++++ 1137.624515 m 0.0024 55 | 4/9
5 h-m-p 0.0000 0.0000 153.0953 ++ 1134.712005 m 0.0000 67 | 5/9
6 h-m-p 0.0001 0.0082 62.3349 ++++ 1125.246585 m 0.0082 81 | 6/9
7 h-m-p 0.0002 0.0009 552.5146 ++ 1102.306996 m 0.0009 93 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 -----Y 1102.306996 0 0.0004 110 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 1102.306996 m 8.0000 127 | 7/9
10 h-m-p 0.0001 0.0475 30.5030 ++++
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
+ 1102.306969 m 0.0475 144
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
N 1102.306969 0 1.6000 156
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18181, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18157, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
12 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
N 1102.306969 0 0.0160 170
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1102.306969
171 lfun, 1881 eigenQcodon, 10260 P(t)
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18169, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102009 0.069510 0.108324 0.067000 0.045528 0.024043 0.000100 0.900000 0.580634 1.013352 1.439112
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.499893
np = 11
lnL0 = -1207.214379
Iterating by ming2
Initial: fx= 1207.214379
x= 0.10201 0.06951 0.10832 0.06700 0.04553 0.02404 0.00011 0.90000 0.58063 1.01335 1.43911
1 h-m-p 0.0000 0.0000 566.4410 ++ 1206.897042 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 260.6286 ++++ 1170.717133 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0002 423.8801 ++ 1144.436000 m 0.0002 46 | 3/11
4 h-m-p 0.0003 0.0015 183.9243 ++ 1120.336052 m 0.0015 60 | 4/11
5 h-m-p 0.0000 0.0000 33473.7823 ++ 1118.339648 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 18920.7183 ++ 1111.159623 m 0.0000 88 | 6/11
7 h-m-p 0.0028 0.0138 7.6939 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 371.1814 ++ 1103.582165 m 0.0001 126 | 7/11
9 h-m-p 0.0016 0.0337 8.7229 -----------.. | 7/11
10 h-m-p 0.0000 0.0000 274.0634 ++ 1102.306999 m 0.0000 163 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1102.306999 m 8.0000 180 | 8/11
12 h-m-p 0.0153 7.6351 0.1130 -------C 1102.306999 0 0.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0002 +++++ 1102.306999 m 8.0000 224 | 8/11
14 h-m-p 0.0050 2.2418 0.3525 ++++C 1102.306992 0 1.3970 245 | 8/11
15 h-m-p 1.6000 8.0000 0.0015 Y 1102.306992 0 1.2358 262 | 8/11
16 h-m-p 1.6000 8.0000 0.0000 C 1102.306992 0 1.6000 279 | 8/11
17 h-m-p 1.6000 8.0000 0.0000 ++ 1102.306992 m 8.0000 296 | 8/11
18 h-m-p 0.2517 8.0000 0.0005 ++Y 1102.306992 0 2.9179 315 | 8/11
19 h-m-p 1.6000 8.0000 0.0001 ++ 1102.306992 m 8.0000 332 | 8/11
20 h-m-p 0.0932 8.0000 0.0064 ++Y 1102.306992 0 3.3247 351 | 8/11
21 h-m-p 1.6000 8.0000 0.0001 ++ 1102.306992 m 8.0000 368 | 8/11
22 h-m-p 0.0050 2.4927 0.8339 +++++ 1102.306941 m 2.4927 388 | 9/11
23 h-m-p 1.6000 8.0000 0.2962
QuantileBeta(0.15, 0.00500, 2.33771) = 1.106836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.97129) = 8.275777e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
+ 1102.306935 m 8.0000 405
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.898738e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18263) = 7.631887e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18234) = 7.632707e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18249) = 7.632297e-161 2000 rounds
| 9/11
24 h-m-p 1.6000 8.0000 1.4072
QuantileBeta(0.15, 0.00500, 4.18592) = 5.570535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19620) = 3.073675e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
+ 1102.306929 m 8.0000 421
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.767182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19964) = 2.673838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
| 9/11
25 h-m-p 1.6000 8.0000 0.4074
QuantileBeta(0.15, 0.00500, 8.49012) = 2.576788e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.36159) = 2.323736e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
+ 1102.306928 m 8.0000 435
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.328624e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65235) = 2.250007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65180) = 2.250141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
| 9/11
26 h-m-p 0.5952 3.5116 5.4756
QuantileBeta(0.15, 0.00500, 8.19963) = 2.673839e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.28896) = 2.342910e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.56130) = 2.272587e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.62938) = 2.255661e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.64640) = 2.251468e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65066) = 2.250423e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65172) = 2.250161e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65199) = 2.250096e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65205) = 2.250080e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250076e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
Y 1102.306928 0 0.0000 460
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.328624e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
| 9/11
27 h-m-p 0.3528 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 9.65208) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
Y 1102.306928 0 0.0399 475
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.328624e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65235) = 2.250007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65180) = 2.250141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
| 9/11
28 h-m-p 0.5366 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
C 1102.306928 0 0.0001 496
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
Out..
