--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:31:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1142.67         -1146.93
2      -1142.59         -1145.54
--------------------------------------
TOTAL    -1142.63         -1146.46
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.902623    0.092882    0.338260    1.481872    0.866229   1491.17   1496.09    1.000
r(A<->C){all}   0.166079    0.017745    0.000070    0.424695    0.133625    160.21    213.93    1.003
r(A<->G){all}   0.165586    0.020117    0.000084    0.454654    0.127678    181.04    252.45    1.000
r(A<->T){all}   0.168173    0.019518    0.000097    0.448653    0.130654    239.10    265.06    1.002
r(C<->G){all}   0.163814    0.019007    0.000004    0.438611    0.131341    254.10    286.63    1.000
r(C<->T){all}   0.161809    0.018535    0.000015    0.446895    0.126397    175.45    226.66    1.000
r(G<->T){all}   0.174540    0.021992    0.000067    0.480947    0.134218    171.30    175.13    1.000
pi(A){all}      0.210318    0.000190    0.182302    0.236827    0.209865   1405.05   1418.04    1.000
pi(C){all}      0.296409    0.000244    0.264128    0.325182    0.296460   1106.65   1126.28    1.000
pi(G){all}      0.316621    0.000251    0.287801    0.349513    0.316308   1219.62   1228.95    1.000
pi(T){all}      0.176653    0.000171    0.151377    0.201796    0.176510   1249.10   1323.81    1.000
alpha{1,2}      0.427800    0.235244    0.000102    1.418501    0.252252   1282.42   1299.71    1.000
alpha{3}        0.462521    0.246342    0.000342    1.436230    0.304922    949.34   1016.57    1.004
pinvar{all}     0.998160    0.000005    0.994026    0.999998    0.998861    981.81   1147.55    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1102.306969
Model 2: PositiveSelection	-1102.306926
Model 0: one-ratio	-1102.306957
Model 7: beta	-1102.306969
Model 8: beta&w>1	-1102.306928


Model 0 vs 1	2.3999999939405825E-5

Model 2 vs 1	8.600000001024455E-5

Model 8 vs 7	8.200000002034358E-5
>C1
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C2
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C3
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C4
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C5
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C6
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=280 

C1              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C2              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C3              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C4              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C5              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C6              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
                **************************************************

C1              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C2              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C3              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C4              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C5              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C6              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
                **************************************************

C1              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C2              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C3              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C4              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C5              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C6              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
                **************************************************

C1              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C2              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C3              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C4              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C5              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C6              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
                **************************************************

C1              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C2              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C3              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C4              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C5              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C6              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
                **************************************************

C1              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C2              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C3              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C4              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C5              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C6              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
                ******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  280 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  280 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8400]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8400]--->[8400]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.486 Mb, Max= 30.823 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C2              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C3              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C4              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C5              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
C6              MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
                **************************************************

C1              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C2              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C3              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C4              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C5              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
C6              TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
                **************************************************

C1              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C2              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C3              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C4              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C5              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
C6              KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
                **************************************************

C1              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C2              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C3              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C4              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C5              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
C6              GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
                **************************************************

C1              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C2              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C3              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C4              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C5              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
C6              QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
                **************************************************

C1              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C2              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C3              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C4              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C5              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
C6              GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
                ******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C2              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C3              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C4              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C5              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
C6              ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
                **************************************************

C1              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C2              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C3              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C4              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C5              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
C6              TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
                **************************************************

C1              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C2              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C3              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C4              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C5              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
C6              TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
                **************************************************

C1              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C2              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C3              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C4              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C5              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
C6              ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
                **************************************************

C1              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C2              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C3              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C4              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C5              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
C6              CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
                **************************************************

C1              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C2              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C3              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C4              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C5              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
C6              ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
                **************************************************

C1              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C2              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C3              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C4              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C5              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
C6              AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
                **************************************************

C1              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C2              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C3              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C4              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C5              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
C6              GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
                **************************************************

C1              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C2              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C3              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C4              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C5              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
C6              GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
                **************************************************

C1              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C2              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C3              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C4              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C5              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
C6              GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
                **************************************************

C1              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C2              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C3              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C4              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C5              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
C6              CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
                **************************************************

C1              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C2              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C3              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C4              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C5              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
C6              GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
                **************************************************

C1              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C2              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C3              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C4              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C5              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
C6              CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
                **************************************************

C1              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C2              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C3              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C4              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C5              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
C6              GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
                **************************************************

C1              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C2              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C3              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C4              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C5              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
C6              GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
                **************************************************

C1              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C2              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C3              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C4              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C5              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
C6              GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
                **************************************************

C1              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C2              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C3              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C4              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C5              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
C6              GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
                ****************************************



>C1
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C2
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C3
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C4
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C5
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C6
ATGGCAATTCGCAAGTACAAGCCGACGACTTCCGGTCGTCGTGGCGCCAG
TGTGTCTGATTTCACCGACATCACTCGTACGAAGCCGGAGAAGGCGTTGA
TGCGTTCGCTGCACGGCCATGGTGGGCGCAACGTCCACGGCCGGATCACC
ACTCGCCACAAGGGCGGTGGCCATAAGCGCGCCTACCGGTTGATCGATTT
CCGCCGCAACGACACAGACGGTGTCAACGCCAAGGTCGCGCACATTGAAT
ATGATCCGAACCGCACAGCGAACATCGCGTTACTGCACTTCTTGGATGGC
AAGAAGCGATACATCCTTGCTCCGCAAGGACTTTCGCAGGGTGACGTGGT
GGAGTCGGGTGCTAACGCTGACATCAAGCCAGGTAACAACCTCCCGTTGC
GCAATATTCCTGCCGGTACCTTGATCCATGCCGTGGAGCTCCGGCCGGGC
GGTGGTGCCAAGCTCGCACGATCGGCCGGGTCGAGCATCCAGTTGCTCGG
CAAGGAATCCAGCTACGCCTCGTTGCGTATGCCCAGTGGTGAGATCCGGC
GGGTCGATGTGCGCTGCCGCGCGACGGTCGGTGAGGTGGGCAATGCCGAG
CAGGCAAACATCAACTGGGGCAAAGCCGGTCGTATGCGTTGGAAAGGTAA
GCGTCCGTCTGTTCGTGGTGTCGTCATGAACCCAGTAGACCACCCTCACG
GCGGTGGTGAGGGTAAGACCTCGGGTGGGCGTCACCCGGTCAGTCCGTGG
GGCAAGCCTGAGGGCCGCACCCGCAAGCCGAACAAATCGAGCAACAAACT
GATCGTCCGCCGACGGCGCACCGGCAAAAAGCACGCGCGC
>C1
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C2
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C3
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C4
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C5
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR
>C6
MAIRKYKPTTSGRRGASVSDFTDITRTKPEKALMRSLHGHGGRNVHGRIT
TRHKGGGHKRAYRLIDFRRNDTDGVNAKVAHIEYDPNRTANIALLHFLDG
KKRYILAPQGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKESSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKSSNKLIVRRRRTGKKHAR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 840 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789808
      Setting output file names to "/data/11res/rplB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 777945979
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0088792756
      Seed = 897400566
      Swapseed = 1579789808
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1879.960164 -- -24.965149
         Chain 2 -- -1879.960164 -- -24.965149
         Chain 3 -- -1879.960272 -- -24.965149
         Chain 4 -- -1879.959985 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1879.960164 -- -24.965149
         Chain 2 -- -1879.960272 -- -24.965149
         Chain 3 -- -1879.960272 -- -24.965149
         Chain 4 -- -1879.960164 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1879.960] (-1879.960) (-1879.960) (-1879.960) * [-1879.960] (-1879.960) (-1879.960) (-1879.960) 
        500 -- (-1150.988) (-1172.122) (-1173.775) [-1147.481] * (-1157.932) (-1148.809) (-1153.168) [-1148.545] -- 0:00:00
       1000 -- [-1150.330] (-1157.000) (-1153.497) (-1149.381) * (-1156.759) [-1152.448] (-1156.350) (-1150.646) -- 0:00:00
       1500 -- (-1152.290) (-1158.000) (-1148.256) [-1146.663] * (-1157.168) (-1155.100) (-1153.019) [-1147.240] -- 0:00:00
       2000 -- (-1150.104) (-1155.409) (-1161.637) [-1150.748] * (-1154.671) (-1148.812) (-1147.650) [-1151.605] -- 0:00:00
       2500 -- (-1151.616) [-1156.785] (-1157.752) (-1147.084) * (-1150.198) (-1149.082) [-1155.992] (-1151.955) -- 0:06:39
       3000 -- (-1156.528) (-1151.409) (-1153.041) [-1150.852] * [-1148.597] (-1151.729) (-1152.617) (-1155.115) -- 0:05:32
       3500 -- (-1154.965) (-1159.063) [-1147.847] (-1152.780) * [-1156.825] (-1155.039) (-1153.657) (-1159.635) -- 0:04:44
       4000 -- (-1156.129) (-1162.152) (-1149.068) [-1152.879] * (-1150.087) (-1152.751) [-1150.729] (-1153.206) -- 0:04:09
       4500 -- (-1151.256) (-1153.466) [-1149.844] (-1151.324) * (-1150.832) (-1153.017) [-1149.523] (-1154.201) -- 0:03:41
       5000 -- (-1153.903) (-1156.067) (-1151.679) [-1150.263] * (-1148.572) (-1159.249) [-1155.046] (-1152.877) -- 0:03:19

      Average standard deviation of split frequencies: 0.109311

       5500 -- (-1156.488) (-1154.987) [-1147.840] (-1157.133) * (-1155.280) (-1148.310) (-1160.432) [-1151.250] -- 0:03:00
       6000 -- (-1158.802) [-1149.742] (-1150.066) (-1162.448) * (-1149.463) (-1150.788) [-1152.929] (-1159.810) -- 0:02:45
       6500 -- (-1157.171) (-1154.362) (-1149.221) [-1156.118] * [-1160.679] (-1151.716) (-1153.730) (-1151.754) -- 0:02:32
       7000 -- (-1155.263) (-1157.910) [-1155.391] (-1150.003) * (-1153.065) [-1154.349] (-1147.986) (-1149.215) -- 0:02:21
       7500 -- (-1146.875) [-1151.785] (-1151.690) (-1154.176) * (-1152.966) [-1155.200] (-1156.552) (-1151.336) -- 0:02:12
       8000 -- (-1148.482) (-1154.056) [-1147.594] (-1158.692) * (-1153.916) (-1154.371) (-1153.960) [-1150.329] -- 0:02:04
       8500 -- (-1150.910) (-1150.861) [-1151.798] (-1159.614) * (-1160.882) (-1149.460) [-1149.182] (-1150.723) -- 0:01:56
       9000 -- (-1160.473) [-1154.525] (-1151.690) (-1148.874) * [-1153.823] (-1148.778) (-1156.887) (-1149.505) -- 0:01:50
       9500 -- (-1151.525) (-1151.134) [-1150.651] (-1156.770) * (-1153.268) [-1155.783] (-1148.180) (-1152.165) -- 0:01:44
      10000 -- (-1154.864) (-1159.465) [-1157.950] (-1155.724) * [-1146.737] (-1150.920) (-1152.693) (-1149.623) -- 0:01:39

      Average standard deviation of split frequencies: 0.081759

      10500 -- (-1150.954) [-1150.823] (-1152.962) (-1157.614) * (-1158.373) (-1156.587) (-1150.046) [-1153.378] -- 0:01:34
      11000 -- (-1158.572) [-1149.786] (-1159.316) (-1149.155) * [-1152.677] (-1156.116) (-1150.109) (-1156.710) -- 0:01:29
      11500 -- (-1153.346) (-1151.441) [-1152.712] (-1155.562) * [-1151.178] (-1153.061) (-1154.309) (-1153.853) -- 0:01:25
      12000 -- (-1153.595) [-1147.710] (-1148.697) (-1149.495) * (-1167.423) (-1162.870) [-1150.883] (-1151.074) -- 0:01:22
      12500 -- (-1156.412) [-1150.543] (-1157.880) (-1147.472) * (-1151.685) [-1148.239] (-1161.816) (-1156.665) -- 0:01:19
      13000 -- (-1162.624) (-1154.337) (-1150.429) [-1146.701] * (-1151.992) (-1148.949) (-1148.023) [-1152.629] -- 0:01:15
      13500 -- (-1153.702) [-1151.280] (-1156.044) (-1143.063) * (-1154.500) [-1152.201] (-1144.798) (-1153.581) -- 0:01:13
      14000 -- (-1147.795) (-1148.526) (-1153.568) [-1142.588] * [-1148.914] (-1155.557) (-1158.867) (-1152.498) -- 0:01:10
      14500 -- (-1151.599) (-1146.511) [-1147.224] (-1146.192) * (-1154.220) [-1153.292] (-1154.351) (-1154.641) -- 0:01:07
      15000 -- (-1153.998) [-1148.458] (-1152.907) (-1144.531) * (-1154.859) [-1159.100] (-1148.757) (-1156.992) -- 0:01:05

      Average standard deviation of split frequencies: 0.062027

      15500 -- (-1159.612) [-1153.032] (-1148.907) (-1144.353) * (-1160.621) (-1152.334) [-1148.384] (-1155.625) -- 0:01:03
      16000 -- [-1157.325] (-1152.756) (-1154.788) (-1143.977) * (-1157.444) [-1148.666] (-1152.313) (-1159.375) -- 0:01:01
      16500 -- [-1153.976] (-1149.661) (-1157.864) (-1146.367) * [-1144.644] (-1155.393) (-1154.274) (-1152.126) -- 0:00:59
      17000 -- (-1157.910) [-1154.575] (-1154.368) (-1144.190) * [-1144.424] (-1153.134) (-1151.713) (-1166.840) -- 0:00:57
      17500 -- (-1164.712) [-1154.874] (-1154.745) (-1144.306) * (-1148.128) (-1152.492) [-1154.371] (-1151.345) -- 0:00:56
      18000 -- (-1152.047) (-1158.848) (-1148.091) [-1143.013] * (-1143.877) [-1151.816] (-1156.996) (-1150.329) -- 0:01:49
      18500 -- (-1148.893) (-1152.373) [-1148.347] (-1142.040) * (-1143.000) (-1152.615) [-1148.754] (-1146.362) -- 0:01:46
      19000 -- [-1154.008] (-1149.967) (-1146.468) (-1145.743) * (-1142.837) (-1154.177) [-1148.006] (-1156.815) -- 0:01:43
      19500 -- (-1146.823) (-1150.719) (-1152.362) [-1144.163] * [-1145.356] (-1152.389) (-1156.461) (-1147.448) -- 0:01:40
      20000 -- (-1144.277) [-1150.932] (-1146.793) (-1144.778) * (-1146.424) (-1149.870) [-1163.301] (-1142.529) -- 0:01:38

      Average standard deviation of split frequencies: 0.053670

      20500 -- (-1143.296) (-1154.482) [-1145.534] (-1144.714) * (-1143.687) (-1154.164) [-1150.854] (-1141.860) -- 0:01:35
      21000 -- (-1142.858) [-1155.306] (-1151.919) (-1143.452) * [-1143.965] (-1155.405) (-1150.815) (-1142.238) -- 0:01:33
      21500 -- [-1142.534] (-1175.170) (-1151.741) (-1142.650) * (-1146.359) (-1150.380) (-1159.341) [-1142.633] -- 0:01:31
      22000 -- [-1142.737] (-1148.792) (-1148.017) (-1141.504) * (-1142.894) (-1154.225) (-1151.798) [-1145.802] -- 0:01:28
      22500 -- (-1141.576) [-1143.970] (-1154.659) (-1143.228) * (-1143.351) (-1150.400) [-1152.135] (-1147.148) -- 0:01:26
      23000 -- (-1143.511) (-1145.881) (-1154.277) [-1141.673] * [-1141.064] (-1150.238) (-1156.391) (-1143.218) -- 0:01:24
      23500 -- (-1141.972) [-1143.606] (-1156.193) (-1142.176) * [-1141.009] (-1150.196) (-1154.089) (-1146.091) -- 0:01:23
      24000 -- (-1142.712) (-1143.926) [-1149.058] (-1142.537) * (-1141.585) [-1152.479] (-1155.947) (-1142.559) -- 0:01:21
      24500 -- (-1142.895) (-1144.938) (-1148.904) [-1141.896] * (-1142.178) (-1155.426) [-1151.655] (-1141.909) -- 0:01:19
      25000 -- [-1143.895] (-1145.398) (-1153.594) (-1142.058) * [-1142.071] (-1156.735) (-1152.862) (-1143.962) -- 0:01:18

      Average standard deviation of split frequencies: 0.053486

      25500 -- (-1143.065) (-1146.398) (-1160.124) [-1142.059] * [-1141.210] (-1148.731) (-1146.236) (-1146.464) -- 0:01:16
      26000 -- (-1146.064) [-1142.361] (-1154.746) (-1145.487) * [-1141.330] (-1154.364) (-1154.072) (-1146.372) -- 0:01:14
      26500 -- (-1145.799) (-1142.022) [-1150.508] (-1145.860) * (-1141.393) (-1157.873) [-1147.274] (-1144.902) -- 0:01:13
      27000 -- (-1145.277) (-1143.908) (-1153.705) [-1146.904] * (-1141.793) (-1158.197) (-1161.479) [-1142.025] -- 0:01:12
      27500 -- (-1144.104) (-1142.786) [-1147.977] (-1146.185) * (-1142.824) (-1148.718) (-1146.776) [-1141.893] -- 0:01:10
      28000 -- (-1146.084) [-1143.303] (-1149.015) (-1143.031) * [-1141.842] (-1164.546) (-1153.705) (-1146.894) -- 0:01:09
      28500 -- [-1144.929] (-1141.639) (-1154.398) (-1142.334) * [-1141.662] (-1150.519) (-1161.331) (-1143.916) -- 0:01:08
      29000 -- (-1142.820) [-1141.845] (-1152.047) (-1142.975) * [-1144.789] (-1150.508) (-1152.872) (-1144.859) -- 0:01:06
      29500 -- (-1145.279) [-1141.518] (-1160.866) (-1143.013) * (-1142.936) (-1150.491) (-1146.152) [-1144.183] -- 0:01:05
      30000 -- (-1143.488) (-1144.305) [-1150.650] (-1143.153) * (-1142.179) (-1151.055) [-1142.419] (-1143.799) -- 0:01:04

      Average standard deviation of split frequencies: 0.042456

      30500 -- (-1145.153) (-1144.446) (-1155.788) [-1143.948] * (-1142.791) (-1150.298) (-1142.014) [-1141.644] -- 0:01:03
      31000 -- (-1141.758) [-1144.114] (-1156.005) (-1143.120) * (-1142.443) (-1159.827) [-1143.918] (-1142.258) -- 0:01:02
      31500 -- (-1142.318) [-1141.411] (-1149.488) (-1144.651) * (-1144.982) [-1148.206] (-1146.192) (-1144.672) -- 0:01:01
      32000 -- (-1145.159) (-1141.377) [-1150.781] (-1143.286) * (-1142.279) [-1152.635] (-1146.989) (-1142.198) -- 0:01:00
      32500 -- [-1144.376] (-1143.950) (-1153.585) (-1143.153) * (-1142.638) (-1154.202) [-1145.379] (-1142.892) -- 0:00:59
      33000 -- (-1145.298) (-1141.605) [-1149.821] (-1144.126) * (-1142.359) [-1150.661] (-1143.587) (-1142.147) -- 0:00:58
      33500 -- (-1142.141) (-1141.900) [-1151.824] (-1142.448) * (-1143.376) (-1149.817) (-1145.304) [-1142.288] -- 0:00:57
      34000 -- (-1145.416) (-1142.479) [-1149.117] (-1143.857) * [-1142.226] (-1147.604) (-1141.496) (-1143.427) -- 0:01:25
      34500 -- (-1144.935) (-1144.278) [-1147.927] (-1144.832) * (-1144.040) (-1163.118) (-1142.391) [-1142.418] -- 0:01:23
      35000 -- [-1141.765] (-1146.528) (-1149.445) (-1148.071) * (-1145.343) (-1154.200) [-1142.732] (-1145.512) -- 0:01:22

      Average standard deviation of split frequencies: 0.043419

      35500 -- (-1145.925) (-1146.055) [-1152.987] (-1144.687) * (-1144.502) (-1154.876) [-1144.598] (-1142.515) -- 0:01:21
      36000 -- (-1153.764) (-1145.476) (-1152.673) [-1143.579] * (-1144.414) (-1160.618) [-1146.171] (-1141.888) -- 0:01:20
      36500 -- (-1142.313) [-1144.014] (-1155.310) (-1143.174) * (-1144.544) (-1156.516) [-1142.370] (-1141.080) -- 0:01:19
      37000 -- [-1141.909] (-1142.846) (-1149.306) (-1146.098) * (-1144.927) (-1156.340) (-1141.339) [-1141.647] -- 0:01:18
      37500 -- (-1143.558) (-1142.208) [-1152.236] (-1143.414) * [-1145.056] (-1153.313) (-1145.280) (-1143.082) -- 0:01:17
      38000 -- (-1148.072) (-1141.461) [-1149.283] (-1142.995) * [-1142.313] (-1149.240) (-1144.177) (-1144.088) -- 0:01:15
      38500 -- [-1146.471] (-1142.123) (-1149.136) (-1141.498) * (-1144.946) (-1149.901) (-1144.326) [-1141.352] -- 0:01:14
      39000 -- (-1142.028) [-1142.460] (-1155.160) (-1143.852) * (-1143.384) (-1159.033) [-1145.438] (-1141.462) -- 0:01:13
      39500 -- (-1142.028) (-1143.220) [-1151.470] (-1144.706) * (-1142.967) (-1153.345) (-1142.982) [-1141.327] -- 0:01:12
      40000 -- (-1144.591) [-1142.390] (-1154.100) (-1149.421) * [-1143.696] (-1156.304) (-1142.010) (-1143.518) -- 0:01:12

      Average standard deviation of split frequencies: 0.032335

      40500 -- (-1142.268) (-1147.432) [-1150.115] (-1145.127) * (-1141.768) (-1151.440) [-1145.119] (-1143.188) -- 0:01:11
      41000 -- (-1143.817) (-1143.896) [-1148.305] (-1144.151) * (-1145.716) [-1147.340] (-1143.251) (-1143.468) -- 0:01:10
      41500 -- [-1143.806] (-1143.367) (-1161.314) (-1143.247) * [-1143.553] (-1152.542) (-1142.522) (-1142.438) -- 0:01:09
      42000 -- (-1142.673) (-1142.444) (-1159.143) [-1142.737] * [-1145.666] (-1152.269) (-1142.800) (-1142.044) -- 0:01:08
      42500 -- (-1142.118) (-1145.014) (-1161.637) [-1143.490] * [-1142.699] (-1155.046) (-1144.002) (-1144.727) -- 0:01:07
      43000 -- (-1143.352) (-1145.297) [-1152.651] (-1146.162) * (-1144.694) [-1146.651] (-1145.930) (-1144.750) -- 0:01:06
      43500 -- (-1144.921) (-1146.447) [-1154.936] (-1143.344) * (-1144.501) (-1151.865) (-1143.067) [-1143.696] -- 0:01:05
      44000 -- (-1142.354) (-1145.107) [-1146.093] (-1147.170) * [-1147.044] (-1160.665) (-1143.453) (-1143.129) -- 0:01:05
      44500 -- (-1142.354) [-1148.368] (-1153.076) (-1145.904) * [-1143.128] (-1152.846) (-1144.658) (-1143.649) -- 0:01:04
      45000 -- (-1145.698) (-1146.137) (-1157.411) [-1148.496] * (-1145.157) (-1150.433) (-1143.705) [-1143.586] -- 0:01:03

      Average standard deviation of split frequencies: 0.024222

      45500 -- [-1142.974] (-1145.375) (-1152.510) (-1142.714) * (-1144.809) (-1160.208) [-1142.606] (-1143.338) -- 0:01:02
      46000 -- (-1144.741) [-1145.203] (-1154.525) (-1142.880) * [-1146.180] (-1154.004) (-1142.476) (-1144.484) -- 0:01:02
      46500 -- (-1142.755) (-1147.307) [-1159.686] (-1142.970) * (-1145.779) [-1151.393] (-1146.927) (-1143.907) -- 0:01:01
      47000 -- (-1144.336) (-1147.225) [-1153.197] (-1143.339) * (-1147.180) (-1157.654) (-1144.998) [-1143.259] -- 0:01:00
      47500 -- (-1142.539) (-1145.949) [-1143.581] (-1141.879) * (-1148.353) [-1148.907] (-1143.294) (-1146.280) -- 0:01:00
      48000 -- (-1142.699) (-1150.005) (-1143.988) [-1143.008] * [-1144.059] (-1155.721) (-1142.513) (-1143.381) -- 0:00:59
      48500 -- (-1144.466) (-1143.371) [-1142.659] (-1142.148) * [-1143.490] (-1151.250) (-1143.881) (-1141.321) -- 0:00:58
      49000 -- (-1142.160) (-1143.025) [-1143.180] (-1142.828) * (-1145.098) (-1150.460) (-1142.975) [-1141.520] -- 0:00:58
      49500 -- (-1142.234) [-1142.106] (-1145.018) (-1142.828) * [-1146.581] (-1154.685) (-1143.795) (-1141.238) -- 0:00:57
      50000 -- (-1142.676) (-1141.868) (-1147.067) [-1141.950] * (-1145.915) (-1152.795) (-1142.809) [-1141.260] -- 0:01:16

      Average standard deviation of split frequencies: 0.024811

      50500 -- (-1143.850) (-1141.461) (-1145.386) [-1141.969] * (-1143.497) (-1152.385) [-1143.317] (-1142.618) -- 0:01:15
      51000 -- (-1144.470) (-1143.813) (-1146.915) [-1143.882] * (-1143.422) (-1151.074) [-1147.497] (-1143.359) -- 0:01:14
      51500 -- (-1142.561) [-1142.159] (-1146.895) (-1143.895) * [-1143.449] (-1152.262) (-1145.843) (-1141.804) -- 0:01:13
      52000 -- (-1143.961) (-1141.264) (-1145.705) [-1142.680] * (-1144.310) [-1148.334] (-1144.103) (-1141.793) -- 0:01:12
      52500 -- (-1142.647) [-1141.664] (-1145.904) (-1143.113) * (-1142.937) [-1159.166] (-1142.316) (-1143.733) -- 0:01:12
      53000 -- (-1144.280) (-1142.961) (-1143.599) [-1141.522] * [-1141.817] (-1155.859) (-1141.655) (-1142.853) -- 0:01:11
      53500 -- (-1144.146) (-1141.623) [-1143.703] (-1142.971) * (-1141.561) (-1154.160) [-1144.384] (-1145.958) -- 0:01:10
      54000 -- (-1144.929) [-1141.440] (-1144.299) (-1142.262) * (-1143.605) [-1149.031] (-1143.176) (-1144.567) -- 0:01:10
      54500 -- (-1141.823) (-1146.362) (-1143.305) [-1143.214] * [-1146.775] (-1152.664) (-1142.557) (-1141.829) -- 0:01:09
      55000 -- (-1142.184) [-1142.300] (-1143.526) (-1142.932) * (-1144.368) [-1150.011] (-1143.790) (-1144.218) -- 0:01:08

      Average standard deviation of split frequencies: 0.023482

      55500 -- (-1147.778) (-1141.417) (-1144.500) [-1142.612] * (-1144.671) [-1148.399] (-1141.207) (-1145.628) -- 0:01:08
      56000 -- (-1143.891) [-1141.324] (-1147.701) (-1146.383) * (-1145.513) [-1149.110] (-1142.364) (-1143.960) -- 0:01:07
      56500 -- [-1144.204] (-1142.409) (-1147.813) (-1145.847) * (-1143.799) (-1158.298) [-1142.905] (-1143.035) -- 0:01:06
      57000 -- (-1145.663) (-1142.265) [-1147.827] (-1144.147) * (-1143.525) [-1148.121] (-1143.700) (-1141.368) -- 0:01:06
      57500 -- [-1141.690] (-1142.199) (-1146.272) (-1143.026) * [-1144.539] (-1156.330) (-1143.414) (-1142.129) -- 0:01:05
      58000 -- (-1143.648) [-1144.127] (-1146.213) (-1142.020) * [-1145.135] (-1164.060) (-1143.775) (-1143.292) -- 0:01:04
      58500 -- (-1141.868) (-1141.509) (-1144.997) [-1142.313] * (-1144.159) (-1151.890) [-1142.510] (-1148.318) -- 0:01:04
      59000 -- (-1141.905) (-1143.891) (-1146.945) [-1144.101] * (-1146.780) (-1158.850) [-1144.004] (-1148.097) -- 0:01:03
      59500 -- (-1142.720) [-1143.637] (-1149.510) (-1142.424) * (-1144.066) [-1147.063] (-1142.927) (-1146.700) -- 0:01:03
      60000 -- [-1142.060] (-1146.324) (-1146.912) (-1142.111) * (-1143.660) [-1152.800] (-1142.705) (-1143.435) -- 0:01:02

      Average standard deviation of split frequencies: 0.024947

      60500 -- (-1142.696) (-1145.946) (-1142.409) [-1141.942] * (-1143.819) (-1146.772) [-1141.791] (-1143.324) -- 0:01:02
      61000 -- (-1142.733) (-1147.539) (-1145.539) [-1142.316] * (-1145.660) (-1154.459) (-1141.126) [-1143.120] -- 0:01:01
      61500 -- (-1141.802) (-1146.315) (-1151.262) [-1147.693] * (-1143.058) [-1147.059] (-1143.643) (-1147.497) -- 0:01:01
      62000 -- (-1141.152) [-1148.173] (-1146.537) (-1144.516) * [-1145.317] (-1149.557) (-1145.164) (-1145.602) -- 0:01:00
      62500 -- (-1141.856) [-1143.231] (-1144.506) (-1144.677) * (-1142.737) [-1149.585] (-1143.744) (-1145.387) -- 0:01:00
      63000 -- (-1144.003) [-1143.093] (-1142.706) (-1144.538) * (-1142.945) [-1149.493] (-1145.310) (-1142.459) -- 0:00:59
      63500 -- [-1143.795] (-1143.265) (-1142.397) (-1142.755) * (-1144.349) (-1155.044) [-1147.626] (-1143.780) -- 0:00:58
      64000 -- (-1143.503) (-1146.230) (-1146.189) [-1143.647] * (-1145.860) (-1157.701) (-1145.813) [-1143.235] -- 0:00:58
      64500 -- [-1142.564] (-1142.641) (-1146.279) (-1146.141) * (-1145.731) [-1151.983] (-1146.161) (-1143.813) -- 0:00:58
      65000 -- [-1142.337] (-1141.583) (-1144.977) (-1144.804) * (-1143.257) (-1158.590) [-1148.568] (-1142.850) -- 0:00:57

      Average standard deviation of split frequencies: 0.021752

      65500 -- (-1144.659) [-1145.679] (-1142.900) (-1145.762) * [-1141.360] (-1164.285) (-1150.076) (-1146.563) -- 0:00:57
      66000 -- (-1145.614) (-1141.791) (-1142.090) [-1145.525] * (-1143.386) (-1151.743) (-1145.171) [-1141.290] -- 0:01:10
      66500 -- (-1145.440) [-1141.606] (-1143.060) (-1146.169) * (-1146.532) [-1156.174] (-1144.843) (-1142.469) -- 0:01:10
      67000 -- (-1144.785) [-1142.640] (-1144.331) (-1144.077) * (-1142.755) (-1152.936) [-1142.845] (-1144.577) -- 0:01:09
      67500 -- [-1142.569] (-1143.179) (-1144.173) (-1144.024) * (-1143.104) (-1161.917) [-1142.477] (-1142.551) -- 0:01:09
      68000 -- (-1149.218) [-1144.163] (-1142.278) (-1143.243) * (-1143.709) (-1154.160) [-1142.291] (-1143.296) -- 0:01:08
      68500 -- (-1148.558) (-1144.167) [-1141.241] (-1147.168) * (-1142.436) (-1147.339) (-1141.919) [-1144.614] -- 0:01:07
      69000 -- [-1145.985] (-1143.982) (-1143.786) (-1148.113) * (-1144.634) [-1145.603] (-1143.818) (-1141.436) -- 0:01:07
      69500 -- [-1142.671] (-1142.063) (-1141.927) (-1142.661) * [-1141.842] (-1153.191) (-1148.573) (-1144.326) -- 0:01:06
      70000 -- (-1144.068) (-1141.723) (-1141.231) [-1143.269] * [-1141.667] (-1154.409) (-1146.074) (-1141.392) -- 0:01:06

      Average standard deviation of split frequencies: 0.024682

      70500 -- [-1144.383] (-1142.211) (-1144.889) (-1143.849) * [-1142.501] (-1151.652) (-1143.688) (-1143.195) -- 0:01:05
      71000 -- (-1143.587) (-1141.874) [-1142.264] (-1141.916) * (-1141.240) [-1151.831] (-1145.169) (-1142.444) -- 0:01:05
      71500 -- (-1142.991) (-1141.874) [-1147.968] (-1141.614) * (-1141.173) (-1151.439) [-1142.617] (-1143.517) -- 0:01:04
      72000 -- (-1145.889) (-1142.602) (-1142.331) [-1141.578] * [-1146.145] (-1153.537) (-1142.588) (-1143.114) -- 0:01:04
      72500 -- [-1142.288] (-1141.601) (-1143.635) (-1142.131) * (-1142.533) (-1148.084) [-1145.579] (-1143.114) -- 0:01:03
      73000 -- (-1142.588) (-1141.173) (-1144.087) [-1143.193] * (-1143.209) (-1148.321) (-1142.598) [-1142.580] -- 0:01:03
      73500 -- (-1142.171) (-1141.996) (-1146.092) [-1142.617] * (-1143.785) (-1159.627) [-1142.887] (-1140.985) -- 0:01:03
      74000 -- (-1145.097) (-1143.713) [-1142.325] (-1145.584) * (-1142.518) [-1149.385] (-1146.155) (-1140.959) -- 0:01:02
      74500 -- (-1143.204) (-1143.123) [-1145.390] (-1146.335) * [-1143.633] (-1152.597) (-1141.779) (-1142.753) -- 0:01:02
      75000 -- (-1143.266) (-1141.742) (-1147.947) [-1144.249] * (-1144.067) (-1164.824) [-1141.390] (-1142.561) -- 0:01:01

      Average standard deviation of split frequencies: 0.017149

      75500 -- (-1142.624) [-1141.418] (-1144.911) (-1142.512) * (-1141.205) (-1159.903) [-1142.396] (-1142.696) -- 0:01:01
      76000 -- (-1141.823) (-1143.806) (-1144.606) [-1141.985] * [-1144.918] (-1154.895) (-1146.663) (-1141.688) -- 0:01:00
      76500 -- (-1151.737) (-1143.877) (-1144.830) [-1143.637] * (-1143.861) [-1149.385] (-1143.386) (-1141.946) -- 0:01:00
      77000 -- (-1145.171) [-1143.134] (-1148.831) (-1145.498) * (-1144.759) [-1154.398] (-1142.650) (-1142.414) -- 0:00:59
      77500 -- (-1144.425) (-1141.300) (-1144.748) [-1142.756] * (-1147.125) (-1154.265) (-1141.363) [-1141.394] -- 0:00:59
      78000 -- (-1144.756) (-1142.618) (-1142.319) [-1144.236] * (-1142.910) [-1156.950] (-1142.831) (-1143.870) -- 0:00:59
      78500 -- (-1143.820) [-1142.657] (-1145.399) (-1142.136) * (-1144.300) (-1155.098) [-1145.089] (-1145.431) -- 0:00:58
      79000 -- [-1144.385] (-1144.820) (-1144.819) (-1143.735) * [-1144.352] (-1149.853) (-1143.133) (-1142.661) -- 0:00:58
      79500 -- (-1146.174) (-1144.074) (-1142.954) [-1144.620] * [-1142.898] (-1156.696) (-1142.106) (-1142.572) -- 0:00:57
      80000 -- [-1143.232] (-1145.572) (-1147.025) (-1144.023) * (-1149.282) [-1154.073] (-1143.522) (-1143.282) -- 0:00:57

      Average standard deviation of split frequencies: 0.014782

      80500 -- (-1141.938) [-1142.635] (-1142.073) (-1141.865) * [-1143.516] (-1161.004) (-1142.394) (-1141.633) -- 0:00:57
      81000 -- (-1142.383) [-1142.095] (-1142.412) (-1143.328) * (-1144.139) [-1150.397] (-1142.934) (-1142.702) -- 0:00:56
      81500 -- (-1142.336) (-1142.752) (-1143.120) [-1143.879] * (-1143.007) (-1151.556) [-1143.669] (-1144.072) -- 0:00:56
      82000 -- (-1145.099) [-1142.646] (-1141.612) (-1144.466) * (-1143.088) [-1151.139] (-1145.526) (-1144.654) -- 0:00:55
      82500 -- (-1144.951) (-1142.423) (-1145.446) [-1142.405] * (-1146.793) (-1154.083) (-1144.858) [-1145.843] -- 0:01:06
      83000 -- [-1141.763] (-1141.446) (-1142.669) (-1142.128) * (-1152.509) (-1161.785) [-1147.090] (-1144.698) -- 0:01:06
      83500 -- (-1143.678) (-1142.694) [-1142.863] (-1142.356) * [-1142.718] (-1159.203) (-1143.964) (-1144.640) -- 0:01:05
      84000 -- (-1144.984) (-1142.213) (-1143.340) [-1145.178] * [-1143.373] (-1153.373) (-1144.000) (-1143.859) -- 0:01:05
      84500 -- (-1149.127) (-1142.458) (-1143.340) [-1143.648] * [-1141.502] (-1151.438) (-1143.956) (-1144.537) -- 0:01:05
      85000 -- (-1146.707) (-1143.820) [-1141.818] (-1143.329) * (-1142.094) (-1154.462) (-1143.282) [-1145.724] -- 0:01:04

      Average standard deviation of split frequencies: 0.014617

      85500 -- (-1145.269) (-1144.216) [-1141.370] (-1144.831) * [-1143.783] (-1161.987) (-1143.979) (-1143.454) -- 0:01:04
      86000 -- [-1144.656] (-1142.013) (-1142.341) (-1142.129) * [-1143.643] (-1155.408) (-1141.879) (-1145.428) -- 0:01:03
      86500 -- (-1144.035) [-1142.017] (-1142.231) (-1146.325) * (-1142.915) [-1148.223] (-1144.544) (-1142.246) -- 0:01:03
      87000 -- (-1142.727) (-1142.266) [-1142.690] (-1147.669) * (-1144.428) (-1156.166) (-1142.768) [-1143.048] -- 0:01:02
      87500 -- [-1143.599] (-1143.617) (-1144.727) (-1143.705) * [-1144.645] (-1157.992) (-1146.357) (-1142.304) -- 0:01:02
      88000 -- (-1144.645) (-1143.480) (-1143.112) [-1146.727] * (-1142.679) (-1155.064) [-1145.122] (-1142.401) -- 0:01:02
      88500 -- [-1146.231] (-1144.420) (-1143.608) (-1145.238) * [-1141.934] (-1151.155) (-1141.525) (-1142.425) -- 0:01:01
      89000 -- (-1146.518) (-1144.952) [-1143.079] (-1144.345) * [-1141.903] (-1148.954) (-1142.049) (-1142.395) -- 0:01:01
      89500 -- (-1141.865) (-1142.127) [-1144.078] (-1147.595) * (-1141.573) (-1154.627) (-1143.647) [-1145.037] -- 0:01:01
      90000 -- [-1142.450] (-1143.054) (-1145.295) (-1147.297) * (-1143.836) (-1154.870) (-1141.397) [-1143.562] -- 0:01:00

      Average standard deviation of split frequencies: 0.017513

      90500 -- (-1145.462) (-1143.155) [-1144.950] (-1144.216) * (-1141.439) (-1148.051) (-1146.487) [-1144.202] -- 0:01:00
      91000 -- [-1142.470] (-1143.084) (-1145.683) (-1143.084) * (-1143.906) [-1149.085] (-1143.241) (-1144.983) -- 0:00:59
      91500 -- (-1143.456) [-1141.734] (-1143.620) (-1142.565) * [-1142.302] (-1150.491) (-1144.567) (-1147.103) -- 0:00:59
      92000 -- (-1144.799) [-1143.088] (-1143.883) (-1143.113) * [-1144.876] (-1153.787) (-1145.008) (-1146.583) -- 0:00:59
      92500 -- (-1144.495) (-1143.916) [-1142.794] (-1141.996) * [-1145.145] (-1158.102) (-1143.249) (-1145.083) -- 0:00:58
      93000 -- (-1145.663) [-1141.666] (-1141.147) (-1145.963) * (-1144.079) [-1153.702] (-1143.568) (-1142.984) -- 0:00:58
      93500 -- (-1146.017) [-1141.296] (-1141.470) (-1142.696) * (-1147.252) [-1152.404] (-1144.111) (-1145.400) -- 0:00:58
      94000 -- [-1146.475] (-1141.379) (-1141.365) (-1143.633) * (-1148.040) (-1152.089) [-1141.854] (-1143.399) -- 0:00:57
      94500 -- (-1142.532) [-1141.888] (-1143.056) (-1144.043) * (-1145.549) [-1147.347] (-1146.278) (-1143.397) -- 0:00:57
      95000 -- [-1143.988] (-1143.342) (-1143.574) (-1144.309) * (-1143.456) (-1152.929) [-1142.166] (-1142.774) -- 0:00:57

      Average standard deviation of split frequencies: 0.018278

      95500 -- (-1143.292) (-1143.490) (-1141.617) [-1141.959] * (-1142.212) [-1149.972] (-1142.616) (-1146.288) -- 0:00:56
      96000 -- (-1143.358) (-1142.909) [-1142.768] (-1142.686) * [-1143.499] (-1147.437) (-1143.003) (-1144.602) -- 0:00:56
      96500 -- (-1143.765) [-1141.085] (-1142.855) (-1142.363) * (-1144.474) (-1152.829) (-1143.919) [-1144.826] -- 0:00:56
      97000 -- [-1143.517] (-1144.804) (-1145.227) (-1144.290) * (-1143.631) (-1148.762) [-1143.197] (-1143.912) -- 0:00:55
      97500 -- [-1144.464] (-1144.887) (-1147.940) (-1144.999) * (-1142.110) (-1156.594) [-1143.972] (-1142.510) -- 0:00:55
      98000 -- (-1146.396) (-1141.480) (-1144.602) [-1143.541] * (-1142.521) [-1156.734] (-1143.184) (-1142.446) -- 0:00:55
      98500 -- (-1145.017) [-1141.243] (-1146.898) (-1143.278) * (-1146.160) [-1149.318] (-1141.506) (-1142.225) -- 0:01:04
      99000 -- [-1145.942] (-1141.909) (-1145.369) (-1144.781) * (-1141.331) [-1147.920] (-1141.986) (-1144.486) -- 0:01:03
      99500 -- (-1145.472) (-1143.860) (-1142.879) [-1142.480] * (-1142.227) (-1148.333) (-1142.436) [-1141.853] -- 0:01:03
      100000 -- (-1143.377) (-1142.961) [-1142.954] (-1142.977) * [-1144.690] (-1156.702) (-1142.099) (-1146.559) -- 0:01:02