lnL = -1102.306928
497 lfun, 5964 eigenQcodon, 32802 P(t)
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1102.301601 S = -1102.300462 -0.000498
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:15
did 20 / 54 patterns 0:16
did 30 / 54 patterns 0:16
did 40 / 54 patterns 0:16
did 50 / 54 patterns 0:16
did 54 / 54 patterns 0:16
QuantileBeta(0.15, 0.00500, 9.65207) = 2.250074e-161 2000 rounds
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=280
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
NC_002677_1_NP_302262_1_1134_rplB MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
**************************************************
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
NC_002677_1_NP_302262_1_1134_rplB TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
**************************************************
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
NC_002677_1_NP_302262_1_1134_rplB KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
**************************************************
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
NC_002677_1_NP_302262_1_1134_rplB GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
**************************************************
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
NC_002677_1_NP_302262_1_1134_rplB QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
**************************************************
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
NC_002677_1_NP_302262_1_1134_rplB GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
******************************
>NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC >NC_002677_1_NP_302262_1_1134_rplB ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC >NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC >NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC >NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC >NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>NC_011896_1_WP_010908583_1_1987_MLBR_RS09430 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR >NC_002677_1_NP_302262_1_1134_rplB MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR >NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR >NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR >NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR >NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500 MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
#NEXUS
[ID: 0088792756]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908583_1_1987_MLBR_RS09430
NC_002677_1_NP_302262_1_1134_rplB
NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585
NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205
NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230
NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908583_1_1987_MLBR_RS09430,
2 NC_002677_1_NP_302262_1_1134_rplB,
3 NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585,
4 NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205,
5 NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230,
6 NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0724785,2:0.07397914,3:0.06654214,4:0.0690742,5:0.06913746,6:0.07272478);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0724785,2:0.07397914,3:0.06654214,4:0.0690742,5:0.06913746,6:0.07272478);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1142.67 -1146.93