      Average standard deviation of split frequencies: 0.018456

      100500 -- (-1141.354) (-1143.433) [-1142.450] (-1144.722) * (-1142.708) [-1153.890] (-1143.888) (-1146.072) -- 0:01:02
      101000 -- (-1141.491) (-1144.307) (-1142.838) [-1142.936] * (-1143.327) [-1149.291] (-1144.189) (-1144.674) -- 0:01:02
      101500 -- (-1143.630) (-1143.985) [-1142.753] (-1141.863) * [-1142.499] (-1148.614) (-1143.966) (-1142.503) -- 0:01:01
      102000 -- (-1142.929) (-1143.433) [-1142.635] (-1143.072) * (-1144.943) (-1151.636) [-1146.195] (-1142.392) -- 0:01:01
      102500 -- (-1143.909) (-1146.970) (-1143.792) [-1145.371] * (-1141.967) (-1151.884) [-1143.323] (-1146.207) -- 0:01:01
      103000 -- (-1142.619) (-1145.187) [-1143.206] (-1143.897) * (-1144.563) [-1152.922] (-1143.849) (-1145.544) -- 0:01:00
      103500 -- (-1141.319) (-1142.775) (-1142.648) [-1143.824] * (-1142.266) (-1149.409) [-1143.123] (-1146.334) -- 0:01:00
      104000 -- (-1143.018) [-1142.916] (-1143.591) (-1142.411) * (-1142.435) [-1153.521] (-1143.000) (-1143.526) -- 0:01:00
      104500 -- (-1141.874) (-1142.075) [-1146.757] (-1142.802) * (-1142.792) (-1148.174) (-1144.415) [-1142.507] -- 0:00:59
      105000 -- (-1142.800) (-1143.000) [-1148.221] (-1143.453) * (-1144.500) [-1149.966] (-1149.994) (-1144.666) -- 0:00:59

      Average standard deviation of split frequencies: 0.017321

      105500 -- (-1142.988) (-1142.350) (-1147.333) [-1145.333] * (-1144.821) [-1152.808] (-1142.360) (-1145.817) -- 0:00:59
      106000 -- (-1143.259) (-1142.555) (-1144.820) [-1147.311] * (-1143.449) (-1153.044) [-1142.743] (-1142.653) -- 0:00:59
      106500 -- (-1145.413) (-1145.406) [-1144.648] (-1143.847) * (-1143.276) [-1147.391] (-1142.794) (-1147.881) -- 0:00:58
      107000 -- (-1143.756) (-1143.577) [-1144.178] (-1144.515) * [-1144.559] (-1149.638) (-1141.771) (-1142.325) -- 0:00:58
      107500 -- [-1141.273] (-1143.210) (-1146.272) (-1146.083) * (-1147.307) (-1153.401) [-1142.072] (-1142.769) -- 0:00:58
      108000 -- [-1141.124] (-1143.191) (-1141.550) (-1143.065) * (-1144.549) (-1151.260) (-1144.069) [-1142.616] -- 0:00:57
      108500 -- (-1141.263) [-1142.542] (-1141.766) (-1143.627) * [-1142.652] (-1155.837) (-1144.893) (-1143.598) -- 0:00:57
      109000 -- (-1141.058) (-1145.450) [-1141.740] (-1142.290) * [-1143.456] (-1149.769) (-1146.470) (-1148.663) -- 0:00:57
      109500 -- (-1144.186) [-1144.498] (-1141.960) (-1142.405) * (-1145.931) (-1154.093) [-1142.491] (-1144.821) -- 0:00:56
      110000 -- (-1148.425) (-1146.342) (-1142.472) [-1142.936] * (-1144.397) (-1150.862) (-1143.225) [-1144.329] -- 0:00:56

      Average standard deviation of split frequencies: 0.017039

      110500 -- (-1141.368) (-1146.290) [-1141.840] (-1142.825) * (-1142.303) [-1152.354] (-1145.047) (-1142.327) -- 0:00:56
      111000 -- (-1141.950) (-1144.794) (-1142.180) [-1142.612] * (-1143.043) (-1159.904) (-1147.243) [-1145.361] -- 0:00:56
      111500 -- (-1145.181) (-1143.008) (-1142.713) [-1142.469] * (-1143.685) (-1152.029) [-1142.710] (-1145.509) -- 0:00:55
      112000 -- [-1144.182] (-1143.099) (-1143.584) (-1143.772) * (-1146.130) [-1154.672] (-1144.478) (-1148.277) -- 0:00:55
      112500 -- (-1144.572) [-1143.529] (-1146.436) (-1146.537) * [-1145.914] (-1152.540) (-1144.598) (-1142.518) -- 0:00:55
      113000 -- [-1144.247] (-1144.301) (-1145.016) (-1145.602) * (-1144.752) (-1153.788) (-1143.467) [-1143.457] -- 0:00:54
      113500 -- (-1145.624) (-1142.816) [-1143.038] (-1141.573) * (-1145.572) (-1164.255) (-1145.158) [-1144.538] -- 0:00:54
      114000 -- (-1146.055) (-1142.431) (-1144.808) [-1142.142] * [-1142.658] (-1144.428) (-1144.216) (-1143.085) -- 0:00:54
      114500 -- (-1145.553) (-1142.898) (-1146.810) [-1141.783] * [-1142.824] (-1144.893) (-1142.378) (-1142.440) -- 0:01:01
      115000 -- (-1146.324) [-1142.377] (-1144.957) (-1142.401) * (-1144.216) (-1142.247) (-1142.483) [-1142.245] -- 0:01:01

      Average standard deviation of split frequencies: 0.019416

      115500 -- (-1142.151) (-1143.388) [-1141.981] (-1146.787) * (-1145.349) (-1142.019) (-1142.483) [-1146.050] -- 0:01:01
      116000 -- (-1141.888) (-1143.004) (-1143.132) [-1143.825] * (-1144.542) [-1143.679] (-1142.187) (-1143.300) -- 0:01:00
      116500 -- [-1141.976] (-1143.505) (-1143.080) (-1145.203) * [-1144.419] (-1142.760) (-1142.770) (-1143.647) -- 0:01:00
      117000 -- (-1144.349) (-1147.415) [-1143.904] (-1146.395) * (-1149.924) [-1141.147] (-1144.055) (-1144.503) -- 0:01:00
      117500 -- (-1145.806) (-1142.637) [-1144.566] (-1143.862) * [-1143.572] (-1141.337) (-1148.446) (-1143.841) -- 0:01:00
      118000 -- (-1144.373) [-1142.034] (-1144.321) (-1143.564) * (-1144.032) [-1143.437] (-1146.655) (-1142.188) -- 0:00:59
      118500 -- [-1142.465] (-1142.376) (-1143.549) (-1143.887) * (-1143.536) (-1142.490) (-1146.934) [-1141.955] -- 0:00:59
      119000 -- (-1144.004) (-1144.813) [-1142.448] (-1144.483) * (-1143.413) (-1143.282) [-1144.483] (-1141.634) -- 0:00:59
      119500 -- (-1142.949) (-1143.360) [-1144.412] (-1144.527) * (-1144.639) (-1145.293) (-1145.503) [-1141.985] -- 0:00:58
      120000 -- (-1143.244) [-1147.732] (-1142.978) (-1142.423) * (-1143.563) [-1144.192] (-1145.224) (-1145.592) -- 0:00:58

      Average standard deviation of split frequencies: 0.019763

      120500 -- (-1145.794) [-1141.954] (-1143.557) (-1145.030) * (-1141.530) [-1144.035] (-1144.131) (-1146.966) -- 0:00:58
      121000 -- [-1143.938] (-1144.517) (-1144.577) (-1142.211) * (-1141.419) (-1146.272) (-1145.403) [-1147.945] -- 0:00:58
      121500 -- (-1142.649) [-1143.834] (-1141.722) (-1144.007) * (-1142.809) [-1143.432] (-1144.437) (-1146.432) -- 0:00:57
      122000 -- (-1145.133) (-1142.482) [-1142.184] (-1145.798) * (-1141.612) (-1142.672) [-1149.396] (-1152.619) -- 0:00:57
      122500 -- (-1144.044) (-1144.522) [-1142.579] (-1147.068) * (-1141.795) (-1143.285) (-1144.263) [-1145.249] -- 0:00:57
      123000 -- [-1142.036] (-1141.581) (-1142.493) (-1142.285) * (-1142.457) (-1145.502) [-1145.753] (-1143.653) -- 0:00:57
      123500 -- (-1143.151) [-1141.570] (-1143.440) (-1142.176) * (-1141.483) (-1145.482) (-1143.141) [-1142.146] -- 0:00:56
      124000 -- (-1142.848) (-1143.562) (-1146.180) [-1141.536] * (-1145.217) [-1143.950] (-1145.175) (-1144.879) -- 0:00:56
      124500 -- (-1141.821) [-1145.358] (-1144.494) (-1144.617) * (-1144.409) (-1143.234) (-1145.458) [-1144.698] -- 0:00:56
      125000 -- (-1144.106) (-1145.323) [-1143.825] (-1142.208) * [-1142.700] (-1144.158) (-1143.944) (-1144.535) -- 0:00:56

      Average standard deviation of split frequencies: 0.018291

      125500 -- [-1147.607] (-1146.545) (-1142.978) (-1141.703) * (-1142.700) (-1143.857) (-1142.490) [-1143.889] -- 0:00:55
      126000 -- (-1143.476) [-1144.313] (-1142.325) (-1141.481) * (-1142.976) [-1142.128] (-1145.245) (-1143.905) -- 0:00:55
      126500 -- (-1143.036) (-1144.755) (-1142.704) [-1145.425] * (-1142.209) (-1141.912) (-1141.900) [-1143.629] -- 0:00:55
      127000 -- [-1142.129] (-1143.218) (-1144.546) (-1143.045) * [-1142.670] (-1142.660) (-1141.628) (-1143.791) -- 0:00:54
      127500 -- (-1142.089) (-1142.825) [-1145.288] (-1142.156) * [-1143.338] (-1147.957) (-1141.596) (-1145.266) -- 0:00:54
      128000 -- (-1142.765) [-1143.702] (-1143.200) (-1141.554) * (-1141.860) [-1142.985] (-1143.244) (-1142.297) -- 0:00:54
      128500 -- (-1142.141) (-1145.429) (-1143.041) [-1146.123] * (-1147.250) [-1145.172] (-1143.946) (-1143.140) -- 0:00:54
      129000 -- (-1144.644) (-1147.031) [-1143.933] (-1146.779) * (-1144.921) (-1144.928) (-1144.468) [-1141.859] -- 0:00:54
      129500 -- [-1144.576] (-1146.850) (-1146.003) (-1143.253) * (-1141.631) [-1144.243] (-1141.831) (-1142.521) -- 0:00:53
      130000 -- [-1143.580] (-1148.429) (-1142.547) (-1143.688) * (-1143.495) (-1143.751) [-1142.213] (-1142.236) -- 0:00:53

      Average standard deviation of split frequencies: 0.017838

      130500 -- [-1143.637] (-1145.273) (-1143.022) (-1143.668) * (-1143.892) (-1145.651) (-1141.940) [-1142.591] -- 0:00:59
      131000 -- (-1143.684) (-1143.455) [-1145.434] (-1144.506) * [-1143.182] (-1146.412) (-1141.933) (-1141.109) -- 0:00:59
      131500 -- (-1142.075) [-1142.009] (-1150.473) (-1145.782) * (-1146.605) (-1145.168) [-1144.762] (-1143.588) -- 0:00:59
      132000 -- (-1142.683) (-1141.980) (-1147.737) [-1144.363] * (-1145.116) (-1144.772) (-1142.206) [-1142.139] -- 0:00:59
      132500 -- (-1142.974) [-1144.177] (-1144.997) (-1147.326) * (-1142.549) (-1145.720) (-1147.006) [-1142.087] -- 0:00:58
      133000 -- (-1144.035) (-1142.797) [-1143.107] (-1141.983) * (-1142.133) (-1146.635) [-1145.888] (-1141.422) -- 0:00:58
      133500 -- (-1144.335) (-1142.750) (-1143.419) [-1141.759] * [-1143.302] (-1147.030) (-1145.954) (-1142.148) -- 0:00:58
      134000 -- (-1143.549) (-1142.546) [-1144.012] (-1144.728) * (-1144.347) (-1143.762) [-1144.298] (-1142.081) -- 0:00:58
      134500 -- (-1143.539) [-1144.252] (-1143.671) (-1144.238) * (-1145.668) (-1144.380) [-1143.104] (-1142.100) -- 0:00:57
      135000 -- (-1144.327) [-1144.960] (-1143.932) (-1143.297) * (-1143.135) (-1142.693) [-1143.197] (-1142.013) -- 0:00:57

      Average standard deviation of split frequencies: 0.019064

      135500 -- [-1145.083] (-1147.013) (-1142.846) (-1144.495) * (-1142.943) (-1141.956) (-1142.820) [-1141.840] -- 0:00:57
      136000 -- (-1147.361) (-1148.463) [-1141.923] (-1143.480) * [-1142.555] (-1141.842) (-1142.380) (-1147.801) -- 0:00:57
      136500 -- (-1143.064) (-1143.019) [-1142.968] (-1143.454) * (-1143.497) (-1141.937) [-1142.012] (-1144.713) -- 0:00:56
      137000 -- [-1142.580] (-1143.270) (-1142.146) (-1143.372) * [-1142.068] (-1142.504) (-1147.141) (-1143.007) -- 0:00:56
      137500 -- [-1142.250] (-1145.120) (-1144.031) (-1142.689) * [-1141.865] (-1142.493) (-1142.666) (-1144.005) -- 0:00:56
      138000 -- [-1142.110] (-1143.785) (-1143.277) (-1143.544) * (-1143.709) [-1142.402] (-1145.059) (-1143.293) -- 0:00:56
      138500 -- [-1142.213] (-1143.845) (-1146.605) (-1142.216) * [-1143.258] (-1141.975) (-1143.991) (-1141.259) -- 0:00:55
      139000 -- [-1142.760] (-1143.638) (-1144.308) (-1145.465) * (-1144.479) [-1141.060] (-1142.852) (-1143.825) -- 0:00:55
      139500 -- (-1142.465) [-1141.406] (-1144.333) (-1143.800) * (-1148.144) [-1141.880] (-1142.905) (-1143.436) -- 0:00:55
      140000 -- (-1142.271) (-1141.401) (-1141.436) [-1141.957] * (-1141.229) (-1142.018) [-1142.831] (-1151.428) -- 0:00:55

      Average standard deviation of split frequencies: 0.016942

      140500 -- (-1143.930) (-1142.468) [-1141.606] (-1142.548) * (-1141.879) (-1143.956) [-1145.811] (-1144.580) -- 0:00:55
      141000 -- (-1149.335) (-1142.181) (-1141.522) [-1141.646] * (-1145.007) [-1141.893] (-1146.009) (-1142.940) -- 0:00:54
      141500 -- (-1143.920) [-1142.287] (-1141.815) (-1141.455) * (-1143.789) (-1142.952) (-1142.768) [-1143.712] -- 0:00:54
      142000 -- (-1144.660) (-1142.444) [-1141.498] (-1141.352) * [-1143.257] (-1141.402) (-1142.071) (-1143.159) -- 0:00:54
      142500 -- [-1144.671] (-1142.148) (-1142.296) (-1141.809) * (-1142.918) (-1142.149) (-1144.425) [-1141.677] -- 0:00:54
      143000 -- (-1150.166) (-1144.836) [-1143.599] (-1141.456) * [-1142.324] (-1145.052) (-1143.051) (-1143.347) -- 0:00:53
      143500 -- (-1144.835) [-1143.572] (-1144.905) (-1144.603) * (-1143.946) [-1143.746] (-1143.428) (-1141.846) -- 0:00:53
      144000 -- [-1143.543] (-1145.628) (-1143.932) (-1144.042) * (-1145.514) (-1143.702) (-1141.771) [-1143.310] -- 0:00:53
      144500 -- (-1143.366) (-1146.149) (-1141.586) [-1145.884] * (-1143.862) (-1142.998) (-1142.094) [-1143.607] -- 0:00:53
      145000 -- (-1145.031) (-1146.090) [-1143.379] (-1142.826) * (-1144.832) (-1141.416) [-1143.091] (-1143.485) -- 0:00:53

      Average standard deviation of split frequencies: 0.014709

      145500 -- (-1141.826) (-1145.441) (-1144.985) [-1143.360] * (-1143.312) [-1142.819] (-1143.756) (-1143.470) -- 0:00:52
      146000 -- (-1145.596) (-1144.684) (-1146.024) [-1141.768] * (-1142.436) (-1141.482) [-1147.191] (-1146.565) -- 0:00:52
      146500 -- (-1141.531) (-1145.044) (-1148.275) [-1142.697] * (-1142.409) (-1142.854) [-1146.538] (-1142.232) -- 0:00:58
      147000 -- (-1146.929) (-1144.511) (-1142.615) [-1142.748] * (-1143.887) (-1143.132) (-1142.087) [-1142.122] -- 0:00:58
      147500 -- [-1144.567] (-1144.823) (-1143.642) (-1144.836) * (-1142.290) [-1142.683] (-1142.173) (-1142.162) -- 0:00:57
      148000 -- (-1146.873) (-1144.811) (-1142.897) [-1143.309] * [-1144.492] (-1146.897) (-1144.022) (-1145.879) -- 0:00:57
      148500 -- (-1143.723) (-1142.985) [-1142.594] (-1142.624) * [-1144.398] (-1144.130) (-1143.571) (-1145.619) -- 0:00:57
      149000 -- (-1143.438) [-1144.055] (-1147.916) (-1143.791) * (-1146.728) (-1143.513) [-1144.914] (-1142.169) -- 0:00:57
      149500 -- (-1143.178) [-1146.544] (-1142.682) (-1142.706) * (-1146.108) [-1144.181] (-1143.373) (-1142.539) -- 0:00:56
      150000 -- (-1144.164) (-1145.492) (-1144.163) [-1141.747] * [-1143.712] (-1144.668) (-1142.860) (-1141.913) -- 0:00:56

      Average standard deviation of split frequencies: 0.014080

      150500 -- (-1144.635) (-1143.320) (-1146.695) [-1142.850] * (-1144.945) (-1148.240) [-1141.855] (-1142.006) -- 0:00:56
      151000 -- (-1144.804) (-1147.030) (-1144.972) [-1143.314] * (-1143.269) [-1144.517] (-1143.048) (-1142.670) -- 0:00:56
      151500 -- [-1141.585] (-1144.771) (-1146.886) (-1142.869) * (-1143.213) (-1146.017) (-1143.463) [-1143.198] -- 0:00:56
      152000 -- [-1141.649] (-1145.541) (-1145.909) (-1146.714) * [-1142.192] (-1147.301) (-1142.726) (-1141.811) -- 0:00:55
      152500 -- [-1141.645] (-1143.715) (-1146.201) (-1146.213) * (-1141.838) (-1145.310) (-1143.581) [-1144.376] -- 0:00:55
      153000 -- (-1141.656) (-1143.777) (-1144.600) [-1143.921] * [-1141.867] (-1142.965) (-1141.193) (-1142.251) -- 0:00:55
      153500 -- (-1143.565) (-1141.942) (-1146.524) [-1144.411] * (-1141.890) [-1144.046] (-1141.226) (-1141.748) -- 0:00:55
      154000 -- [-1141.437] (-1141.563) (-1144.266) (-1144.464) * (-1142.166) (-1143.054) [-1142.003] (-1143.113) -- 0:00:54
      154500 -- (-1142.728) [-1141.562] (-1145.559) (-1143.760) * (-1143.095) [-1144.188] (-1144.992) (-1143.311) -- 0:00:54
      155000 -- (-1143.593) (-1141.928) (-1144.687) [-1142.225] * (-1143.325) [-1140.992] (-1144.876) (-1141.904) -- 0:00:54

      Average standard deviation of split frequencies: 0.013095

      155500 -- [-1143.068] (-1142.343) (-1153.469) (-1143.670) * (-1145.061) (-1141.071) (-1144.863) [-1142.757] -- 0:00:54
      156000 -- (-1143.726) [-1141.838] (-1144.856) (-1146.583) * (-1143.745) (-1141.267) (-1143.724) [-1142.839] -- 0:00:54
      156500 -- (-1142.680) (-1144.018) [-1144.108] (-1143.690) * (-1143.757) (-1141.278) [-1146.397] (-1143.123) -- 0:00:53
      157000 -- (-1142.579) (-1148.185) (-1145.073) [-1143.167] * (-1143.501) (-1141.386) (-1144.788) [-1143.068] -- 0:00:53
      157500 -- (-1144.561) (-1147.572) (-1143.178) [-1142.754] * (-1146.204) (-1143.798) [-1144.569] (-1142.370) -- 0:00:53
      158000 -- (-1143.280) (-1144.397) [-1143.231] (-1141.831) * (-1143.649) (-1143.017) (-1145.628) [-1146.481] -- 0:00:53
      158500 -- (-1143.784) [-1143.657] (-1143.359) (-1143.052) * (-1142.251) (-1141.026) [-1144.505] (-1145.915) -- 0:00:53
      159000 -- (-1144.134) [-1143.779] (-1144.621) (-1144.908) * (-1142.197) [-1141.045] (-1142.508) (-1145.934) -- 0:00:52
      159500 -- (-1145.463) [-1143.405] (-1144.410) (-1145.203) * (-1141.454) (-1140.983) [-1144.085] (-1146.088) -- 0:00:52
      160000 -- [-1141.443] (-1144.167) (-1142.337) (-1146.318) * [-1145.867] (-1141.874) (-1144.798) (-1146.942) -- 0:00:52