2 -1142.59 -1145.54
--------------------------------------
TOTAL -1142.63 -1146.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902623 0.092882 0.338260 1.481872 0.866229 1491.17 1496.09 1.000
r(A<->C){all} 0.166079 0.017745 0.000070 0.424695 0.133625 160.21 213.93 1.003
r(A<->G){all} 0.165586 0.020117 0.000084 0.454654 0.127678 181.04 252.45 1.000
r(A<->T){all} 0.168173 0.019518 0.000097 0.448653 0.130654 239.10 265.06 1.002
r(C<->G){all} 0.163814 0.019007 0.000004 0.438611 0.131341 254.10 286.63 1.000
r(C<->T){all} 0.161809 0.018535 0.000015 0.446895 0.126397 175.45 226.66 1.000
r(G<->T){all} 0.174540 0.021992 0.000067 0.480947 0.134218 171.30 175.13 1.000
pi(A){all} 0.210318 0.000190 0.182302 0.236827 0.209865 1405.05 1418.04 1.000
pi(C){all} 0.296409 0.000244 0.264128 0.325182 0.296460 1106.65 1126.28 1.000
pi(G){all} 0.316621 0.000251 0.287801 0.349513 0.316308 1219.62 1228.95 1.000
pi(T){all} 0.176653 0.000171 0.151377 0.201796 0.176510 1249.10 1323.81 1.000
alpha{1,2} 0.427800 0.235244 0.000102 1.418501 0.252252 1282.42 1299.71 1.000
alpha{3} 0.462521 0.246342 0.000342 1.436230 0.304922 949.34 1016.57 1.004
pinvar{all} 0.998160 0.000005 0.994026 0.999998 0.998861 981.81 1147.55 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 280
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 4 4 4 4 4 4 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 3 3 3 3 3 3 | Arg CGT 10 10 10 10 10 10
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 9 9 9 9 9 9 | CGC 15 15 15 15 15 15
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 3 3 3 3 3 3 | CCG 10 10 10 10 10 10 | CAG 3 3 3 3 3 3 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 11 11 11 11 11 11 | ACC 6 6 6 6 6 6 | AAC 13 13 13 13 13 13 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 3 3 3 3 3 3 | AAG 17 17 17 17 17 17 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 19 19 19 19 19 19
GTC 9 9 9 9 9 9 | GCC 10 10 10 10 10 10 | GAC 6 6 6 6 6 6 | GGC 14 14 14 14 14 14
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 6 6 6 6 6 6 | GAG 8 8 8 8 8 8 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908583_1_1987_MLBR_RS09430
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
#2: NC_002677_1_NP_302262_1_1134_rplB
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
#3: NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
#4: NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
#5: NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
#6: NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 24 | TGC 6
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 48 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 18 | Arg R CGT 60
CTC 24 | CCC 6 | CAC 54 | CGC 90
CTA 0 | CCA 12 | Gln Q CAA 6 | CGA 18
CTG 18 | CCG 60 | CAG 18 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 12 | Ser S AGT 18
ATC 66 | ACC 36 | AAC 78 | AGC 18
ATA 0 | ACA 12 | Lys K AAA 30 | Arg R AGA 0
Met M ATG 30 | ACG 18 | AAG 102 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 114
GTC 54 | GCC 60 | GAC 36 | GGC 84
GTA 6 | GCA 18 | Glu E GAA 12 | GGA 6
GTG 36 | GCG 36 | GAG 48 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11429 C:0.26786 A:0.27143 G:0.34643
position 2: T:0.20000 C:0.22857 A:0.28214 G:0.28929
position 3: T:0.21429 C:0.39643 A:0.07500 G:0.31429
Average T:0.17619 C:0.29762 A:0.20952 G:0.31667
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1102.306957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.439112
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908583_1_1987_MLBR_RS09430: 0.000004, NC_002677_1_NP_302262_1_1134_rplB: 0.000004, NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585: 0.000004, NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205: 0.000004, NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230: 0.000004, NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.43911
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
7..2 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
7..3 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
7..4 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
7..5 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
7..6 0.000 690.2 149.8 1.4391 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1102.306969 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.416109
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908583_1_1987_MLBR_RS09430: 0.000004, NC_002677_1_NP_302262_1_1134_rplB: 0.000004, NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585: 0.000004, NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205: 0.000004, NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230: 0.000004, NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.41611 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1102.306926 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 161.316683
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908583_1_1987_MLBR_RS09430: 0.000004, NC_002677_1_NP_302262_1_1134_rplB: 0.000004, NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585: 0.000004, NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205: 0.000004, NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230: 0.000004, NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 161.31668
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
7..2 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
7..3 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
7..4 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
7..5 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
7..6 0.000 690.2 149.8 161.3167 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908583_1_1987_MLBR_RS09430)
Pr(w>1) post mean +- SE for w
1 M 1.000** 161.317
2 A 1.000** 161.317
3 I 1.000** 161.317
4 R 1.000** 161.317
5 K 1.000** 161.317
6 Y 1.000** 161.317
7 K 1.000** 161.317
8 P 1.000** 161.317
9 T 1.000** 161.317
10 T 1.000** 161.317
11 S 1.000** 161.317
12 G 1.000** 161.317
13 R 1.000** 161.317
14 R 1.000** 161.317
15 G 1.000** 161.317
16 A 1.000** 161.317
17 S 1.000** 161.317
18 V 1.000** 161.317
19 S 1.000** 161.317
20 D 1.000** 161.317
21 F 1.000** 161.317
22 T 1.000** 161.317
23 D 1.000** 161.317
24 I 1.000** 161.317
25 T 1.000** 161.317
26 R 1.000** 161.317
27 T 1.000** 161.317
28 K 1.000** 161.317
29 P 1.000** 161.317
30 E 1.000** 161.317
31 K 1.000** 161.317
32 A 1.000** 161.317
33 L 1.000** 161.317
34 M 1.000** 161.317
35 R 1.000** 161.317
36 S 1.000** 161.317
37 L 1.000** 161.317
38 H 1.000** 161.317
39 G 1.000** 161.317
40 H 1.000** 161.317