      Average standard deviation of split frequencies: 0.012045

      160500 -- [-1141.443] (-1144.997) (-1146.379) (-1143.176) * [-1142.151] (-1144.455) (-1145.018) (-1141.383) -- 0:00:52
      161000 -- (-1142.876) [-1143.704] (-1142.244) (-1144.755) * (-1146.467) (-1141.988) (-1144.812) [-1141.469] -- 0:00:52
      161500 -- [-1143.532] (-1142.875) (-1142.778) (-1145.424) * [-1142.363] (-1142.866) (-1142.576) (-1144.082) -- 0:00:51
      162000 -- (-1146.046) (-1144.769) [-1143.142] (-1146.936) * (-1143.003) (-1142.042) [-1143.149] (-1144.270) -- 0:00:51
      162500 -- (-1148.549) (-1144.928) (-1142.534) [-1144.398] * [-1142.630] (-1143.918) (-1143.206) (-1143.249) -- 0:00:51
      163000 -- (-1142.452) (-1145.390) [-1142.042] (-1142.943) * (-1144.451) [-1141.858] (-1144.288) (-1145.508) -- 0:00:56
      163500 -- (-1143.197) (-1143.399) (-1144.501) [-1143.742] * [-1141.802] (-1143.600) (-1145.113) (-1146.145) -- 0:00:56
      164000 -- (-1143.588) (-1142.681) [-1144.705] (-1142.464) * (-1141.524) [-1142.222] (-1145.270) (-1146.912) -- 0:00:56
      164500 -- [-1143.086] (-1143.579) (-1143.534) (-1142.453) * (-1145.614) [-1141.796] (-1142.255) (-1148.127) -- 0:00:55
      165000 -- (-1143.790) (-1143.506) [-1142.653] (-1142.183) * (-1141.874) (-1142.582) [-1144.415] (-1143.739) -- 0:00:55

      Average standard deviation of split frequencies: 0.013900

      165500 -- (-1142.495) (-1143.658) (-1143.148) [-1145.166] * [-1142.431] (-1145.145) (-1143.136) (-1143.778) -- 0:00:55
      166000 -- (-1145.855) [-1142.903] (-1142.911) (-1142.339) * (-1142.371) (-1143.144) [-1142.488] (-1141.218) -- 0:00:55
      166500 -- [-1143.820] (-1143.162) (-1142.926) (-1146.022) * (-1145.217) (-1142.838) (-1150.205) [-1141.217] -- 0:00:55
      167000 -- (-1142.809) (-1141.823) [-1144.346] (-1142.779) * [-1143.568] (-1143.355) (-1144.183) (-1141.284) -- 0:00:54
      167500 -- [-1146.504] (-1141.615) (-1144.346) (-1142.810) * (-1142.806) (-1145.250) [-1145.756] (-1142.038) -- 0:00:54
      168000 -- (-1144.160) [-1141.688] (-1142.123) (-1142.686) * [-1144.625] (-1146.348) (-1143.814) (-1142.599) -- 0:00:54
      168500 -- (-1142.804) (-1148.108) (-1143.199) [-1141.635] * [-1142.490] (-1143.723) (-1144.364) (-1145.647) -- 0:00:54
      169000 -- (-1143.576) (-1143.348) (-1146.384) [-1142.635] * (-1143.898) [-1144.842] (-1143.569) (-1143.615) -- 0:00:54
      169500 -- (-1143.227) (-1147.179) [-1144.886] (-1142.695) * (-1145.088) [-1145.604] (-1144.345) (-1142.505) -- 0:00:53
      170000 -- (-1144.359) (-1144.675) [-1142.415] (-1146.397) * (-1142.672) [-1145.040] (-1141.564) (-1143.826) -- 0:00:53

      Average standard deviation of split frequencies: 0.014731

      170500 -- [-1144.626] (-1144.658) (-1143.230) (-1148.760) * (-1142.715) (-1142.883) [-1142.200] (-1149.837) -- 0:00:53
      171000 -- (-1148.314) (-1142.493) (-1142.205) [-1146.446] * (-1146.997) (-1143.012) [-1143.623] (-1147.521) -- 0:00:53
      171500 -- (-1146.463) [-1143.755] (-1142.564) (-1144.105) * (-1147.193) (-1142.040) [-1141.760] (-1146.206) -- 0:00:53
      172000 -- (-1142.746) (-1142.519) [-1146.647] (-1145.165) * (-1143.566) (-1142.623) (-1143.185) [-1142.746] -- 0:00:52
      172500 -- (-1144.888) [-1141.728] (-1141.772) (-1145.576) * (-1144.667) (-1142.252) [-1144.937] (-1145.218) -- 0:00:52
      173000 -- (-1141.431) [-1142.651] (-1143.145) (-1144.173) * [-1142.937] (-1144.648) (-1143.056) (-1145.655) -- 0:00:52
      173500 -- (-1141.373) (-1143.546) (-1142.567) [-1141.202] * [-1142.471] (-1143.881) (-1143.730) (-1143.157) -- 0:00:52
      174000 -- (-1141.489) [-1141.831] (-1146.115) (-1143.606) * [-1143.801] (-1143.958) (-1143.066) (-1143.258) -- 0:00:52
      174500 -- (-1142.109) (-1151.935) [-1142.031] (-1144.267) * (-1142.923) (-1144.008) [-1146.700] (-1143.270) -- 0:00:52
      175000 -- [-1143.009] (-1149.959) (-1143.486) (-1142.872) * (-1144.369) [-1144.394] (-1145.836) (-1142.634) -- 0:00:51

      Average standard deviation of split frequencies: 0.013987

      175500 -- (-1147.102) (-1142.770) (-1142.422) [-1142.283] * [-1145.136] (-1147.600) (-1145.678) (-1141.880) -- 0:00:51
      176000 -- (-1145.271) (-1141.503) [-1143.556] (-1142.743) * (-1145.139) [-1141.876] (-1144.403) (-1142.094) -- 0:00:51
      176500 -- [-1142.523] (-1141.992) (-1143.560) (-1142.466) * (-1144.277) (-1141.918) [-1142.150] (-1144.839) -- 0:00:51
      177000 -- (-1142.269) [-1143.373] (-1142.642) (-1142.754) * [-1142.714] (-1143.865) (-1141.356) (-1144.406) -- 0:00:51
      177500 -- (-1142.268) (-1146.283) [-1143.534] (-1144.568) * [-1142.158] (-1147.250) (-1143.400) (-1144.587) -- 0:00:50
      178000 -- (-1143.442) [-1145.210] (-1141.711) (-1144.835) * (-1142.860) (-1141.853) (-1143.594) [-1144.763] -- 0:00:50
      178500 -- (-1142.154) (-1143.941) (-1144.708) [-1145.360] * (-1144.893) (-1144.590) [-1144.443] (-1144.220) -- 0:00:50
      179000 -- (-1146.068) (-1146.241) [-1141.973] (-1144.333) * (-1144.686) (-1143.812) (-1144.124) [-1143.268] -- 0:00:55
      179500 -- [-1144.028] (-1143.333) (-1141.978) (-1146.971) * (-1144.851) (-1143.812) (-1146.577) [-1143.280] -- 0:00:54
      180000 -- [-1141.685] (-1141.948) (-1142.215) (-1144.044) * [-1142.423] (-1146.106) (-1141.492) (-1143.006) -- 0:00:54

      Average standard deviation of split frequencies: 0.015656

      180500 -- (-1148.295) (-1142.855) (-1141.287) [-1144.172] * (-1141.354) (-1148.598) [-1141.842] (-1141.991) -- 0:00:54
      181000 -- (-1143.039) (-1145.637) [-1141.302] (-1142.881) * (-1143.961) (-1150.395) [-1142.384] (-1145.090) -- 0:00:54
      181500 -- [-1142.737] (-1141.800) (-1142.724) (-1145.934) * [-1144.348] (-1146.505) (-1142.539) (-1146.684) -- 0:00:54
      182000 -- (-1143.614) [-1141.636] (-1144.831) (-1147.117) * (-1146.655) (-1146.967) (-1145.987) [-1144.325] -- 0:00:53
      182500 -- (-1142.186) [-1142.242] (-1143.156) (-1141.605) * [-1147.315] (-1144.626) (-1145.216) (-1143.426) -- 0:00:53
      183000 -- (-1143.407) (-1142.398) [-1144.572] (-1142.355) * [-1145.364] (-1143.925) (-1144.431) (-1147.833) -- 0:00:53
      183500 -- [-1144.121] (-1143.387) (-1145.425) (-1144.531) * [-1142.422] (-1143.775) (-1143.736) (-1145.799) -- 0:00:53
      184000 -- (-1143.644) (-1145.625) (-1143.466) [-1148.553] * (-1141.787) (-1143.626) [-1142.364] (-1144.444) -- 0:00:53
      184500 -- (-1143.220) [-1144.667] (-1145.836) (-1142.451) * (-1144.658) [-1143.027] (-1142.190) (-1143.224) -- 0:00:53
      185000 -- (-1142.265) (-1144.215) [-1143.511] (-1142.451) * (-1143.743) (-1142.870) (-1146.047) [-1143.799] -- 0:00:52

      Average standard deviation of split frequencies: 0.015340

      185500 -- (-1142.421) (-1143.483) [-1141.544] (-1141.580) * (-1147.605) (-1142.716) (-1148.373) [-1144.563] -- 0:00:52
      186000 -- (-1143.147) (-1144.470) [-1146.614] (-1141.580) * (-1144.791) (-1144.315) [-1142.401] (-1143.213) -- 0:00:52
      186500 -- [-1143.164] (-1150.575) (-1144.133) (-1141.846) * (-1144.557) [-1148.504] (-1143.671) (-1141.626) -- 0:00:52
      187000 -- (-1147.164) [-1144.866] (-1142.462) (-1142.240) * (-1145.111) (-1146.675) [-1141.642] (-1141.047) -- 0:00:52
      187500 -- (-1147.594) (-1142.868) (-1146.976) [-1142.885] * [-1142.730] (-1143.609) (-1142.198) (-1141.954) -- 0:00:52
      188000 -- (-1143.694) [-1142.141] (-1141.049) (-1144.684) * (-1142.322) (-1147.183) (-1142.478) [-1142.450] -- 0:00:51
      188500 -- (-1146.621) [-1141.635] (-1143.258) (-1142.509) * (-1144.464) [-1144.050] (-1141.676) (-1141.250) -- 0:00:51
      189000 -- (-1143.873) (-1142.886) [-1142.046] (-1144.765) * (-1148.649) (-1143.093) (-1142.843) [-1141.992] -- 0:00:51
      189500 -- (-1144.915) [-1144.336] (-1142.404) (-1142.206) * (-1145.835) (-1143.395) [-1144.089] (-1144.994) -- 0:00:51
      190000 -- (-1142.197) (-1144.869) (-1143.181) [-1142.372] * (-1143.521) (-1142.933) (-1144.486) [-1142.948] -- 0:00:51

      Average standard deviation of split frequencies: 0.013736

      190500 -- (-1142.705) (-1144.644) (-1142.996) [-1143.052] * (-1143.009) (-1142.926) [-1143.492] (-1143.071) -- 0:00:50
      191000 -- (-1145.155) (-1144.334) (-1154.457) [-1144.372] * [-1144.161] (-1142.496) (-1144.883) (-1144.945) -- 0:00:50
      191500 -- (-1143.343) (-1150.196) (-1146.365) [-1141.151] * (-1144.182) (-1142.766) [-1143.828] (-1143.841) -- 0:00:50
      192000 -- (-1144.324) (-1143.543) (-1143.184) [-1142.126] * (-1141.390) (-1143.377) [-1142.464] (-1141.821) -- 0:00:50
      192500 -- (-1142.314) [-1142.356] (-1152.010) (-1142.663) * (-1148.405) (-1142.603) [-1143.403] (-1141.473) -- 0:00:50
      193000 -- (-1146.464) (-1143.804) (-1142.489) [-1141.655] * (-1142.828) (-1142.453) (-1143.356) [-1142.943] -- 0:00:50
      193500 -- (-1146.301) (-1143.103) [-1141.525] (-1141.655) * (-1144.245) [-1143.171] (-1141.791) (-1142.803) -- 0:00:50
      194000 -- (-1146.418) (-1143.612) [-1144.344] (-1141.641) * (-1144.715) (-1143.168) [-1142.115] (-1142.239) -- 0:00:49
      194500 -- (-1143.111) (-1143.463) [-1144.007] (-1141.704) * (-1143.487) (-1142.979) (-1142.454) [-1143.943] -- 0:00:53
      195000 -- (-1143.543) (-1144.414) [-1143.254] (-1143.437) * [-1143.161] (-1144.724) (-1143.160) (-1142.669) -- 0:00:53

      Average standard deviation of split frequencies: 0.013362

      195500 -- [-1143.603] (-1143.480) (-1143.777) (-1143.303) * (-1143.186) [-1144.803] (-1142.675) (-1146.172) -- 0:00:53
      196000 -- (-1145.109) (-1142.903) (-1143.376) [-1144.791] * [-1142.291] (-1142.389) (-1142.648) (-1146.543) -- 0:00:53
      196500 -- [-1144.680] (-1142.586) (-1143.450) (-1144.463) * (-1142.062) (-1142.717) (-1142.163) [-1142.709] -- 0:00:53
      197000 -- (-1145.827) [-1142.727] (-1147.201) (-1142.754) * [-1144.324] (-1143.421) (-1142.442) (-1142.948) -- 0:00:52
      197500 -- (-1142.352) [-1142.199] (-1145.027) (-1142.926) * (-1147.764) (-1144.240) (-1142.370) [-1143.083] -- 0:00:52
      198000 -- (-1143.452) [-1142.008] (-1145.438) (-1143.432) * (-1148.738) (-1150.016) [-1142.180] (-1143.667) -- 0:00:52
      198500 -- (-1142.071) (-1141.990) (-1142.199) [-1141.338] * (-1142.556) [-1146.288] (-1144.824) (-1142.132) -- 0:00:52
      199000 -- [-1142.200] (-1142.648) (-1146.852) (-1144.963) * (-1142.865) [-1143.346] (-1147.076) (-1146.691) -- 0:00:52
      199500 -- (-1142.135) (-1142.434) (-1145.862) [-1143.053] * (-1145.138) (-1147.971) (-1146.227) [-1142.336] -- 0:00:52
      200000 -- (-1142.603) (-1145.526) [-1143.463] (-1141.737) * (-1144.777) [-1142.888] (-1143.258) (-1143.233) -- 0:00:51

      Average standard deviation of split frequencies: 0.012660

      200500 -- [-1148.383] (-1141.923) (-1144.137) (-1144.887) * (-1143.809) (-1142.687) [-1142.947] (-1142.477) -- 0:00:51
      201000 -- (-1147.433) [-1142.078] (-1142.805) (-1143.869) * [-1144.647] (-1145.624) (-1143.026) (-1143.568) -- 0:00:51
      201500 -- (-1143.293) (-1141.543) (-1142.174) [-1141.594] * [-1144.380] (-1142.945) (-1144.113) (-1143.154) -- 0:00:51
      202000 -- [-1143.873] (-1141.716) (-1141.835) (-1144.741) * [-1143.453] (-1144.367) (-1144.361) (-1146.180) -- 0:00:51
      202500 -- (-1143.318) [-1142.376] (-1149.805) (-1143.158) * [-1142.990] (-1144.033) (-1144.751) (-1142.233) -- 0:00:51
      203000 -- (-1142.474) (-1142.327) [-1146.559] (-1144.590) * (-1142.965) (-1148.179) (-1144.075) [-1143.743] -- 0:00:51
      203500 -- (-1143.090) (-1142.642) [-1142.563] (-1142.831) * (-1141.572) (-1146.950) (-1142.345) [-1146.200] -- 0:00:50
      204000 -- (-1143.861) [-1143.613] (-1142.036) (-1143.190) * [-1142.912] (-1148.983) (-1144.059) (-1147.683) -- 0:00:50
      204500 -- (-1142.807) (-1143.106) (-1141.810) [-1142.603] * (-1143.517) (-1146.782) (-1141.802) [-1146.187] -- 0:00:50
      205000 -- (-1145.745) [-1142.213] (-1147.477) (-1142.736) * (-1144.206) [-1141.708] (-1142.742) (-1146.241) -- 0:00:50

      Average standard deviation of split frequencies: 0.012526

      205500 -- [-1144.289] (-1142.153) (-1144.654) (-1145.169) * (-1145.118) (-1142.679) [-1141.582] (-1152.382) -- 0:00:50
      206000 -- (-1146.519) [-1144.119] (-1143.260) (-1141.952) * [-1143.150] (-1142.411) (-1143.908) (-1149.139) -- 0:00:50
      206500 -- (-1145.897) [-1141.258] (-1144.490) (-1144.020) * (-1141.064) (-1142.760) [-1144.087] (-1145.292) -- 0:00:49
      207000 -- (-1142.425) [-1142.563] (-1143.307) (-1142.445) * (-1141.807) (-1145.406) [-1141.730] (-1143.022) -- 0:00:49
      207500 -- [-1145.609] (-1142.086) (-1145.179) (-1142.291) * (-1141.110) [-1144.141] (-1142.722) (-1143.187) -- 0:00:49
      208000 -- [-1147.032] (-1142.877) (-1142.904) (-1144.041) * (-1142.215) (-1141.355) [-1142.504] (-1144.227) -- 0:00:49
      208500 -- [-1141.950] (-1151.756) (-1145.577) (-1144.174) * (-1142.686) [-1142.860] (-1142.740) (-1144.224) -- 0:00:49
      209000 -- (-1147.692) (-1147.695) (-1142.630) [-1141.904] * [-1141.967] (-1141.738) (-1143.421) (-1145.799) -- 0:00:52
      209500 -- [-1144.629] (-1145.922) (-1143.320) (-1141.984) * [-1144.699] (-1143.197) (-1141.430) (-1145.204) -- 0:00:52
      210000 -- (-1145.070) (-1149.533) (-1144.017) [-1141.735] * [-1143.548] (-1143.292) (-1141.252) (-1145.880) -- 0:00:52

      Average standard deviation of split frequencies: 0.011686

      210500 -- [-1143.437] (-1142.250) (-1144.899) (-1144.808) * (-1142.986) (-1142.364) (-1141.934) [-1144.936] -- 0:00:52
      211000 -- [-1142.082] (-1142.265) (-1144.179) (-1142.541) * (-1145.101) [-1142.033] (-1142.469) (-1142.227) -- 0:00:52
      211500 -- [-1142.961] (-1142.306) (-1143.403) (-1150.098) * (-1143.959) (-1143.175) [-1142.469] (-1142.236) -- 0:00:52
      212000 -- (-1144.014) [-1142.812] (-1144.402) (-1143.242) * (-1144.515) [-1142.716] (-1143.950) (-1147.654) -- 0:00:52
      212500 -- (-1147.932) [-1142.815] (-1145.206) (-1144.870) * (-1145.857) (-1144.631) (-1142.982) [-1142.647] -- 0:00:51
      213000 -- (-1146.549) (-1141.884) (-1143.104) [-1141.689] * (-1145.857) [-1144.637] (-1142.295) (-1141.254) -- 0:00:51
      213500 -- (-1145.626) (-1144.454) [-1146.040] (-1144.453) * (-1143.630) (-1144.398) (-1141.856) [-1141.445] -- 0:00:51
      214000 -- (-1145.305) [-1147.319] (-1143.250) (-1146.260) * (-1143.737) (-1143.993) (-1143.599) [-1141.505] -- 0:00:51
      214500 -- (-1145.307) (-1143.698) (-1142.612) [-1142.304] * (-1144.277) (-1144.433) (-1141.652) [-1141.091] -- 0:00:51
      215000 -- (-1145.661) (-1144.924) (-1142.816) [-1142.858] * (-1142.882) (-1145.871) [-1141.133] (-1142.305) -- 0:00:51

      Average standard deviation of split frequencies: 0.012246

      215500 -- (-1143.607) [-1142.650] (-1143.569) (-1144.884) * (-1141.579) [-1143.573] (-1143.584) (-1143.544) -- 0:00:50
      216000 -- (-1143.513) (-1141.318) [-1142.434] (-1143.645) * (-1142.751) (-1144.731) (-1145.327) [-1141.896] -- 0:00:50
      216500 -- (-1146.298) (-1143.535) [-1142.943] (-1142.229) * (-1141.514) [-1144.152] (-1141.804) (-1141.530) -- 0:00:50
      217000 -- (-1143.695) (-1142.390) [-1142.251] (-1143.300) * (-1143.194) (-1144.354) (-1141.429) [-1142.930] -- 0:00:50
      217500 -- (-1145.258) [-1144.418] (-1142.520) (-1145.254) * (-1142.643) (-1142.527) (-1141.345) [-1142.732] -- 0:00:50
      218000 -- (-1142.411) (-1145.395) (-1145.495) [-1145.242] * (-1147.660) (-1142.957) (-1142.991) [-1146.210] -- 0:00:50
      218500 -- [-1141.976] (-1146.442) (-1146.302) (-1146.751) * (-1146.724) (-1142.494) [-1142.000] (-1142.407) -- 0:00:50
      219000 -- [-1141.499] (-1145.913) (-1142.543) (-1142.663) * [-1143.304] (-1143.292) (-1143.125) (-1143.928) -- 0:00:49
      219500 -- [-1142.943] (-1144.000) (-1143.026) (-1145.490) * (-1144.309) (-1144.963) [-1142.516] (-1146.046) -- 0:00:49
      220000 -- (-1143.786) (-1142.998) [-1143.694] (-1143.663) * (-1142.442) (-1143.126) [-1143.924] (-1143.964) -- 0:00:49