41 G 1.000** 161.317
42 G 1.000** 161.317
43 R 1.000** 161.317
44 N 1.000** 161.317
45 V 1.000** 161.317
46 H 1.000** 161.317
47 G 1.000** 161.317
48 R 1.000** 161.317
49 I 1.000** 161.317
50 T 1.000** 161.317
51 T 1.000** 161.317
52 R 1.000** 161.317
53 H 1.000** 161.317
54 K 1.000** 161.317
55 G 1.000** 161.317
56 G 1.000** 161.317
57 G 1.000** 161.317
58 H 1.000** 161.317
59 K 1.000** 161.317
60 R 1.000** 161.317
61 A 1.000** 161.317
62 Y 1.000** 161.317
63 R 1.000** 161.317
64 L 1.000** 161.317
65 I 1.000** 161.317
66 D 1.000** 161.317
67 F 1.000** 161.317
68 R 1.000** 161.317
69 R 1.000** 161.317
70 N 1.000** 161.317
71 D 1.000** 161.317
72 T 1.000** 161.317
73 D 1.000** 161.317
74 G 1.000** 161.317
75 V 1.000** 161.317
76 N 1.000** 161.317
77 A 1.000** 161.317
78 K 1.000** 161.317
79 V 1.000** 161.317
80 A 1.000** 161.317
81 H 1.000** 161.317
82 I 1.000** 161.317
83 E 1.000** 161.317
84 Y 1.000** 161.317
85 D 1.000** 161.317
86 P 1.000** 161.317
87 N 1.000** 161.317
88 R 1.000** 161.317
89 T 1.000** 161.317
90 A 1.000** 161.317
91 N 1.000** 161.317
92 I 1.000** 161.317
93 A 1.000** 161.317
94 L 1.000** 161.317
95 L 1.000** 161.317
96 H 1.000** 161.317
97 F 1.000** 161.317
98 L 1.000** 161.317
99 D 1.000** 161.317
100 G 1.000** 161.317
101 K 1.000** 161.317
102 K 1.000** 161.317
103 R 1.000** 161.317
104 Y 1.000** 161.317
105 I 1.000** 161.317
106 L 1.000** 161.317
107 A 1.000** 161.317
108 P 1.000** 161.317
109 Q 1.000** 161.317
110 G 1.000** 161.317
111 L 1.000** 161.317
112 S 1.000** 161.317
113 Q 1.000** 161.317
114 G 1.000** 161.317
115 D 1.000** 161.317
116 V 1.000** 161.317
117 V 1.000** 161.317
118 E 1.000** 161.317
119 S 1.000** 161.317
120 G 1.000** 161.317
121 A 1.000** 161.317
122 N 1.000** 161.317
123 A 1.000** 161.317
124 D 1.000** 161.317
125 I 1.000** 161.317
126 K 1.000** 161.317
127 P 1.000** 161.317
128 G 1.000** 161.317
129 N 1.000** 161.317
130 N 1.000** 161.317
131 L 1.000** 161.317
132 P 1.000** 161.317
133 L 1.000** 161.317
134 R 1.000** 161.317
135 N 1.000** 161.317
136 I 1.000** 161.317
137 P 1.000** 161.317
138 A 1.000** 161.317
139 G 1.000** 161.317
140 T 1.000** 161.317
141 L 1.000** 161.317
142 I 1.000** 161.317
143 H 1.000** 161.317
144 A 1.000** 161.317
145 V 1.000** 161.317
146 E 1.000** 161.317
147 L 1.000** 161.317
148 R 1.000** 161.317
149 P 1.000** 161.317
150 G 1.000** 161.317
151 G 1.000** 161.317
152 G 1.000** 161.317
153 A 1.000** 161.317
154 K 1.000** 161.317
155 L 1.000** 161.317
156 A 1.000** 161.317
157 R 1.000** 161.317
158 S 1.000** 161.317
159 A 1.000** 161.317
160 G 1.000** 161.317
161 S 1.000** 161.317
162 S 1.000** 161.317
163 I 1.000** 161.317
164 Q 1.000** 161.317
165 L 1.000** 161.317
166 L 1.000** 161.317
167 G 1.000** 161.317
168 K 1.000** 161.317
169 E 1.000** 161.317
170 S 1.000** 161.317
171 S 1.000** 161.317
172 Y 1.000** 161.317
173 A 1.000** 161.317
174 S 1.000** 161.317
175 L 1.000** 161.317
176 R 1.000** 161.317
177 M 1.000** 161.317
178 P 1.000** 161.317
179 S 1.000** 161.317
180 G 1.000** 161.317
181 E 1.000** 161.317
182 I 1.000** 161.317
183 R 1.000** 161.317
184 R 1.000** 161.317
185 V 1.000** 161.317
186 D 1.000** 161.317
187 V 1.000** 161.317
188 R 1.000** 161.317
189 C 1.000** 161.317
190 R 1.000** 161.317
191 A 1.000** 161.317
192 T 1.000** 161.317