      Average standard deviation of split frequencies: 0.011561

      220500 -- (-1142.575) [-1143.586] (-1146.004) (-1144.075) * (-1143.678) (-1143.451) (-1145.058) [-1144.813] -- 0:00:49
      221000 -- [-1143.219] (-1142.830) (-1147.524) (-1144.123) * (-1143.167) (-1142.907) [-1143.805] (-1147.196) -- 0:00:49
      221500 -- (-1142.424) [-1146.580] (-1143.342) (-1143.035) * [-1141.396] (-1145.910) (-1144.017) (-1142.765) -- 0:00:49
      222000 -- (-1143.887) (-1143.564) (-1143.201) [-1145.279] * (-1141.525) [-1143.254] (-1144.120) (-1142.744) -- 0:00:49
      222500 -- (-1143.199) (-1146.690) (-1141.783) [-1141.708] * [-1145.320] (-1143.324) (-1144.568) (-1145.246) -- 0:00:48
      223000 -- (-1143.396) [-1143.981] (-1145.253) (-1144.079) * (-1141.872) [-1143.128] (-1146.218) (-1146.770) -- 0:00:48
      223500 -- (-1146.011) (-1145.325) (-1143.332) [-1143.887] * [-1142.830] (-1143.624) (-1145.320) (-1146.727) -- 0:00:52
      224000 -- (-1143.451) (-1142.787) (-1141.821) [-1142.837] * (-1146.161) (-1144.876) [-1143.242] (-1143.151) -- 0:00:51
      224500 -- [-1143.875] (-1144.126) (-1143.917) (-1143.712) * [-1142.403] (-1144.171) (-1141.250) (-1143.151) -- 0:00:51
      225000 -- [-1142.190] (-1145.304) (-1142.102) (-1143.485) * [-1141.454] (-1142.897) (-1143.465) (-1146.024) -- 0:00:51

      Average standard deviation of split frequencies: 0.012515

      225500 -- [-1144.203] (-1144.056) (-1141.457) (-1143.062) * (-1143.832) [-1143.362] (-1143.246) (-1142.034) -- 0:00:51
      226000 -- [-1144.925] (-1142.071) (-1141.809) (-1142.524) * [-1141.557] (-1143.354) (-1144.134) (-1141.220) -- 0:00:51
      226500 -- (-1144.853) (-1149.721) [-1142.290] (-1142.928) * [-1142.210] (-1141.875) (-1147.030) (-1141.220) -- 0:00:51
      227000 -- [-1146.253] (-1143.285) (-1142.244) (-1142.117) * (-1141.998) [-1144.429] (-1146.878) (-1142.137) -- 0:00:51
      227500 -- [-1146.130] (-1144.695) (-1145.582) (-1143.932) * (-1146.511) [-1142.763] (-1146.079) (-1142.301) -- 0:00:50
      228000 -- (-1144.687) (-1145.796) (-1141.005) [-1143.125] * [-1144.528] (-1144.546) (-1143.727) (-1142.746) -- 0:00:50
      228500 -- [-1145.084] (-1142.946) (-1141.224) (-1142.332) * (-1143.882) (-1143.662) (-1142.878) [-1141.067] -- 0:00:50
      229000 -- (-1144.123) (-1144.018) (-1141.230) [-1142.005] * (-1144.181) [-1142.650] (-1142.512) (-1142.715) -- 0:00:50
      229500 -- (-1145.012) (-1147.447) (-1141.473) [-1142.068] * (-1145.324) [-1143.271] (-1143.016) (-1143.592) -- 0:00:50
      230000 -- (-1145.497) [-1147.955] (-1141.942) (-1141.505) * (-1142.755) (-1143.982) [-1142.805] (-1143.222) -- 0:00:50

      Average standard deviation of split frequencies: 0.012376

      230500 -- [-1144.415] (-1145.300) (-1142.579) (-1142.247) * (-1143.584) [-1142.052] (-1144.408) (-1143.587) -- 0:00:50
      231000 -- (-1144.037) [-1142.578] (-1151.379) (-1141.783) * [-1146.226] (-1144.623) (-1145.952) (-1146.377) -- 0:00:49
      231500 -- (-1141.467) (-1141.760) [-1141.888] (-1143.983) * (-1142.727) (-1141.950) [-1144.312] (-1144.074) -- 0:00:49
      232000 -- [-1141.424] (-1142.470) (-1146.906) (-1144.423) * (-1141.898) (-1141.894) (-1146.068) [-1147.994] -- 0:00:49
      232500 -- (-1142.256) [-1145.542] (-1142.806) (-1143.316) * (-1142.579) [-1145.593] (-1145.547) (-1145.374) -- 0:00:49
      233000 -- (-1146.085) [-1144.841] (-1144.099) (-1145.885) * [-1142.237] (-1145.146) (-1145.267) (-1145.386) -- 0:00:49
      233500 -- (-1142.466) (-1143.392) (-1149.634) [-1143.798] * (-1142.491) (-1142.934) (-1144.331) [-1142.957] -- 0:00:49
      234000 -- (-1142.862) [-1147.257] (-1146.893) (-1150.920) * [-1144.635] (-1142.932) (-1145.133) (-1143.257) -- 0:00:49
      234500 -- (-1145.466) [-1146.404] (-1144.734) (-1144.102) * (-1144.537) (-1143.382) (-1143.416) [-1141.285] -- 0:00:48
      235000 -- (-1144.022) (-1145.976) [-1143.102] (-1146.475) * [-1144.418] (-1143.995) (-1144.676) (-1142.378) -- 0:00:48

      Average standard deviation of split frequencies: 0.012651

      235500 -- (-1141.807) (-1143.995) [-1144.106] (-1145.377) * (-1144.302) [-1141.908] (-1142.698) (-1141.827) -- 0:00:48
      236000 -- (-1148.976) (-1142.293) [-1142.870] (-1143.240) * (-1141.906) (-1142.881) (-1143.202) [-1142.664] -- 0:00:48
      236500 -- (-1144.489) (-1147.919) (-1142.772) [-1143.116] * (-1142.282) (-1142.877) [-1141.553] (-1142.805) -- 0:00:48
      237000 -- (-1142.843) (-1145.781) [-1145.329] (-1145.147) * [-1141.698] (-1145.023) (-1144.465) (-1142.075) -- 0:00:48
      237500 -- (-1142.293) (-1143.537) [-1150.220] (-1145.147) * [-1143.296] (-1142.570) (-1145.711) (-1142.143) -- 0:00:48
      238000 -- (-1142.406) (-1143.309) [-1142.884] (-1143.848) * (-1141.104) (-1141.288) (-1142.948) [-1143.952] -- 0:00:48
      238500 -- [-1141.944] (-1142.449) (-1142.886) (-1144.557) * [-1142.239] (-1142.156) (-1144.312) (-1142.328) -- 0:00:51
      239000 -- [-1142.414] (-1148.303) (-1142.486) (-1141.606) * (-1141.227) (-1141.755) [-1143.900] (-1143.147) -- 0:00:50
      239500 -- (-1141.949) [-1143.179] (-1142.231) (-1141.122) * (-1142.654) (-1141.405) (-1142.128) [-1142.783] -- 0:00:50
      240000 -- (-1145.528) (-1142.554) [-1141.684] (-1141.188) * [-1145.292] (-1141.217) (-1141.078) (-1144.712) -- 0:00:50

      Average standard deviation of split frequencies: 0.013596

      240500 -- (-1146.569) [-1142.457] (-1141.752) (-1143.764) * (-1145.687) (-1142.802) (-1144.490) [-1141.920] -- 0:00:50
      241000 -- (-1146.778) (-1142.253) [-1141.830] (-1143.426) * (-1144.377) [-1144.176] (-1146.533) (-1141.739) -- 0:00:50
      241500 -- [-1143.135] (-1143.227) (-1142.238) (-1142.157) * (-1144.818) [-1142.111] (-1145.051) (-1142.146) -- 0:00:50
      242000 -- [-1142.569] (-1142.702) (-1151.764) (-1145.693) * (-1144.315) (-1142.444) (-1143.048) [-1143.285] -- 0:00:50
      242500 -- (-1143.927) (-1142.245) (-1143.857) [-1144.035] * (-1144.611) [-1142.485] (-1142.043) (-1142.234) -- 0:00:49
      243000 -- [-1143.314] (-1142.030) (-1142.831) (-1143.109) * (-1142.359) (-1142.310) [-1142.687] (-1142.311) -- 0:00:49
      243500 -- (-1144.258) [-1142.089] (-1142.584) (-1144.545) * (-1145.537) [-1141.580] (-1141.802) (-1144.851) -- 0:00:49
      244000 -- (-1143.220) (-1142.083) (-1145.432) [-1142.474] * (-1143.587) (-1141.602) (-1142.717) [-1145.082] -- 0:00:49
      244500 -- (-1143.220) (-1143.276) (-1141.625) [-1145.165] * (-1144.627) [-1142.047] (-1142.626) (-1145.288) -- 0:00:49
      245000 -- (-1142.732) (-1145.761) [-1141.937] (-1141.820) * (-1157.074) [-1142.053] (-1146.343) (-1145.705) -- 0:00:49

      Average standard deviation of split frequencies: 0.013865

      245500 -- [-1145.538] (-1142.727) (-1142.188) (-1141.320) * (-1150.422) [-1141.582] (-1146.214) (-1142.437) -- 0:00:49
      246000 -- (-1145.436) (-1146.909) [-1144.412] (-1142.252) * (-1146.757) (-1143.642) (-1144.909) [-1141.823] -- 0:00:49
      246500 -- (-1141.936) (-1146.678) (-1148.607) [-1142.252] * (-1145.399) [-1144.355] (-1143.537) (-1144.948) -- 0:00:48
      247000 -- (-1141.930) (-1147.327) [-1142.973] (-1142.140) * (-1145.106) (-1145.849) (-1143.631) [-1144.272] -- 0:00:48
      247500 -- (-1142.244) [-1143.847] (-1143.978) (-1143.460) * (-1146.720) [-1143.187] (-1141.689) (-1142.725) -- 0:00:48
      248000 -- [-1142.689] (-1144.373) (-1141.570) (-1145.798) * (-1144.260) (-1142.216) [-1141.434] (-1143.167) -- 0:00:48
      248500 -- (-1145.301) [-1144.198] (-1143.576) (-1147.786) * (-1144.669) [-1143.590] (-1141.416) (-1146.116) -- 0:00:48
      249000 -- [-1143.085] (-1143.123) (-1143.711) (-1143.475) * (-1143.442) [-1143.194] (-1141.671) (-1142.934) -- 0:00:48
      249500 -- [-1142.198] (-1143.142) (-1147.287) (-1142.142) * (-1143.181) (-1143.689) [-1144.097] (-1143.128) -- 0:00:48
      250000 -- (-1141.778) (-1146.240) [-1145.114] (-1149.020) * [-1142.084] (-1142.080) (-1143.593) (-1142.503) -- 0:00:48

      Average standard deviation of split frequencies: 0.014160

      250500 -- (-1141.657) (-1145.332) [-1144.370] (-1142.783) * (-1146.692) [-1143.605] (-1144.403) (-1141.248) -- 0:00:47
      251000 -- [-1141.382] (-1145.098) (-1148.223) (-1141.976) * (-1146.297) [-1147.213] (-1141.794) (-1143.275) -- 0:00:47
      251500 -- (-1141.110) (-1143.790) [-1144.405] (-1142.446) * (-1143.138) (-1144.138) (-1141.797) [-1141.841] -- 0:00:47
      252000 -- (-1142.549) [-1142.328] (-1144.547) (-1146.791) * (-1142.881) (-1144.259) [-1146.118] (-1145.348) -- 0:00:47
      252500 -- [-1143.392] (-1143.512) (-1144.956) (-1144.116) * (-1144.230) (-1143.354) (-1143.664) [-1143.581] -- 0:00:47
      253000 -- (-1144.689) [-1143.476] (-1146.589) (-1142.588) * (-1144.366) (-1143.831) (-1144.175) [-1144.251] -- 0:00:47
      253500 -- (-1144.603) [-1144.862] (-1143.370) (-1142.517) * (-1143.821) (-1143.317) [-1143.140] (-1142.639) -- 0:00:47
      254000 -- [-1143.154] (-1143.430) (-1143.697) (-1144.937) * (-1142.478) (-1143.965) [-1141.943] (-1147.842) -- 0:00:49
      254500 -- [-1143.420] (-1143.787) (-1144.175) (-1145.617) * (-1143.581) (-1142.657) [-1141.622] (-1145.331) -- 0:00:49
      255000 -- (-1142.438) (-1145.227) [-1143.874] (-1143.199) * [-1143.299] (-1144.846) (-1143.463) (-1145.788) -- 0:00:49

      Average standard deviation of split frequencies: 0.014081

      255500 -- (-1142.633) (-1148.120) [-1141.850] (-1142.702) * (-1143.656) (-1146.532) [-1143.840] (-1143.670) -- 0:00:49
      256000 -- (-1141.936) (-1145.834) [-1141.108] (-1141.989) * [-1141.286] (-1145.146) (-1143.724) (-1142.632) -- 0:00:49
      256500 -- (-1143.066) [-1143.588] (-1143.945) (-1142.011) * (-1146.310) (-1143.590) [-1142.058] (-1142.661) -- 0:00:49
      257000 -- (-1141.918) (-1144.004) (-1145.779) [-1141.963] * (-1142.943) (-1144.836) [-1142.234] (-1142.317) -- 0:00:49
      257500 -- (-1142.372) [-1143.339] (-1146.438) (-1144.281) * (-1142.204) [-1143.468] (-1142.137) (-1141.919) -- 0:00:49
      258000 -- (-1146.048) (-1144.989) (-1144.841) [-1143.121] * (-1142.970) (-1144.266) [-1142.528] (-1141.858) -- 0:00:48
      258500 -- (-1142.926) [-1142.925] (-1145.991) (-1143.222) * [-1145.879] (-1144.356) (-1141.801) (-1141.821) -- 0:00:48
      259000 -- [-1142.171] (-1144.121) (-1144.573) (-1142.101) * (-1143.630) (-1143.431) (-1146.234) [-1142.086] -- 0:00:48
      259500 -- (-1141.209) (-1141.667) (-1144.505) [-1141.619] * (-1146.237) (-1142.051) [-1143.432] (-1144.451) -- 0:00:48
      260000 -- (-1142.006) (-1143.808) (-1143.569) [-1143.201] * (-1147.612) [-1142.761] (-1142.973) (-1144.511) -- 0:00:48

      Average standard deviation of split frequencies: 0.013404

      260500 -- (-1141.977) (-1143.250) (-1142.188) [-1143.717] * [-1145.120] (-1144.504) (-1142.828) (-1144.762) -- 0:00:48
      261000 -- (-1143.170) (-1144.751) (-1141.735) [-1141.589] * (-1148.666) (-1142.139) [-1142.182] (-1145.008) -- 0:00:48
      261500 -- (-1143.277) [-1142.270] (-1143.351) (-1141.783) * (-1145.125) [-1141.618] (-1143.590) (-1143.540) -- 0:00:48
      262000 -- (-1141.954) (-1146.994) (-1143.847) [-1141.751] * (-1144.256) [-1141.144] (-1144.296) (-1143.047) -- 0:00:47
      262500 -- (-1142.954) (-1142.315) (-1146.278) [-1141.561] * (-1142.644) [-1142.121] (-1143.575) (-1143.687) -- 0:00:47
      263000 -- (-1141.905) [-1141.837] (-1142.838) (-1141.561) * (-1142.387) (-1145.139) [-1143.428] (-1146.308) -- 0:00:47
      263500 -- (-1142.642) [-1142.151] (-1141.917) (-1143.541) * (-1142.745) [-1145.109] (-1144.651) (-1143.859) -- 0:00:47
      264000 -- (-1143.678) [-1145.144] (-1142.245) (-1143.702) * (-1144.159) (-1144.983) [-1142.684] (-1142.714) -- 0:00:47
      264500 -- (-1142.161) (-1141.518) (-1142.836) [-1141.586] * (-1141.044) (-1144.722) [-1143.671] (-1144.532) -- 0:00:47
      265000 -- (-1142.626) [-1141.548] (-1142.892) (-1143.401) * (-1141.727) [-1143.971] (-1143.041) (-1144.789) -- 0:00:47

      Average standard deviation of split frequencies: 0.013239

      265500 -- (-1143.897) (-1143.298) (-1142.798) [-1141.745] * [-1141.997] (-1143.735) (-1143.587) (-1143.888) -- 0:00:47
      266000 -- (-1143.689) (-1142.849) (-1144.783) [-1144.500] * [-1141.040] (-1143.704) (-1147.244) (-1146.855) -- 0:00:46
      266500 -- (-1145.292) (-1142.978) (-1146.302) [-1143.215] * [-1142.015] (-1141.381) (-1145.275) (-1143.743) -- 0:00:46
      267000 -- [-1144.275] (-1143.028) (-1144.644) (-1143.267) * (-1141.427) [-1141.605] (-1144.364) (-1142.182) -- 0:00:46
      267500 -- [-1145.323] (-1142.567) (-1141.749) (-1143.384) * (-1142.278) (-1141.145) [-1144.430] (-1143.385) -- 0:00:46
      268000 -- (-1144.341) (-1142.248) (-1141.922) [-1143.044] * [-1143.932] (-1141.529) (-1146.819) (-1143.045) -- 0:00:46
      268500 -- (-1145.710) (-1142.143) [-1143.165] (-1145.591) * (-1142.776) (-1144.927) (-1146.386) [-1141.996] -- 0:00:46
      269000 -- (-1147.358) (-1142.246) (-1142.567) [-1146.674] * (-1141.539) (-1144.204) [-1144.110] (-1141.750) -- 0:00:48
      269500 -- (-1143.811) [-1142.335] (-1141.581) (-1147.611) * (-1142.670) (-1142.597) (-1142.646) [-1141.462] -- 0:00:48
      270000 -- (-1143.284) [-1143.646] (-1141.268) (-1144.011) * (-1141.877) (-1143.339) (-1142.435) [-1141.633] -- 0:00:48

      Average standard deviation of split frequencies: 0.012579

      270500 -- [-1144.364] (-1143.356) (-1141.956) (-1153.078) * (-1144.548) (-1144.130) (-1142.400) [-1141.533] -- 0:00:48
      271000 -- (-1147.976) [-1143.252] (-1142.725) (-1145.146) * (-1145.882) (-1143.738) (-1146.690) [-1142.138] -- 0:00:48
      271500 -- [-1144.305] (-1146.025) (-1142.322) (-1145.663) * (-1141.981) (-1145.431) [-1142.532] (-1141.641) -- 0:00:48
      272000 -- (-1143.787) (-1144.057) [-1141.886] (-1145.056) * (-1141.585) (-1145.601) (-1146.879) [-1144.703] -- 0:00:48
      272500 -- [-1144.081] (-1143.087) (-1142.773) (-1146.929) * (-1142.805) (-1143.345) [-1142.086] (-1146.479) -- 0:00:48
      273000 -- (-1144.377) (-1141.339) [-1141.494] (-1143.882) * (-1141.961) [-1145.101] (-1142.319) (-1143.028) -- 0:00:47
      273500 -- (-1144.630) (-1141.037) (-1142.046) [-1144.248] * (-1142.471) (-1143.265) (-1146.437) [-1141.816] -- 0:00:47
      274000 -- (-1142.761) (-1143.362) [-1142.434] (-1145.839) * (-1143.033) (-1142.975) (-1143.793) [-1143.319] -- 0:00:47
      274500 -- (-1145.854) [-1143.986] (-1142.326) (-1143.517) * (-1146.708) (-1142.849) [-1143.893] (-1141.087) -- 0:00:47
      275000 -- (-1145.648) (-1143.751) [-1142.161] (-1144.341) * (-1143.614) (-1145.735) [-1143.726] (-1143.238) -- 0:00:47

      Average standard deviation of split frequencies: 0.011956

      275500 -- [-1143.804] (-1142.033) (-1141.998) (-1148.723) * (-1144.456) (-1143.979) [-1143.363] (-1145.916) -- 0:00:47
      276000 -- (-1145.415) (-1141.992) (-1144.923) [-1141.954] * (-1143.643) [-1143.652] (-1144.115) (-1145.201) -- 0:00:47
      276500 -- (-1143.051) (-1143.908) [-1141.803] (-1143.257) * (-1143.883) [-1144.989] (-1143.677) (-1144.260) -- 0:00:47
      277000 -- (-1141.662) (-1146.931) (-1146.863) [-1141.141] * (-1143.524) (-1142.599) (-1141.098) [-1143.292] -- 0:00:46
      277500 -- [-1142.117] (-1142.249) (-1145.304) (-1143.193) * [-1143.875] (-1143.847) (-1141.072) (-1141.719) -- 0:00:46
      278000 -- (-1141.731) (-1143.099) [-1147.372] (-1141.116) * (-1144.022) (-1144.340) (-1142.496) [-1142.461] -- 0:00:46
      278500 -- [-1142.585] (-1146.316) (-1142.635) (-1141.693) * (-1143.985) (-1142.469) (-1143.525) [-1141.628] -- 0:00:46
      279000 -- (-1145.028) (-1142.914) (-1142.441) [-1142.023] * [-1142.422] (-1141.456) (-1144.582) (-1143.601) -- 0:00:46
      279500 -- (-1144.639) (-1141.687) [-1142.578] (-1142.769) * (-1141.685) (-1145.491) (-1142.763) [-1144.599] -- 0:00:46
      280000 -- (-1144.451) [-1143.235] (-1142.241) (-1142.731) * (-1144.001) (-1141.712) (-1141.575) [-1141.502] -- 0:00:46

      Average standard deviation of split frequencies: 0.011856

      280500 -- [-1143.806] (-1145.794) (-1143.648) (-1141.572) * [-1144.556] (-1143.003) (-1141.789) (-1141.555) -- 0:00:46
      281000 -- [-1146.143] (-1145.415) (-1149.012) (-1147.164) * (-1143.938) (-1142.713) (-1141.787) [-1141.343] -- 0:00:46
      281500 -- [-1143.096] (-1145.052) (-1149.562) (-1146.745) * (-1141.610) (-1142.386) [-1141.366] (-1141.871) -- 0:00:45
      282000 -- (-1145.773) (-1143.959) (-1146.640) [-1143.622] * (-1141.606) (-1143.086) [-1143.107] (-1145.877) -- 0:00:45
      282500 -- (-1146.940) (-1145.279) [-1143.478] (-1142.586) * (-1144.689) [-1142.592] (-1145.918) (-1143.256) -- 0:00:45
      283000 -- (-1150.500) (-1143.258) [-1144.764] (-1148.643) * (-1145.718) (-1143.500) [-1145.123] (-1143.585) -- 0:00:45
      283500 -- [-1146.098] (-1144.298) (-1142.322) (-1148.920) * (-1142.706) [-1142.654] (-1142.465) (-1147.189) -- 0:00:45
      284000 -- (-1142.736) [-1142.466] (-1144.249) (-1146.688) * (-1141.545) (-1141.823) (-1142.389) [-1145.809] -- 0:00:45
      284500 -- (-1142.722) (-1142.357) [-1143.242] (-1141.305) * (-1142.861) (-1143.564) [-1143.975] (-1147.272) -- 0:00:45
      285000 -- (-1142.596) (-1143.739) (-1146.059) [-1143.989] * (-1141.612) (-1148.139) [-1146.511] (-1144.335) -- 0:00:47

      Average standard deviation of split frequencies: 0.011355

      285500 -- [-1141.562] (-1141.982) (-1144.613) (-1144.706) * (-1142.273) (-1147.352) (-1146.789) [-1143.130] -- 0:00:47
      286000 -- (-1143.189) (-1144.485) [-1142.710] (-1145.499) * (-1141.838) [-1142.757] (-1143.471) (-1142.987) -- 0:00:47
      286500 -- (-1144.503) [-1143.335] (-1146.166) (-1142.524) * (-1141.229) (-1141.716) [-1143.006] (-1143.179) -- 0:00:47
      287000 -- (-1151.035) [-1142.704] (-1144.418) (-1145.934) * (-1141.497) (-1141.749) [-1141.471] (-1145.288) -- 0:00:47
      287500 -- (-1146.132) [-1143.230] (-1145.082) (-1147.227) * (-1141.624) (-1144.565) (-1141.471) [-1142.206] -- 0:00:47
      288000 -- (-1144.607) (-1144.112) [-1144.416] (-1144.666) * (-1141.521) (-1141.607) [-1141.025] (-1142.960) -- 0:00:46
      288500 -- [-1142.880] (-1142.026) (-1146.845) (-1145.848) * (-1145.762) (-1150.051) [-1141.024] (-1143.313) -- 0:00:46
      289000 -- (-1142.453) (-1142.924) [-1143.920] (-1145.197) * (-1143.444) (-1148.329) (-1142.908) [-1143.562] -- 0:00:46
      289500 -- (-1143.330) (-1142.461) [-1142.251] (-1145.364) * (-1143.257) [-1144.079] (-1143.556) (-1142.911) -- 0:00:46
      290000 -- [-1142.148] (-1144.206) (-1143.755) (-1146.246) * (-1143.831) [-1142.216] (-1143.687) (-1143.263) -- 0:00:46

      Average standard deviation of split frequencies: 0.011263

      290500 -- (-1143.234) (-1143.265) [-1144.446] (-1142.898) * (-1145.915) (-1142.558) (-1144.067) [-1144.047] -- 0:00:46
      291000 -- (-1143.663) (-1141.793) [-1141.109] (-1143.800) * (-1146.950) [-1143.186] (-1142.002) (-1143.690) -- 0:00:46
      291500 -- (-1141.579) (-1142.133) [-1146.748] (-1141.485) * (-1143.347) [-1143.958] (-1143.385) (-1144.159) -- 0:00:46
      292000 -- (-1143.424) (-1143.758) [-1145.202] (-1141.938) * (-1143.667) [-1144.250] (-1144.372) (-1143.866) -- 0:00:46
      292500 -- (-1143.067) (-1143.118) [-1142.848] (-1142.416) * (-1147.947) (-1145.952) (-1143.291) [-1143.129] -- 0:00:45
      293000 -- (-1143.454) [-1142.614] (-1144.504) (-1143.328) * (-1142.128) (-1146.349) (-1141.354) [-1141.623] -- 0:00:45
      293500 -- (-1144.368) (-1142.932) (-1146.445) [-1143.430] * (-1145.526) (-1146.546) [-1143.773] (-1142.753) -- 0:00:45
      294000 -- (-1146.480) [-1147.993] (-1144.632) (-1143.115) * (-1145.539) (-1146.734) (-1143.060) [-1142.943] -- 0:00:45
      294500 -- (-1145.973) (-1143.600) [-1145.745] (-1142.135) * (-1143.984) (-1143.411) (-1144.440) [-1144.832] -- 0:00:45
      295000 -- (-1149.233) [-1146.484] (-1144.680) (-1142.636) * (-1142.450) (-1148.574) (-1143.071) [-1141.970] -- 0:00:45

      Average standard deviation of split frequencies: 0.011429

      295500 -- (-1150.753) [-1144.504] (-1146.284) (-1143.939) * [-1145.518] (-1146.525) (-1142.811) (-1141.779) -- 0:00:45
      296000 -- [-1144.379] (-1141.786) (-1142.925) (-1145.028) * (-1145.073) (-1143.031) [-1144.779] (-1144.664) -- 0:00:45
      296500 -- (-1143.391) (-1143.679) [-1142.968] (-1142.218) * (-1144.199) (-1144.912) (-1142.537) [-1147.589] -- 0:00:45
      297000 -- [-1143.867] (-1144.018) (-1144.759) (-1145.115) * [-1142.258] (-1141.741) (-1142.899) (-1144.345) -- 0:00:44
      297500 -- (-1144.813) (-1143.653) [-1142.806] (-1147.173) * (-1143.914) [-1141.674] (-1143.042) (-1146.465) -- 0:00:44
      298000 -- (-1142.998) [-1143.856] (-1144.942) (-1142.391) * (-1154.889) (-1142.564) (-1149.944) [-1143.587] -- 0:00:44
      298500 -- (-1143.612) (-1144.427) (-1141.717) [-1143.404] * (-1147.170) [-1143.947] (-1145.817) (-1143.134) -- 0:00:44
      299000 -- (-1143.759) (-1147.701) (-1141.748) [-1141.281] * [-1143.530] (-1143.675) (-1143.769) (-1142.256) -- 0:00:44
      299500 -- (-1141.484) (-1147.414) (-1141.805) [-1142.331] * (-1143.599) (-1142.107) [-1147.384] (-1143.445) -- 0:00:44
      300000 -- (-1142.809) (-1144.848) [-1142.287] (-1143.540) * (-1143.889) [-1142.847] (-1144.929) (-1143.738) -- 0:00:44

      Average standard deviation of split frequencies: 0.012266

      300500 -- (-1146.343) [-1143.682] (-1149.296) (-1150.135) * (-1144.091) (-1146.428) (-1143.487) [-1143.248] -- 0:00:46
      301000 -- (-1145.186) (-1145.426) (-1144.508) [-1145.967] * (-1142.569) [-1148.667] (-1144.311) (-1144.090) -- 0:00:46
      301500 -- (-1143.079) (-1145.426) (-1142.511) [-1143.707] * (-1144.398) [-1145.681] (-1146.154) (-1145.381) -- 0:00:46
      302000 -- (-1142.689) (-1145.757) (-1143.149) [-1147.021] * (-1142.554) (-1143.864) [-1143.396] (-1144.465) -- 0:00:46
      302500 -- [-1142.315] (-1142.412) (-1143.903) (-1142.538) * (-1143.154) [-1142.191] (-1143.812) (-1146.368) -- 0:00:46
      303000 -- (-1142.262) (-1143.212) [-1143.371] (-1141.986) * (-1144.086) (-1141.262) (-1143.566) [-1146.542] -- 0:00:46
      303500 -- [-1141.343] (-1142.304) (-1144.310) (-1143.693) * (-1144.171) (-1144.901) [-1143.515] (-1142.532) -- 0:00:45
      304000 -- (-1141.428) (-1144.867) (-1144.018) [-1142.186] * [-1143.358] (-1144.688) (-1151.684) (-1141.693) -- 0:00:45
      304500 -- [-1146.517] (-1141.638) (-1144.104) (-1143.014) * (-1144.361) [-1143.780] (-1149.918) (-1145.470) -- 0:00:45
      305000 -- (-1141.510) [-1144.560] (-1143.704) (-1142.269) * (-1146.162) (-1146.604) (-1144.101) [-1142.844] -- 0:00:45

      Average standard deviation of split frequencies: 0.011896

      305500 -- (-1143.671) (-1147.270) [-1142.754] (-1142.849) * (-1145.031) (-1146.832) [-1143.647] (-1145.095) -- 0:00:45
      306000 -- (-1143.977) (-1142.780) [-1143.194] (-1142.534) * [-1143.704] (-1144.405) (-1145.544) (-1144.599) -- 0:00:45
      306500 -- (-1143.132) [-1142.719] (-1142.930) (-1149.531) * (-1148.470) (-1142.879) [-1145.311] (-1141.682) -- 0:00:45
      307000 -- (-1144.209) [-1142.997] (-1143.023) (-1147.359) * (-1145.668) [-1141.731] (-1143.913) (-1141.140) -- 0:00:45
      307500 -- [-1143.745] (-1143.446) (-1145.840) (-1143.097) * [-1144.868] (-1141.827) (-1143.155) (-1141.418) -- 0:00:45
      308000 -- (-1142.068) [-1143.255] (-1145.908) (-1142.705) * (-1141.738) (-1142.586) [-1142.996] (-1144.099) -- 0:00:44
      308500 -- (-1143.304) (-1144.365) (-1149.737) [-1142.221] * (-1142.069) (-1144.508) [-1142.863] (-1142.009) -- 0:00:44
      309000 -- (-1141.720) (-1143.149) (-1144.511) [-1143.372] * [-1141.882] (-1147.745) (-1143.991) (-1143.886) -- 0:00:44
      309500 -- [-1145.205] (-1143.043) (-1143.070) (-1143.684) * (-1142.222) (-1147.133) [-1142.086] (-1145.428) -- 0:00:44
      310000 -- (-1149.533) [-1147.046] (-1148.242) (-1143.528) * (-1142.665) (-1147.349) [-1142.988] (-1145.088) -- 0:00:44

      Average standard deviation of split frequencies: 0.012219

      310500 -- (-1147.830) (-1144.551) (-1146.289) [-1142.557] * (-1141.933) [-1145.380] (-1146.054) (-1142.507) -- 0:00:44
      311000 -- (-1146.676) [-1143.163] (-1143.813) (-1145.030) * (-1141.662) [-1143.175] (-1144.843) (-1142.291) -- 0:00:44
      311500 -- (-1144.559) (-1141.418) (-1146.927) [-1144.220] * (-1141.662) (-1143.065) [-1141.870] (-1146.588) -- 0:00:44
      312000 -- [-1141.750] (-1143.141) (-1143.930) (-1143.740) * (-1141.838) [-1142.089] (-1142.536) (-1144.700) -- 0:00:44
      312500 -- [-1141.381] (-1143.561) (-1142.830) (-1143.520) * [-1143.154] (-1146.499) (-1145.535) (-1142.332) -- 0:00:44
      313000 -- (-1143.550) [-1143.346] (-1143.606) (-1143.086) * [-1143.945] (-1148.431) (-1144.435) (-1143.198) -- 0:00:43
      313500 -- (-1142.828) (-1148.209) (-1143.144) [-1142.330] * (-1146.527) [-1143.769] (-1144.780) (-1144.459) -- 0:00:43
      314000 -- (-1142.828) (-1145.283) [-1142.311] (-1142.561) * (-1147.849) (-1142.613) (-1147.606) [-1144.843] -- 0:00:43
      314500 -- [-1142.817] (-1147.628) (-1144.682) (-1143.155) * [-1145.277] (-1142.160) (-1143.316) (-1144.744) -- 0:00:43
      315000 -- [-1146.177] (-1147.682) (-1142.122) (-1142.909) * (-1147.591) (-1142.656) [-1142.972] (-1146.745) -- 0:00:43

      Average standard deviation of split frequencies: 0.012461

      315500 -- (-1141.675) [-1144.559] (-1142.637) (-1144.627) * (-1145.538) (-1144.128) (-1142.144) [-1145.409] -- 0:00:43
      316000 -- (-1146.115) [-1142.121] (-1142.145) (-1144.605) * (-1142.896) [-1142.938] (-1142.934) (-1147.388) -- 0:00:43
      316500 -- (-1144.399) (-1144.735) (-1144.481) [-1143.314] * (-1146.410) [-1143.010] (-1142.054) (-1143.622) -- 0:00:43
      317000 -- (-1144.584) (-1144.323) [-1141.159] (-1146.408) * (-1150.444) (-1144.262) (-1141.935) [-1144.351] -- 0:00:45
      317500 -- (-1141.496) (-1143.292) [-1141.322] (-1145.254) * (-1142.119) [-1143.132] (-1143.691) (-1143.734) -- 0:00:45
      318000 -- (-1141.392) [-1142.739] (-1144.658) (-1145.314) * (-1143.963) [-1142.936] (-1147.737) (-1142.477) -- 0:00:45
      318500 -- [-1142.906] (-1145.089) (-1141.769) (-1143.567) * (-1143.555) (-1147.682) [-1143.252] (-1144.264) -- 0:00:44
      319000 -- (-1144.070) (-1145.582) (-1143.879) [-1144.337] * (-1142.559) (-1144.992) (-1144.784) [-1143.787] -- 0:00:44
      319500 -- [-1141.928] (-1144.467) (-1141.986) (-1143.172) * (-1143.231) (-1144.261) (-1143.504) [-1142.384] -- 0:00:44
      320000 -- (-1144.838) (-1146.564) (-1141.919) [-1144.228] * (-1145.117) (-1147.474) [-1145.225] (-1142.300) -- 0:00:44

      Average standard deviation of split frequencies: 0.011924

      320500 -- (-1144.034) [-1141.289] (-1142.036) (-1143.664) * [-1143.817] (-1146.406) (-1148.530) (-1141.799) -- 0:00:44
      321000 -- (-1147.914) (-1141.704) [-1141.336] (-1144.602) * (-1145.007) [-1143.451] (-1143.917) (-1143.605) -- 0:00:44
      321500 -- (-1148.701) [-1142.301] (-1142.642) (-1143.978) * (-1142.124) (-1143.332) [-1144.435] (-1144.939) -- 0:00:44
      322000 -- (-1144.404) (-1142.553) [-1142.028] (-1143.660) * [-1145.332] (-1141.947) (-1144.251) (-1141.478) -- 0:00:44
      322500 -- (-1144.006) (-1144.261) [-1142.577] (-1143.274) * (-1142.347) (-1143.078) (-1142.291) [-1141.863] -- 0:00:44
      323000 -- [-1141.988] (-1150.082) (-1143.551) (-1144.578) * (-1142.859) (-1141.571) [-1141.894] (-1141.402) -- 0:00:44
      323500 -- [-1142.374] (-1143.063) (-1145.279) (-1144.769) * [-1141.116] (-1143.727) (-1141.827) (-1142.792) -- 0:00:43
      324000 -- (-1142.811) (-1141.471) (-1143.460) [-1143.144] * [-1141.183] (-1142.104) (-1150.499) (-1150.058) -- 0:00:43
      324500 -- (-1143.761) [-1141.907] (-1142.693) (-1144.267) * [-1142.098] (-1142.783) (-1141.958) (-1144.583) -- 0:00:43
      325000 -- (-1141.944) [-1141.946] (-1147.551) (-1141.937) * (-1142.940) [-1143.317] (-1141.965) (-1146.685) -- 0:00:43

      Average standard deviation of split frequencies: 0.012211

      325500 -- (-1142.046) (-1142.530) [-1143.951] (-1145.652) * (-1143.219) (-1143.211) [-1141.972] (-1144.506) -- 0:00:43
      326000 -- [-1142.580] (-1143.276) (-1142.801) (-1143.168) * (-1142.660) (-1142.409) (-1141.791) [-1142.358] -- 0:00:43
      326500 -- (-1145.875) (-1142.353) (-1141.756) [-1144.025] * [-1145.373] (-1143.123) (-1141.079) (-1141.588) -- 0:00:43
      327000 -- (-1142.931) [-1142.779] (-1142.418) (-1144.608) * (-1144.352) (-1142.993) [-1141.674] (-1141.173) -- 0:00:43
      327500 -- (-1145.302) (-1142.933) [-1142.038] (-1144.748) * (-1144.319) (-1142.386) (-1141.671) [-1142.056] -- 0:00:43
      328000 -- [-1143.054] (-1142.926) (-1142.018) (-1145.123) * [-1142.237] (-1146.206) (-1142.869) (-1142.504) -- 0:00:43
      328500 -- [-1143.524] (-1144.354) (-1141.137) (-1145.070) * [-1146.796] (-1143.749) (-1142.952) (-1143.585) -- 0:00:42
      329000 -- (-1145.008) (-1142.280) [-1141.134] (-1142.260) * [-1143.469] (-1141.998) (-1142.893) (-1142.710) -- 0:00:42
      329500 -- (-1146.663) [-1142.937] (-1141.179) (-1145.706) * (-1143.018) (-1141.554) (-1142.609) [-1144.074] -- 0:00:42
      330000 -- (-1145.048) [-1148.198] (-1142.282) (-1145.872) * (-1142.121) [-1141.772] (-1142.456) (-1146.654) -- 0:00:42

      Average standard deviation of split frequencies: 0.012244

      330500 -- (-1143.667) (-1149.849) [-1143.106] (-1142.451) * (-1141.428) (-1141.633) [-1143.355] (-1144.384) -- 0:00:42
      331000 -- [-1143.309] (-1144.614) (-1141.398) (-1142.907) * (-1143.345) (-1141.155) [-1141.488] (-1144.158) -- 0:00:42
      331500 -- (-1147.866) (-1144.412) [-1142.424] (-1144.613) * [-1143.432] (-1142.020) (-1143.590) (-1148.296) -- 0:00:42
      332000 -- (-1147.195) (-1142.373) (-1144.434) [-1144.662] * (-1142.831) (-1142.977) (-1146.357) [-1143.821] -- 0:00:42
      332500 -- (-1143.599) [-1144.783] (-1144.106) (-1144.019) * [-1142.120] (-1144.490) (-1141.591) (-1141.674) -- 0:00:42
      333000 -- [-1144.729] (-1142.640) (-1144.735) (-1141.907) * (-1142.016) (-1142.234) (-1145.392) [-1141.672] -- 0:00:44
      333500 -- [-1143.740] (-1141.975) (-1143.134) (-1144.689) * (-1142.162) (-1142.185) (-1145.514) [-1141.812] -- 0:00:43
      334000 -- (-1145.422) (-1146.323) [-1143.990] (-1144.962) * [-1145.404] (-1147.179) (-1145.955) (-1144.553) -- 0:00:43
      334500 -- [-1142.232] (-1146.497) (-1143.129) (-1142.260) * (-1145.094) (-1144.257) (-1142.252) [-1142.269] -- 0:00:43
      335000 -- [-1142.434] (-1143.031) (-1144.784) (-1142.568) * (-1144.195) (-1144.322) (-1142.062) [-1144.218] -- 0:00:43

      Average standard deviation of split frequencies: 0.013562

      335500 -- (-1143.513) [-1145.432] (-1142.278) (-1143.558) * (-1144.912) (-1146.453) [-1142.045] (-1147.489) -- 0:00:43
      336000 -- [-1142.152] (-1143.931) (-1142.932) (-1143.552) * [-1143.714] (-1148.758) (-1142.672) (-1142.433) -- 0:00:43
      336500 -- [-1142.628] (-1144.349) (-1143.926) (-1141.822) * (-1142.636) (-1142.696) [-1143.760] (-1142.844) -- 0:00:43
      337000 -- (-1142.727) (-1143.040) [-1142.609] (-1146.651) * (-1143.174) (-1141.444) [-1143.592] (-1143.149) -- 0:00:43
      337500 -- (-1141.601) (-1142.231) (-1141.403) [-1142.424] * (-1142.565) [-1141.297] (-1143.001) (-1142.013) -- 0:00:43
      338000 -- (-1143.478) (-1144.349) [-1143.675] (-1142.822) * (-1143.564) (-1141.271) [-1141.333] (-1146.280) -- 0:00:43
      338500 -- [-1141.095] (-1145.515) (-1142.900) (-1145.224) * (-1149.855) (-1144.619) [-1141.744] (-1146.852) -- 0:00:42
      339000 -- [-1141.544] (-1147.433) (-1144.330) (-1142.038) * (-1143.746) [-1142.365] (-1141.556) (-1144.753) -- 0:00:42
      339500 -- (-1141.609) (-1144.677) (-1146.710) [-1142.029] * (-1144.229) [-1144.136] (-1143.645) (-1147.838) -- 0:00:42
      340000 -- [-1142.457] (-1144.318) (-1144.572) (-1146.229) * (-1143.756) (-1146.884) [-1142.620] (-1144.653) -- 0:00:42

      Average standard deviation of split frequencies: 0.013453

      340500 -- [-1145.092] (-1143.724) (-1146.216) (-1147.831) * (-1141.710) (-1148.088) (-1141.831) [-1142.740] -- 0:00:42
      341000 -- (-1146.281) [-1143.726] (-1143.859) (-1148.447) * (-1142.046) (-1143.762) [-1143.053] (-1144.633) -- 0:00:42
      341500 -- (-1147.706) [-1144.564] (-1143.829) (-1145.477) * (-1144.540) [-1142.844] (-1144.422) (-1143.196) -- 0:00:42
      342000 -- [-1142.988] (-1142.798) (-1141.774) (-1144.160) * (-1144.286) (-1144.399) (-1144.325) [-1142.104] -- 0:00:42
      342500 -- [-1142.236] (-1143.691) (-1143.860) (-1147.951) * (-1146.931) [-1142.836] (-1143.924) (-1143.134) -- 0:00:42
      343000 -- [-1142.019] (-1141.632) (-1142.737) (-1144.831) * (-1145.007) [-1144.753] (-1142.882) (-1144.728) -- 0:00:42
      343500 -- (-1143.678) (-1144.643) [-1142.927] (-1144.133) * (-1142.308) (-1143.408) (-1142.957) [-1143.556] -- 0:00:42
      344000 -- (-1144.649) (-1146.841) [-1143.299] (-1143.070) * [-1142.687] (-1141.585) (-1142.986) (-1145.466) -- 0:00:41
      344500 -- (-1145.390) (-1145.265) [-1142.083] (-1144.473) * (-1142.110) (-1142.545) [-1144.823] (-1144.873) -- 0:00:41
      345000 -- (-1146.023) (-1143.801) (-1142.247) [-1141.861] * (-1142.114) (-1142.991) (-1149.460) [-1144.342] -- 0:00:41