193 V 1.000** 161.317
194 G 1.000** 161.317
195 E 1.000** 161.317
196 V 1.000** 161.317
197 G 1.000** 161.317
198 N 1.000** 161.317
199 A 1.000** 161.317
200 E 1.000** 161.317
201 Q 1.000** 161.317
202 A 1.000** 161.317
203 N 1.000** 161.317
204 I 1.000** 161.317
205 N 1.000** 161.317
206 W 1.000** 161.317
207 G 1.000** 161.317
208 K 1.000** 161.317
209 A 1.000** 161.317
210 G 1.000** 161.317
211 R 1.000** 161.317
212 M 1.000** 161.317
213 R 1.000** 161.317
214 W 1.000** 161.317
215 K 1.000** 161.317
216 G 1.000** 161.317
217 K 1.000** 161.317
218 R 1.000** 161.317
219 P 1.000** 161.317
220 S 1.000** 161.317
221 V 1.000** 161.317
222 R 1.000** 161.317
223 G 1.000** 161.317
224 V 1.000** 161.317
225 V 1.000** 161.317
226 M 1.000** 161.317
227 N 1.000** 161.317
228 P 1.000** 161.317
229 V 1.000** 161.317
230 D 1.000** 161.317
231 H 1.000** 161.317
232 P 1.000** 161.317
233 H 1.000** 161.317
234 G 1.000** 161.317
235 G 1.000** 161.317
236 G 1.000** 161.317
237 E 1.000** 161.317
238 G 1.000** 161.317
239 K 1.000** 161.317
240 T 1.000** 161.317
241 S 1.000** 161.317
242 G 1.000** 161.317
243 G 1.000** 161.317
244 R 1.000** 161.317
245 H 1.000** 161.317
246 P 1.000** 161.317
247 V 1.000** 161.317
248 S 1.000** 161.317
249 P 1.000** 161.317
250 W 1.000** 161.317
251 G 1.000** 161.317
252 K 1.000** 161.317
253 P 1.000** 161.317
254 E 1.000** 161.317
255 G 1.000** 161.317
256 R 1.000** 161.317
257 T 1.000** 161.317
258 R 1.000** 161.317
259 K 1.000** 161.317
260 P 1.000** 161.317
261 N 1.000** 161.317
262 K 1.000** 161.317
263 S 1.000** 161.317
264 S 1.000** 161.317
265 N 1.000** 161.317
266 K 1.000** 161.317
267 L 1.000** 161.317
268 I 1.000** 161.317
269 V 1.000** 161.317
270 R 1.000** 161.317
271 R 1.000** 161.317
272 R 1.000** 161.317
273 R 1.000** 161.317
274 T 1.000** 161.317
275 G 1.000** 161.317
276 K 1.000** 161.317
277 K 1.000** 161.317
278 H 1.000** 161.317
279 A 1.000** 161.317
280 R 1.000** 161.317
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908583_1_1987_MLBR_RS09430)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1102.306969 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 2.181688 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908583_1_1987_MLBR_RS09430: 0.000004, NC_002677_1_NP_302262_1_1134_rplB: 0.000004, NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585: 0.000004, NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205: 0.000004, NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230: 0.000004, NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 2.18169 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 690.2 149.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1102.306928 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 9.652075 18.213356
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908583_1_1987_MLBR_RS09430: 0.000004, NC_002677_1_NP_302262_1_1134_rplB: 0.000004, NZ_LVXE01000034_1_WP_010908583_1_1548_A3216_RS09585: 0.000004, NZ_LYPH01000037_1_WP_010908583_1_1504_A8144_RS07205: 0.000004, NZ_CP029543_1_WP_010908583_1_2010_DIJ64_RS10230: 0.000004, NZ_AP014567_1_WP_010908583_1_2064_JK2ML_RS10500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 9.65207
(p1 = 0.99999) w = 18.21336
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 18.21336
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