      Average standard deviation of split frequencies: 0.012565

      345500 -- (-1142.657) (-1143.483) (-1142.682) [-1142.355] * (-1143.274) (-1143.029) (-1146.235) [-1142.547] -- 0:00:41
      346000 -- (-1148.568) (-1145.881) (-1142.628) [-1143.021] * (-1146.003) [-1148.770] (-1143.522) (-1141.988) -- 0:00:41
      346500 -- [-1149.286] (-1145.056) (-1142.586) (-1142.347) * (-1142.022) (-1143.029) (-1142.602) [-1141.907] -- 0:00:41
      347000 -- [-1142.508] (-1142.555) (-1145.480) (-1141.908) * (-1141.899) (-1145.792) (-1142.999) [-1145.538] -- 0:00:41
      347500 -- (-1142.431) [-1144.239] (-1147.554) (-1141.184) * (-1143.067) (-1141.982) (-1142.531) [-1145.841] -- 0:00:41
      348000 -- [-1141.608] (-1145.197) (-1149.856) (-1143.168) * [-1141.424] (-1142.171) (-1144.370) (-1144.097) -- 0:00:41
      348500 -- (-1143.782) (-1150.173) (-1144.945) [-1142.700] * (-1144.254) (-1143.086) (-1145.023) [-1141.968] -- 0:00:41
      349000 -- (-1145.075) [-1143.052] (-1143.174) (-1143.729) * [-1143.072] (-1145.253) (-1142.511) (-1143.841) -- 0:00:41
      349500 -- [-1147.953] (-1145.613) (-1143.474) (-1143.193) * (-1142.836) (-1143.835) (-1146.638) [-1145.072] -- 0:00:42
      350000 -- (-1147.515) (-1145.371) [-1145.046] (-1142.382) * (-1146.460) [-1142.299] (-1144.817) (-1144.226) -- 0:00:42

      Average standard deviation of split frequencies: 0.012846

      350500 -- [-1141.771] (-1142.977) (-1143.820) (-1143.056) * (-1141.372) (-1141.877) (-1143.109) [-1143.369] -- 0:00:42
      351000 -- (-1151.273) (-1142.969) [-1144.565] (-1142.287) * (-1144.519) [-1142.670] (-1142.994) (-1141.943) -- 0:00:42
      351500 -- [-1141.830] (-1144.167) (-1148.218) (-1146.300) * [-1145.102] (-1144.277) (-1143.594) (-1141.856) -- 0:00:42
      352000 -- (-1142.801) [-1144.391] (-1149.251) (-1143.755) * (-1146.453) (-1143.322) (-1142.823) [-1141.754] -- 0:00:42
      352500 -- [-1143.573] (-1143.946) (-1143.367) (-1144.432) * (-1146.754) (-1146.616) (-1141.868) [-1143.732] -- 0:00:42
      353000 -- (-1142.482) (-1145.043) (-1144.014) [-1147.929] * (-1141.959) (-1146.422) (-1142.391) [-1143.513] -- 0:00:42
      353500 -- [-1142.539] (-1143.765) (-1146.633) (-1144.559) * (-1141.803) [-1141.715] (-1142.296) (-1143.024) -- 0:00:42
      354000 -- (-1141.178) (-1146.940) (-1141.754) [-1141.931] * (-1142.989) [-1142.569] (-1143.665) (-1143.493) -- 0:00:41
      354500 -- (-1142.290) [-1141.970] (-1141.989) (-1141.842) * (-1142.175) (-1142.694) (-1144.071) [-1143.744] -- 0:00:41
      355000 -- (-1143.954) (-1141.991) [-1141.934] (-1141.129) * (-1144.297) (-1142.745) [-1146.299] (-1143.079) -- 0:00:41

      Average standard deviation of split frequencies: 0.013021

      355500 -- (-1142.375) (-1143.076) [-1142.261] (-1142.324) * (-1148.929) [-1144.234] (-1145.073) (-1144.294) -- 0:00:41
      356000 -- (-1144.497) (-1143.889) [-1144.007] (-1143.332) * [-1141.997] (-1144.443) (-1144.401) (-1145.677) -- 0:00:41
      356500 -- (-1147.443) (-1143.092) (-1143.912) [-1143.439] * (-1142.480) [-1142.138] (-1145.619) (-1145.315) -- 0:00:41
      357000 -- [-1146.962] (-1144.470) (-1143.429) (-1148.235) * (-1143.202) [-1142.256] (-1144.999) (-1143.543) -- 0:00:41
      357500 -- (-1141.366) (-1143.913) [-1145.856] (-1148.958) * (-1145.917) [-1144.015] (-1143.502) (-1143.248) -- 0:00:41
      358000 -- (-1144.565) (-1142.370) [-1143.002] (-1144.421) * [-1141.759] (-1142.465) (-1143.712) (-1143.618) -- 0:00:41
      358500 -- [-1147.525] (-1144.558) (-1143.484) (-1144.703) * (-1147.289) [-1145.144] (-1144.470) (-1144.296) -- 0:00:41
      359000 -- [-1142.871] (-1144.311) (-1142.080) (-1150.751) * (-1147.810) [-1142.688] (-1142.925) (-1144.263) -- 0:00:41
      359500 -- (-1144.525) (-1145.162) [-1145.914] (-1144.495) * (-1148.538) (-1143.507) [-1146.316] (-1145.375) -- 0:00:40
      360000 -- (-1143.677) (-1145.167) [-1149.540] (-1142.912) * (-1150.150) (-1147.015) [-1142.683] (-1148.703) -- 0:00:40

      Average standard deviation of split frequencies: 0.013143

      360500 -- (-1145.340) (-1144.989) (-1147.851) [-1144.497] * (-1141.825) (-1143.213) (-1143.580) [-1145.685] -- 0:00:40
      361000 -- [-1143.991] (-1146.235) (-1143.287) (-1142.768) * [-1141.991] (-1145.663) (-1142.960) (-1141.696) -- 0:00:40
      361500 -- [-1141.741] (-1145.991) (-1141.854) (-1144.129) * (-1141.900) [-1143.306] (-1142.746) (-1141.345) -- 0:00:40
      362000 -- [-1141.686] (-1149.366) (-1142.465) (-1143.707) * [-1142.652] (-1144.431) (-1141.622) (-1141.318) -- 0:00:40
      362500 -- [-1142.151] (-1144.512) (-1142.775) (-1142.214) * (-1142.452) (-1144.262) [-1142.706] (-1143.859) -- 0:00:40
      363000 -- (-1142.581) (-1145.147) [-1143.184] (-1141.982) * (-1141.283) [-1146.695] (-1142.064) (-1142.174) -- 0:00:40
      363500 -- (-1144.621) (-1144.407) (-1142.530) [-1142.293] * (-1144.653) [-1142.547] (-1144.117) (-1141.256) -- 0:00:40
      364000 -- [-1142.148] (-1142.730) (-1143.952) (-1145.273) * (-1141.872) (-1142.006) (-1141.956) [-1141.799] -- 0:00:40
      364500 -- [-1143.572] (-1142.799) (-1142.827) (-1145.943) * (-1144.308) (-1144.060) (-1142.263) [-1141.880] -- 0:00:40
      365000 -- (-1142.171) [-1144.069] (-1143.185) (-1143.040) * (-1143.260) (-1141.960) [-1142.436] (-1144.210) -- 0:00:40

      Average standard deviation of split frequencies: 0.012594

      365500 -- (-1145.879) [-1143.219] (-1144.966) (-1147.559) * (-1141.712) (-1141.451) (-1142.109) [-1142.461] -- 0:00:41
      366000 -- (-1143.905) [-1143.168] (-1142.650) (-1143.518) * [-1141.712] (-1142.280) (-1141.704) (-1142.050) -- 0:00:41
      366500 -- (-1143.160) (-1143.858) (-1143.432) [-1143.942] * (-1143.715) (-1142.581) (-1141.226) [-1142.799] -- 0:00:41
      367000 -- [-1144.865] (-1141.622) (-1142.463) (-1145.987) * (-1145.782) (-1142.176) (-1144.897) [-1141.435] -- 0:00:41
      367500 -- [-1143.529] (-1141.748) (-1146.382) (-1142.800) * (-1142.301) (-1142.712) (-1145.468) [-1141.669] -- 0:00:41
      368000 -- [-1142.119] (-1143.063) (-1142.635) (-1142.834) * [-1144.143] (-1142.351) (-1146.179) (-1145.714) -- 0:00:41
      368500 -- [-1143.969] (-1141.657) (-1143.004) (-1144.489) * [-1145.165] (-1143.791) (-1141.922) (-1143.513) -- 0:00:41
      369000 -- (-1146.494) (-1141.607) [-1143.261] (-1143.560) * (-1143.253) [-1147.684] (-1143.166) (-1144.881) -- 0:00:41
      369500 -- [-1144.871] (-1143.675) (-1141.960) (-1143.922) * (-1143.032) [-1146.542] (-1143.132) (-1142.833) -- 0:00:40
      370000 -- (-1142.554) (-1141.963) [-1153.737] (-1145.538) * (-1143.549) (-1148.172) (-1141.656) [-1145.807] -- 0:00:40

      Average standard deviation of split frequencies: 0.011915

      370500 -- (-1144.261) (-1144.734) [-1143.870] (-1145.690) * [-1142.053] (-1146.984) (-1142.062) (-1143.255) -- 0:00:40
      371000 -- (-1142.770) (-1143.362) [-1147.194] (-1149.111) * (-1144.635) (-1144.117) (-1142.363) [-1142.474] -- 0:00:40
      371500 -- [-1144.217] (-1143.474) (-1143.556) (-1145.122) * [-1143.331] (-1143.748) (-1144.032) (-1146.043) -- 0:00:40
      372000 -- (-1143.287) [-1143.921] (-1143.709) (-1144.966) * (-1142.511) (-1143.009) (-1145.739) [-1142.464] -- 0:00:40
      372500 -- (-1142.864) [-1148.025] (-1146.745) (-1143.666) * (-1144.035) [-1148.277] (-1142.062) (-1144.358) -- 0:00:40
      373000 -- (-1142.334) (-1145.492) [-1144.760] (-1142.441) * [-1145.597] (-1144.361) (-1142.538) (-1143.952) -- 0:00:40
      373500 -- (-1145.547) [-1144.109] (-1146.752) (-1145.966) * [-1143.463] (-1143.644) (-1142.538) (-1148.119) -- 0:00:40
      374000 -- [-1145.605] (-1144.566) (-1146.749) (-1144.644) * (-1141.865) [-1142.226] (-1141.802) (-1146.434) -- 0:00:40
      374500 -- (-1141.441) [-1143.450] (-1144.888) (-1144.501) * (-1141.450) [-1142.166] (-1144.924) (-1146.126) -- 0:00:40
      375000 -- [-1143.176] (-1143.546) (-1143.734) (-1142.877) * (-1142.775) (-1142.173) (-1144.518) [-1143.273] -- 0:00:40

      Average standard deviation of split frequencies: 0.012398

      375500 -- (-1143.187) (-1142.804) [-1143.665] (-1143.279) * (-1143.606) [-1143.064] (-1141.661) (-1141.603) -- 0:00:39
      376000 -- (-1143.793) [-1141.446] (-1145.511) (-1142.080) * (-1141.711) [-1142.134] (-1143.384) (-1143.941) -- 0:00:39
      376500 -- (-1144.134) [-1142.873] (-1144.335) (-1142.994) * (-1142.641) [-1141.830] (-1143.286) (-1142.816) -- 0:00:39
      377000 -- (-1141.819) (-1142.245) [-1142.289] (-1143.705) * [-1141.379] (-1142.463) (-1146.032) (-1143.999) -- 0:00:39
      377500 -- (-1141.767) (-1142.089) (-1143.661) [-1143.579] * (-1144.119) (-1143.457) [-1142.616] (-1153.288) -- 0:00:39
      378000 -- (-1143.101) [-1142.262] (-1146.236) (-1145.621) * (-1143.197) (-1142.499) [-1142.348] (-1146.675) -- 0:00:39
      378500 -- [-1142.664] (-1149.454) (-1145.982) (-1146.799) * (-1143.810) (-1143.793) (-1145.617) [-1144.555] -- 0:00:39
      379000 -- (-1143.332) (-1142.188) (-1143.304) [-1143.812] * (-1144.038) [-1143.308] (-1143.436) (-1143.606) -- 0:00:39
      379500 -- (-1143.047) [-1143.499] (-1141.869) (-1142.658) * (-1144.796) (-1147.242) (-1143.416) [-1144.122] -- 0:00:39
      380000 -- (-1143.542) (-1143.931) (-1142.585) [-1142.091] * (-1141.250) (-1144.420) (-1143.962) [-1143.183] -- 0:00:39

      Average standard deviation of split frequencies: 0.011997

      380500 -- (-1142.743) [-1142.931] (-1142.761) (-1146.551) * (-1143.199) [-1146.635] (-1143.876) (-1145.573) -- 0:00:39
      381000 -- (-1142.149) [-1143.816] (-1145.255) (-1142.921) * (-1143.649) (-1141.005) [-1143.341] (-1146.431) -- 0:00:38
      381500 -- (-1144.579) (-1144.460) (-1143.160) [-1142.813] * (-1142.921) [-1141.692] (-1143.303) (-1142.217) -- 0:00:40
      382000 -- [-1141.586] (-1143.909) (-1143.504) (-1144.241) * (-1141.683) (-1145.015) (-1142.796) [-1142.124] -- 0:00:40
      382500 -- (-1142.788) (-1146.263) (-1141.880) [-1143.816] * (-1141.619) [-1141.666] (-1144.884) (-1143.693) -- 0:00:40
      383000 -- (-1142.762) (-1145.361) (-1144.052) [-1142.582] * (-1142.421) (-1143.524) [-1144.097] (-1141.669) -- 0:00:40
      383500 -- (-1143.032) (-1142.757) [-1151.594] (-1142.311) * [-1141.735] (-1147.972) (-1143.364) (-1149.971) -- 0:00:40
      384000 -- (-1146.068) [-1142.425] (-1146.928) (-1142.975) * [-1142.188] (-1144.434) (-1142.612) (-1143.133) -- 0:00:40
      384500 -- (-1143.685) [-1142.454] (-1143.638) (-1143.046) * [-1141.756] (-1142.900) (-1142.724) (-1142.442) -- 0:00:40
      385000 -- (-1144.305) [-1143.070] (-1143.849) (-1146.693) * (-1142.557) [-1142.443] (-1144.934) (-1142.168) -- 0:00:39

      Average standard deviation of split frequencies: 0.012416

      385500 -- [-1142.601] (-1143.264) (-1146.123) (-1142.024) * (-1143.683) [-1142.772] (-1144.101) (-1143.668) -- 0:00:39
      386000 -- (-1141.637) [-1143.119] (-1147.521) (-1142.342) * [-1142.648] (-1142.375) (-1148.344) (-1144.439) -- 0:00:39
      386500 -- [-1142.375] (-1145.224) (-1145.126) (-1145.729) * (-1143.173) (-1143.743) [-1143.012] (-1142.950) -- 0:00:39
      387000 -- (-1143.819) [-1143.983] (-1145.001) (-1141.871) * (-1143.085) (-1143.846) (-1143.676) [-1142.594] -- 0:00:39
      387500 -- (-1141.427) [-1143.025] (-1141.923) (-1143.957) * (-1145.712) [-1143.039] (-1142.626) (-1141.417) -- 0:00:39
      388000 -- [-1141.863] (-1144.597) (-1146.303) (-1144.262) * (-1143.729) (-1141.863) [-1143.154] (-1141.092) -- 0:00:39
      388500 -- (-1142.240) (-1144.432) [-1149.231] (-1143.770) * [-1143.224] (-1142.600) (-1142.944) (-1143.047) -- 0:00:39
      389000 -- [-1141.975] (-1148.574) (-1144.767) (-1144.482) * (-1146.069) [-1141.637] (-1141.859) (-1141.671) -- 0:00:39
      389500 -- (-1141.955) (-1146.340) (-1146.268) [-1146.569] * (-1143.570) (-1145.528) [-1147.408] (-1142.838) -- 0:00:39
      390000 -- [-1142.012] (-1144.567) (-1145.095) (-1145.925) * (-1147.308) [-1143.864] (-1142.229) (-1143.585) -- 0:00:39

      Average standard deviation of split frequencies: 0.012134

      390500 -- (-1141.712) (-1145.276) [-1142.536] (-1146.198) * (-1144.095) (-1145.066) [-1141.552] (-1145.023) -- 0:00:39
      391000 -- (-1143.085) [-1142.537] (-1142.537) (-1144.342) * (-1142.579) (-1146.262) [-1141.268] (-1142.148) -- 0:00:38
      391500 -- [-1141.962] (-1143.347) (-1141.896) (-1141.961) * (-1144.895) (-1146.473) [-1142.065] (-1142.127) -- 0:00:38
      392000 -- [-1143.301] (-1146.516) (-1143.912) (-1142.204) * [-1144.313] (-1145.425) (-1145.081) (-1142.501) -- 0:00:38
      392500 -- [-1142.239] (-1143.546) (-1143.331) (-1141.990) * (-1150.090) (-1143.803) (-1142.306) [-1142.742] -- 0:00:38
      393000 -- (-1143.232) (-1145.979) (-1141.581) [-1143.853] * (-1150.412) (-1142.069) [-1141.844] (-1141.879) -- 0:00:38
      393500 -- (-1142.576) [-1144.583] (-1142.117) (-1143.675) * (-1144.670) (-1141.923) (-1141.546) [-1145.303] -- 0:00:38
      394000 -- (-1142.785) [-1144.484] (-1145.033) (-1143.231) * [-1142.189] (-1141.446) (-1141.524) (-1143.115) -- 0:00:38
      394500 -- (-1141.696) (-1142.577) [-1142.041] (-1152.492) * (-1151.366) (-1141.443) [-1141.815] (-1142.986) -- 0:00:38
      395000 -- [-1141.595] (-1142.088) (-1142.164) (-1144.325) * (-1143.601) (-1142.941) (-1144.492) [-1142.200] -- 0:00:38

      Average standard deviation of split frequencies: 0.011904

      395500 -- [-1143.806] (-1142.342) (-1143.982) (-1142.788) * (-1147.542) (-1143.866) [-1146.339] (-1142.259) -- 0:00:38
      396000 -- [-1141.429] (-1141.759) (-1144.411) (-1142.117) * (-1144.433) (-1143.817) (-1144.459) [-1142.468] -- 0:00:38
      396500 -- (-1143.431) [-1146.244] (-1143.766) (-1141.949) * [-1142.541] (-1143.789) (-1142.024) (-1146.376) -- 0:00:38
      397000 -- [-1143.956] (-1144.045) (-1142.936) (-1144.490) * (-1144.926) [-1145.718] (-1141.934) (-1146.113) -- 0:00:37
      397500 -- (-1143.548) [-1141.721] (-1143.337) (-1142.922) * [-1147.088] (-1145.299) (-1141.410) (-1147.006) -- 0:00:39
      398000 -- (-1144.679) [-1143.222] (-1144.188) (-1143.234) * [-1142.468] (-1144.891) (-1141.976) (-1146.086) -- 0:00:39
      398500 -- (-1146.743) (-1142.794) [-1142.709] (-1142.749) * (-1143.674) (-1143.937) [-1144.361] (-1148.072) -- 0:00:39
      399000 -- [-1146.938] (-1143.637) (-1144.016) (-1143.509) * (-1144.280) (-1144.788) (-1144.827) [-1144.467] -- 0:00:39
      399500 -- (-1142.575) (-1144.707) (-1143.918) [-1145.891] * (-1146.362) (-1146.182) (-1143.636) [-1143.610] -- 0:00:39
      400000 -- (-1141.731) (-1143.869) (-1142.682) [-1147.533] * [-1143.733] (-1143.571) (-1144.375) (-1142.219) -- 0:00:39

      Average standard deviation of split frequencies: 0.013080

      400500 -- (-1143.724) (-1144.576) [-1142.272] (-1144.852) * (-1144.350) (-1142.504) [-1144.896] (-1142.567) -- 0:00:38
      401000 -- (-1144.262) (-1144.995) [-1141.530] (-1143.662) * [-1143.080] (-1144.247) (-1141.730) (-1141.530) -- 0:00:38
      401500 -- (-1149.097) [-1142.843] (-1141.313) (-1144.522) * [-1145.116] (-1143.841) (-1141.760) (-1145.743) -- 0:00:38
      402000 -- (-1147.561) [-1144.430] (-1141.312) (-1146.617) * (-1144.895) (-1142.522) (-1142.406) [-1145.477] -- 0:00:38
      402500 -- (-1141.434) [-1146.573] (-1141.271) (-1147.128) * (-1144.735) (-1142.785) [-1142.411] (-1144.704) -- 0:00:38
      403000 -- (-1142.815) [-1145.529] (-1142.571) (-1144.856) * (-1141.782) [-1141.721] (-1142.061) (-1144.067) -- 0:00:38
      403500 -- [-1141.977] (-1147.019) (-1141.782) (-1143.915) * (-1142.119) (-1141.961) (-1144.683) [-1145.698] -- 0:00:38
      404000 -- (-1143.485) (-1145.614) (-1141.635) [-1144.049] * (-1142.190) (-1142.063) [-1142.711] (-1145.336) -- 0:00:38
      404500 -- (-1151.118) (-1144.004) (-1143.953) [-1144.096] * (-1149.221) (-1142.706) [-1142.737] (-1143.639) -- 0:00:38
      405000 -- (-1147.125) (-1147.071) [-1143.266] (-1144.176) * [-1149.704] (-1144.350) (-1146.965) (-1143.171) -- 0:00:38