7..2 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
7..3 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
7..4 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
7..5 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
7..6 0.000 690.2 149.8 18.2132 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908583_1_1987_MLBR_RS09430)
Pr(w>1) post mean +- SE for w
1 M 1.000** 18.213
2 A 1.000** 18.213
3 I 1.000** 18.213
4 R 1.000** 18.213
5 K 1.000** 18.213
6 Y 1.000** 18.213
7 K 1.000** 18.213
8 P 1.000** 18.213
9 T 1.000** 18.213
10 T 1.000** 18.213
11 S 1.000** 18.213
12 G 1.000** 18.213
13 R 1.000** 18.213
14 R 1.000** 18.213
15 G 1.000** 18.213
16 A 1.000** 18.213
17 S 1.000** 18.213
18 V 1.000** 18.213
19 S 1.000** 18.213
20 D 1.000** 18.213
21 F 1.000** 18.213
22 T 1.000** 18.213
23 D 1.000** 18.213
24 I 1.000** 18.213
25 T 1.000** 18.213
26 R 1.000** 18.213
27 T 1.000** 18.213
28 K 1.000** 18.213
29 P 1.000** 18.213
30 E 1.000** 18.213
31 K 1.000** 18.213
32 A 1.000** 18.213
33 L 1.000** 18.213
34 M 1.000** 18.213
35 R 1.000** 18.213
36 S 1.000** 18.213
37 L 1.000** 18.213
38 H 1.000** 18.213
39 G 1.000** 18.213
40 H 1.000** 18.213
41 G 1.000** 18.213
42 G 1.000** 18.213
43 R 1.000** 18.213
44 N 1.000** 18.213
45 V 1.000** 18.213
46 H 1.000** 18.213
47 G 1.000** 18.213
48 R 1.000** 18.213
49 I 1.000** 18.213
50 T 1.000** 18.213
51 T 1.000** 18.213
52 R 1.000** 18.213
53 H 1.000** 18.213
54 K 1.000** 18.213
55 G 1.000** 18.213
56 G 1.000** 18.213
57 G 1.000** 18.213
58 H 1.000** 18.213
59 K 1.000** 18.213
60 R 1.000** 18.213
61 A 1.000** 18.213
62 Y 1.000** 18.213
63 R 1.000** 18.213
64 L 1.000** 18.213
65 I 1.000** 18.213
66 D 1.000** 18.213
67 F 1.000** 18.213
68 R 1.000** 18.213
69 R 1.000** 18.213
70 N 1.000** 18.213
71 D 1.000** 18.213
72 T 1.000** 18.213
73 D 1.000** 18.213
74 G 1.000** 18.213
75 V 1.000** 18.213
76 N 1.000** 18.213
77 A 1.000** 18.213
78 K 1.000** 18.213
79 V 1.000** 18.213
80 A 1.000** 18.213
81 H 1.000** 18.213
82 I 1.000** 18.213
83 E 1.000** 18.213
84 Y 1.000** 18.213
85 D 1.000** 18.213
86 P 1.000** 18.213
87 N 1.000** 18.213
88 R 1.000** 18.213
89 T 1.000** 18.213
90 A 1.000** 18.213
91 N 1.000** 18.213
92 I 1.000** 18.213
93 A 1.000** 18.213
94 L 1.000** 18.213
95 L 1.000** 18.213
96 H 1.000** 18.213
97 F 1.000** 18.213
98 L 1.000** 18.213
99 D 1.000** 18.213
100 G 1.000** 18.213
101 K 1.000** 18.213
102 K 1.000** 18.213
103 R 1.000** 18.213
104 Y 1.000** 18.213
105 I 1.000** 18.213
106 L 1.000** 18.213
107 A 1.000** 18.213
108 P 1.000** 18.213
109 Q 1.000** 18.213
110 G 1.000** 18.213
111 L 1.000** 18.213
112 S 1.000** 18.213
113 Q 1.000** 18.213
114 G 1.000** 18.213
115 D 1.000** 18.213
116 V 1.000** 18.213
117 V 1.000** 18.213
118 E 1.000** 18.213
119 S 1.000** 18.213
120 G 1.000** 18.213
121 A 1.000** 18.213
122 N 1.000** 18.213
123 A 1.000** 18.213
124 D 1.000** 18.213
125 I 1.000** 18.213
126 K 1.000** 18.213
127 P 1.000** 18.213
128 G 1.000** 18.213
129 N 1.000** 18.213
130 N 1.000** 18.213
131 L 1.000** 18.213
132 P 1.000** 18.213
133 L 1.000** 18.213
134 R 1.000** 18.213
135 N 1.000** 18.213
136 I 1.000** 18.213
137 P 1.000** 18.213
138 A 1.000** 18.213
139 G 1.000** 18.213
140 T 1.000** 18.213
141 L 1.000** 18.213
142 I 1.000** 18.213
143 H 1.000** 18.213
144 A 1.000** 18.213
145 V 1.000** 18.213
146 E 1.000** 18.213
147 L 1.000** 18.213
148 R 1.000** 18.213
149 P 1.000** 18.213
150 G 1.000** 18.213
151 G 1.000** 18.213
152 G 1.000** 18.213
153 A 1.000** 18.213
154 K 1.000** 18.213
155 L 1.000** 18.213
156 A 1.000** 18.213
157 R 1.000** 18.213
158 S 1.000** 18.213
159 A 1.000** 18.213
160 G 1.000** 18.213
161 S 1.000** 18.213
162 S 1.000** 18.213
163 I 1.000** 18.213
164 Q 1.000** 18.213
165 L 1.000** 18.213
166 L 1.000** 18.213
167 G 1.000** 18.213
168 K 1.000** 18.213
169 E 1.000** 18.213
170 S 1.000** 18.213
171 S 1.000** 18.213
172 Y 1.000** 18.213
173 A 1.000** 18.213
174 S 1.000** 18.213
175 L 1.000** 18.213
176 R 1.000** 18.213
177 M 1.000** 18.213
178 P 1.000** 18.213
179 S 1.000** 18.213
180 G 1.000** 18.213
181 E 1.000** 18.213
182 I 1.000** 18.213
183 R 1.000** 18.213
184 R 1.000** 18.213
185 V 1.000** 18.213
186 D 1.000** 18.213
187 V 1.000** 18.213
188 R 1.000** 18.213
189 C 1.000** 18.213
190 R 1.000** 18.213
191 A 1.000** 18.213
192 T 1.000** 18.213
193 V 1.000** 18.213
194 G 1.000** 18.213
195 E 1.000** 18.213
196 V 1.000** 18.213
197 G 1.000** 18.213
198 N 1.000** 18.213
199 A 1.000** 18.213
200 E 1.000** 18.213
201 Q 1.000** 18.213
202 A 1.000** 18.213
203 N 1.000** 18.213
204 I 1.000** 18.213
205 N 1.000** 18.213
206 W 1.000** 18.213
207 G 1.000** 18.213
208 K 1.000** 18.213
209 A 1.000** 18.213
210 G 1.000** 18.213
211 R 1.000** 18.213
212 M 1.000** 18.213
213 R 1.000** 18.213
214 W 1.000** 18.213
215 K 1.000** 18.213
216 G 1.000** 18.213
217 K 1.000** 18.213
218 R 1.000** 18.213
219 P 1.000** 18.213
220 S 1.000** 18.213
221 V 1.000** 18.213
222 R 1.000** 18.213
223 G 1.000** 18.213
224 V 1.000** 18.213
225 V 1.000** 18.213
226 M 1.000** 18.213
227 N 1.000** 18.213
228 P 1.000** 18.213
229 V 1.000** 18.213
230 D 1.000** 18.213
231 H 1.000** 18.213
232 P 1.000** 18.213
233 H 1.000** 18.213
234 G 1.000** 18.213
235 G 1.000** 18.213
236 G 1.000** 18.213
237 E 1.000** 18.213
238 G 1.000** 18.213
239 K 1.000** 18.213
240 T 1.000** 18.213
241 S 1.000** 18.213
242 G 1.000** 18.213
243 G 1.000** 18.213
244 R 1.000** 18.213
245 H 1.000** 18.213
246 P 1.000** 18.213
247 V 1.000** 18.213
248 S 1.000** 18.213
249 P 1.000** 18.213
250 W 1.000** 18.213
251 G 1.000** 18.213
252 K 1.000** 18.213
253 P 1.000** 18.213
254 E 1.000** 18.213
255 G 1.000** 18.213
256 R 1.000** 18.213
257 T 1.000** 18.213
258 R 1.000** 18.213
259 K 1.000** 18.213
260 P 1.000** 18.213
261 N 1.000** 18.213
262 K 1.000** 18.213
263 S 1.000** 18.213
264 S 1.000** 18.213
265 N 1.000** 18.213
266 K 1.000** 18.213
267 L 1.000** 18.213
268 I 1.000** 18.213
269 V 1.000** 18.213
270 R 1.000** 18.213
271 R 1.000** 18.213
272 R 1.000** 18.213
273 R 1.000** 18.213
274 T 1.000** 18.213
275 G 1.000** 18.213
276 K 1.000** 18.213
277 K 1.000** 18.213
278 H 1.000** 18.213
279 A 1.000** 18.213
280 R 1.000** 18.213
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908583_1_1987_MLBR_RS09430)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -1102.306969 Model 2: PositiveSelection -1102.306926 Model 0: one-ratio -1102.306957 Model 7: beta -1102.306969 Model 8: beta&w>1 -1102.306928 Model 0 vs 1 2.3999999939405825E-5 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 8.200000002034358E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