      Average standard deviation of split frequencies: 0.013546

      405500 -- (-1141.630) (-1141.882) [-1142.662] (-1144.860) * (-1145.792) (-1143.044) (-1144.243) [-1142.316] -- 0:00:38
      406000 -- (-1142.166) (-1141.987) (-1141.673) [-1146.134] * (-1144.130) (-1142.434) [-1142.272] (-1143.092) -- 0:00:38
      406500 -- [-1145.789] (-1144.914) (-1145.739) (-1144.718) * (-1144.062) (-1142.734) (-1146.698) [-1143.087] -- 0:00:37
      407000 -- (-1147.882) (-1141.107) [-1144.308] (-1143.049) * (-1145.401) (-1142.656) (-1146.455) [-1143.117] -- 0:00:37
      407500 -- (-1142.142) (-1143.288) [-1143.837] (-1142.277) * (-1147.442) [-1143.591] (-1143.877) (-1141.700) -- 0:00:37
      408000 -- (-1144.302) [-1143.911] (-1142.994) (-1144.307) * (-1146.280) (-1143.984) (-1142.804) [-1144.953] -- 0:00:37
      408500 -- (-1144.613) (-1146.363) (-1141.535) [-1143.522] * (-1143.137) [-1142.169] (-1142.071) (-1143.825) -- 0:00:37
      409000 -- (-1142.735) [-1146.283] (-1141.849) (-1142.242) * (-1154.032) (-1143.083) (-1144.459) [-1143.510] -- 0:00:37
      409500 -- (-1142.317) [-1142.717] (-1143.069) (-1144.793) * (-1145.441) [-1144.285] (-1142.195) (-1144.160) -- 0:00:37
      410000 -- (-1142.161) (-1143.005) [-1143.936] (-1142.623) * (-1143.087) (-1144.648) [-1144.208] (-1144.286) -- 0:00:37

      Average standard deviation of split frequencies: 0.014094

      410500 -- (-1142.268) [-1150.010] (-1142.266) (-1141.435) * [-1141.070] (-1144.921) (-1147.974) (-1142.930) -- 0:00:37
      411000 -- [-1142.226] (-1143.522) (-1143.456) (-1141.643) * [-1141.243] (-1146.895) (-1144.019) (-1143.573) -- 0:00:37
      411500 -- (-1142.431) (-1142.999) (-1148.365) [-1143.285] * [-1141.790] (-1146.917) (-1144.259) (-1143.948) -- 0:00:37
      412000 -- [-1142.396] (-1143.123) (-1144.683) (-1141.201) * (-1144.748) (-1143.560) (-1144.132) [-1143.448] -- 0:00:37
      412500 -- (-1145.982) [-1144.723] (-1143.795) (-1147.875) * (-1144.143) [-1145.734] (-1143.694) (-1142.789) -- 0:00:37
      413000 -- (-1143.656) (-1143.362) [-1144.338] (-1142.293) * [-1142.623] (-1147.547) (-1146.210) (-1143.355) -- 0:00:38
      413500 -- [-1143.558] (-1144.255) (-1145.437) (-1143.174) * (-1142.127) (-1142.774) (-1144.907) [-1145.959] -- 0:00:38
      414000 -- [-1143.856] (-1144.660) (-1146.999) (-1141.538) * [-1145.217] (-1142.031) (-1149.139) (-1148.046) -- 0:00:38
      414500 -- (-1143.959) (-1144.723) (-1143.528) [-1141.172] * (-1143.601) [-1143.000] (-1144.262) (-1146.264) -- 0:00:38
      415000 -- (-1149.454) (-1146.316) (-1142.042) [-1141.221] * (-1145.788) [-1146.198] (-1141.582) (-1144.220) -- 0:00:38

      Average standard deviation of split frequencies: 0.013472

      415500 -- (-1146.321) [-1143.435] (-1141.431) (-1142.543) * (-1142.069) (-1143.421) [-1142.519] (-1142.361) -- 0:00:37
      416000 -- (-1143.840) (-1143.481) (-1141.464) [-1145.264] * (-1144.401) (-1143.089) (-1144.294) [-1144.020] -- 0:00:37
      416500 -- [-1143.828] (-1144.374) (-1142.101) (-1144.383) * (-1143.112) (-1144.125) (-1151.187) [-1141.441] -- 0:00:37
      417000 -- (-1145.371) (-1147.597) (-1142.134) [-1144.247] * (-1143.695) (-1143.222) [-1142.733] (-1143.784) -- 0:00:37
      417500 -- [-1143.673] (-1143.286) (-1143.488) (-1145.500) * (-1144.336) [-1145.495] (-1143.037) (-1143.264) -- 0:00:37
      418000 -- [-1142.013] (-1149.673) (-1142.033) (-1147.016) * (-1144.787) [-1148.682] (-1143.087) (-1146.209) -- 0:00:37
      418500 -- (-1151.035) (-1144.363) (-1143.387) [-1141.786] * (-1143.958) (-1142.895) [-1141.086] (-1150.942) -- 0:00:37
      419000 -- (-1147.825) [-1142.222] (-1143.626) (-1145.846) * (-1145.530) [-1145.045] (-1141.184) (-1151.520) -- 0:00:37
      419500 -- (-1143.004) (-1149.771) (-1143.972) [-1146.762] * (-1141.705) (-1146.041) [-1142.576] (-1142.392) -- 0:00:37
      420000 -- (-1142.134) (-1144.544) [-1143.096] (-1143.490) * (-1143.205) [-1141.769] (-1141.298) (-1142.255) -- 0:00:37

      Average standard deviation of split frequencies: 0.013385

      420500 -- (-1142.619) (-1149.701) (-1143.236) [-1142.026] * (-1145.687) (-1141.929) [-1141.298] (-1142.909) -- 0:00:37
      421000 -- (-1142.102) (-1143.706) (-1141.592) [-1142.252] * (-1145.180) (-1141.510) (-1141.281) [-1145.265] -- 0:00:37
      421500 -- (-1143.718) [-1141.945] (-1142.868) (-1142.111) * (-1144.881) (-1141.768) [-1141.353] (-1145.095) -- 0:00:37
      422000 -- (-1144.111) (-1143.695) (-1142.417) [-1141.914] * (-1144.303) [-1142.226] (-1142.266) (-1145.682) -- 0:00:36
      422500 -- (-1143.717) (-1144.790) (-1141.657) [-1143.962] * (-1142.089) (-1142.186) [-1146.012] (-1141.607) -- 0:00:36
      423000 -- (-1142.153) (-1145.225) (-1146.132) [-1142.671] * (-1144.753) (-1142.661) (-1142.755) [-1140.984] -- 0:00:36
      423500 -- (-1142.261) (-1143.012) [-1145.616] (-1148.184) * (-1143.821) (-1142.772) (-1141.997) [-1146.635] -- 0:00:36
      424000 -- (-1142.625) (-1146.722) (-1143.658) [-1148.405] * (-1141.618) (-1142.478) [-1143.333] (-1142.588) -- 0:00:36
      424500 -- (-1142.546) (-1144.526) [-1142.671] (-1147.269) * (-1144.039) (-1143.431) (-1142.396) [-1142.413] -- 0:00:36
      425000 -- [-1141.755] (-1144.361) (-1141.865) (-1142.529) * [-1141.823] (-1142.207) (-1142.189) (-1142.254) -- 0:00:36

      Average standard deviation of split frequencies: 0.012787

      425500 -- (-1142.418) [-1141.931] (-1143.381) (-1143.104) * (-1142.079) (-1141.906) (-1142.004) [-1142.295] -- 0:00:36
      426000 -- (-1144.691) (-1147.276) (-1142.834) [-1142.710] * (-1146.112) (-1146.563) [-1141.847] (-1144.585) -- 0:00:36
      426500 -- (-1144.142) [-1142.156] (-1143.824) (-1142.201) * [-1145.554] (-1141.387) (-1144.382) (-1141.910) -- 0:00:36
      427000 -- (-1141.852) (-1141.330) [-1145.267] (-1143.158) * (-1143.589) (-1144.557) (-1143.443) [-1141.381] -- 0:00:36
      427500 -- (-1143.891) [-1145.322] (-1142.598) (-1145.918) * (-1142.730) (-1145.385) (-1143.207) [-1142.715] -- 0:00:36
      428000 -- (-1142.940) (-1144.887) [-1143.787] (-1141.660) * [-1141.559] (-1147.156) (-1142.693) (-1147.803) -- 0:00:36
      428500 -- (-1144.775) (-1144.207) [-1143.779] (-1141.554) * (-1142.456) (-1150.598) [-1142.003] (-1145.065) -- 0:00:36
      429000 -- (-1142.670) (-1143.676) (-1141.349) [-1144.120] * (-1142.238) (-1142.205) [-1142.213] (-1145.652) -- 0:00:37
      429500 -- [-1142.362] (-1143.368) (-1143.610) (-1143.649) * (-1143.798) (-1142.880) (-1144.554) [-1143.130] -- 0:00:37
      430000 -- (-1144.815) [-1146.304] (-1143.216) (-1141.775) * (-1144.002) [-1146.421] (-1144.066) (-1142.331) -- 0:00:37

      Average standard deviation of split frequencies: 0.013135

      430500 -- (-1149.647) (-1148.125) (-1141.981) [-1141.435] * (-1142.439) (-1143.812) (-1143.972) [-1143.363] -- 0:00:37
      431000 -- (-1146.165) [-1142.450] (-1144.281) (-1144.846) * [-1144.545] (-1143.330) (-1143.112) (-1147.388) -- 0:00:36
      431500 -- (-1146.185) [-1143.234] (-1142.610) (-1142.172) * [-1143.929] (-1143.369) (-1142.476) (-1143.027) -- 0:00:36
      432000 -- [-1144.165] (-1141.878) (-1142.572) (-1145.060) * (-1143.628) [-1144.075] (-1144.237) (-1146.648) -- 0:00:36
      432500 -- (-1142.853) [-1142.151] (-1142.624) (-1142.013) * (-1143.606) [-1142.625] (-1142.528) (-1144.197) -- 0:00:36
      433000 -- [-1144.427] (-1141.479) (-1142.221) (-1144.370) * [-1142.932] (-1142.843) (-1142.557) (-1143.741) -- 0:00:36
      433500 -- [-1141.908] (-1142.115) (-1144.811) (-1141.902) * (-1142.214) [-1143.344] (-1147.324) (-1143.798) -- 0:00:36
      434000 -- (-1142.629) [-1144.102] (-1148.689) (-1142.128) * (-1143.861) (-1144.240) (-1146.898) [-1142.297] -- 0:00:36
      434500 -- (-1143.200) (-1146.307) (-1148.293) [-1142.619] * (-1143.897) (-1145.381) [-1145.486] (-1144.721) -- 0:00:36
      435000 -- (-1144.850) (-1142.115) (-1148.193) [-1142.512] * (-1142.031) [-1142.925] (-1143.351) (-1143.593) -- 0:00:36

      Average standard deviation of split frequencies: 0.013455

      435500 -- (-1141.383) (-1149.202) [-1145.286] (-1146.141) * (-1143.309) (-1143.655) (-1142.055) [-1143.628] -- 0:00:36
      436000 -- (-1142.950) (-1143.572) [-1142.218] (-1147.912) * (-1143.291) [-1146.764] (-1142.224) (-1143.547) -- 0:00:36
      436500 -- (-1141.583) [-1142.963] (-1143.267) (-1146.859) * [-1142.911] (-1148.495) (-1142.331) (-1142.190) -- 0:00:36
      437000 -- (-1143.417) (-1144.420) (-1143.685) [-1146.152] * (-1142.079) (-1143.605) [-1142.285] (-1142.826) -- 0:00:36
      437500 -- (-1143.502) (-1145.535) [-1145.330] (-1147.469) * [-1144.595] (-1146.022) (-1141.779) (-1146.440) -- 0:00:36
      438000 -- (-1144.649) (-1143.927) [-1144.120] (-1142.524) * (-1145.603) (-1144.698) (-1142.031) [-1144.943] -- 0:00:35
      438500 -- (-1142.942) (-1143.929) (-1142.766) [-1142.351] * (-1145.402) (-1143.799) [-1141.678] (-1144.735) -- 0:00:35
      439000 -- (-1142.342) (-1143.530) (-1142.860) [-1142.039] * (-1144.625) (-1146.140) [-1141.557] (-1144.301) -- 0:00:35
      439500 -- (-1142.352) [-1143.246] (-1142.960) (-1145.311) * (-1146.603) [-1142.670] (-1141.443) (-1141.285) -- 0:00:35
      440000 -- (-1141.486) [-1144.390] (-1144.170) (-1144.218) * (-1147.063) (-1143.410) (-1141.487) [-1142.562] -- 0:00:35

      Average standard deviation of split frequencies: 0.013847

      440500 -- (-1144.063) (-1147.181) (-1143.419) [-1141.782] * (-1145.599) (-1142.258) (-1143.116) [-1143.692] -- 0:00:35
      441000 -- (-1142.836) [-1144.155] (-1142.025) (-1141.511) * (-1142.298) (-1143.706) [-1142.930] (-1142.951) -- 0:00:35
      441500 -- (-1144.948) (-1143.390) [-1144.311] (-1143.452) * (-1142.546) (-1143.922) (-1143.038) [-1143.587] -- 0:00:35
      442000 -- (-1144.930) [-1144.969] (-1144.062) (-1144.793) * [-1142.224] (-1142.268) (-1144.464) (-1142.673) -- 0:00:35
      442500 -- (-1143.366) (-1145.944) (-1145.576) [-1143.183] * [-1142.033] (-1145.093) (-1142.136) (-1142.401) -- 0:00:35
      443000 -- (-1142.221) (-1142.434) (-1144.438) [-1144.671] * [-1145.392] (-1145.425) (-1144.062) (-1142.736) -- 0:00:35
      443500 -- (-1142.083) (-1143.593) [-1143.754] (-1148.577) * (-1144.268) [-1142.212] (-1144.547) (-1143.503) -- 0:00:35
      444000 -- [-1143.024] (-1141.944) (-1142.203) (-1150.454) * [-1141.221] (-1141.947) (-1141.989) (-1141.813) -- 0:00:35
      444500 -- [-1143.877] (-1142.723) (-1142.065) (-1143.651) * (-1141.948) (-1143.449) [-1142.890] (-1142.016) -- 0:00:34
      445000 -- (-1145.824) (-1142.101) (-1141.838) [-1142.214] * (-1142.050) [-1141.899] (-1144.334) (-1142.043) -- 0:00:36

      Average standard deviation of split frequencies: 0.013564

      445500 -- (-1142.976) (-1143.978) (-1143.663) [-1143.355] * (-1141.708) (-1145.212) (-1147.852) [-1145.327] -- 0:00:36
      446000 -- [-1141.774] (-1144.076) (-1149.255) (-1143.918) * (-1143.048) (-1143.176) [-1148.150] (-1143.589) -- 0:00:36
      446500 -- [-1142.939] (-1144.757) (-1144.081) (-1142.888) * [-1142.631] (-1143.812) (-1142.444) (-1143.889) -- 0:00:35
      447000 -- [-1142.245] (-1141.085) (-1144.812) (-1144.518) * (-1144.697) (-1144.156) [-1142.988] (-1146.157) -- 0:00:35
      447500 -- (-1143.837) [-1141.546] (-1147.483) (-1145.732) * (-1144.284) [-1144.559] (-1142.716) (-1147.584) -- 0:00:35
      448000 -- (-1143.092) (-1142.991) [-1147.311] (-1141.983) * (-1142.648) (-1144.847) (-1143.090) [-1144.904] -- 0:00:35
      448500 -- (-1144.694) (-1143.410) [-1143.177] (-1142.499) * [-1142.830] (-1144.558) (-1142.187) (-1143.192) -- 0:00:35
      449000 -- (-1142.745) (-1145.081) [-1142.668] (-1141.514) * [-1142.186] (-1145.177) (-1142.187) (-1143.749) -- 0:00:35
      449500 -- (-1149.870) (-1142.223) [-1141.872] (-1141.538) * [-1142.317] (-1143.039) (-1142.309) (-1143.255) -- 0:00:35
      450000 -- (-1142.453) [-1142.393] (-1143.237) (-1143.056) * [-1142.928] (-1144.078) (-1143.132) (-1141.557) -- 0:00:35

      Average standard deviation of split frequencies: 0.014237

      450500 -- [-1143.004] (-1143.111) (-1144.308) (-1143.027) * (-1142.630) [-1145.134] (-1143.562) (-1144.758) -- 0:00:35
      451000 -- (-1141.740) (-1142.413) (-1145.724) [-1142.622] * (-1141.953) (-1142.333) (-1142.747) [-1142.514] -- 0:00:35
      451500 -- (-1142.465) (-1144.728) (-1145.428) [-1144.072] * [-1145.255] (-1144.043) (-1144.625) (-1143.039) -- 0:00:35
      452000 -- (-1143.506) [-1145.494] (-1145.569) (-1143.154) * (-1143.003) (-1144.415) [-1144.830] (-1146.409) -- 0:00:35
      452500 -- (-1142.241) (-1143.017) [-1143.140] (-1143.718) * (-1142.264) (-1150.225) [-1147.582] (-1146.569) -- 0:00:35
      453000 -- (-1142.250) (-1141.930) (-1143.677) [-1142.186] * (-1145.023) (-1148.200) (-1146.644) [-1145.072] -- 0:00:35
      453500 -- (-1145.149) (-1142.460) [-1144.568] (-1143.100) * (-1143.314) (-1142.897) [-1143.709] (-1149.211) -- 0:00:34
      454000 -- (-1143.563) (-1141.717) [-1141.688] (-1141.934) * (-1142.708) [-1141.919] (-1142.750) (-1146.009) -- 0:00:34
      454500 -- (-1144.405) (-1144.560) (-1142.157) [-1142.167] * (-1142.137) [-1142.687] (-1142.397) (-1143.339) -- 0:00:34
      455000 -- [-1144.988] (-1143.148) (-1143.147) (-1144.828) * (-1144.560) [-1142.797] (-1143.562) (-1143.810) -- 0:00:34

      Average standard deviation of split frequencies: 0.013497

      455500 -- [-1146.811] (-1142.666) (-1144.558) (-1143.305) * [-1142.366] (-1144.647) (-1142.135) (-1146.884) -- 0:00:34
      456000 -- (-1141.949) (-1142.816) (-1146.753) [-1144.801] * [-1141.290] (-1142.878) (-1142.640) (-1145.138) -- 0:00:34
      456500 -- [-1142.056] (-1143.326) (-1142.594) (-1144.498) * [-1144.081] (-1142.845) (-1141.288) (-1147.594) -- 0:00:34
      457000 -- (-1143.001) (-1143.054) [-1144.839] (-1143.357) * [-1144.295] (-1144.366) (-1142.089) (-1145.481) -- 0:00:34
      457500 -- [-1143.536] (-1146.217) (-1142.875) (-1143.911) * [-1143.845] (-1142.307) (-1142.313) (-1145.838) -- 0:00:34
      458000 -- (-1143.059) (-1143.860) (-1143.776) [-1143.775] * (-1142.225) [-1143.162] (-1142.943) (-1144.427) -- 0:00:34
      458500 -- (-1144.476) [-1141.499] (-1148.589) (-1144.283) * (-1144.044) [-1143.281] (-1143.037) (-1141.827) -- 0:00:34
      459000 -- (-1144.322) [-1142.934] (-1144.384) (-1142.516) * [-1146.490] (-1142.365) (-1144.114) (-1141.620) -- 0:00:34
      459500 -- (-1142.236) (-1145.854) (-1142.238) [-1142.107] * [-1147.104] (-1143.528) (-1143.995) (-1142.241) -- 0:00:34
      460000 -- (-1143.421) (-1142.805) [-1142.371] (-1144.821) * (-1146.996) [-1141.482] (-1143.655) (-1143.089) -- 0:00:34

      Average standard deviation of split frequencies: 0.013758

      460500 -- (-1142.786) (-1141.187) [-1142.427] (-1145.658) * (-1149.538) (-1141.851) [-1142.029] (-1144.562) -- 0:00:33
      461000 -- (-1143.474) (-1141.238) (-1142.521) [-1143.741] * (-1145.885) (-1141.797) [-1142.263] (-1142.998) -- 0:00:35
      461500 -- [-1142.348] (-1141.608) (-1142.780) (-1145.771) * (-1144.023) (-1142.051) [-1144.369] (-1142.122) -- 0:00:35
      462000 -- [-1144.373] (-1144.161) (-1142.806) (-1144.852) * [-1143.543] (-1144.694) (-1142.196) (-1144.771) -- 0:00:34
      462500 -- [-1144.957] (-1143.757) (-1142.354) (-1142.548) * [-1141.039] (-1143.402) (-1143.205) (-1143.186) -- 0:00:34
      463000 -- [-1143.010] (-1144.348) (-1141.483) (-1142.022) * (-1143.068) (-1141.979) [-1143.942] (-1145.583) -- 0:00:34
      463500 -- (-1142.491) [-1141.278] (-1141.487) (-1144.220) * [-1142.350] (-1143.203) (-1144.639) (-1147.874) -- 0:00:34
      464000 -- (-1141.663) [-1142.931] (-1144.579) (-1145.247) * (-1145.894) (-1142.097) (-1143.491) [-1147.988] -- 0:00:34
      464500 -- [-1146.587] (-1141.939) (-1142.028) (-1145.342) * (-1147.611) [-1141.929] (-1144.115) (-1143.734) -- 0:00:34
      465000 -- [-1143.025] (-1143.488) (-1142.949) (-1147.139) * (-1142.129) [-1143.264] (-1141.653) (-1146.915) -- 0:00:34

      Average standard deviation of split frequencies: 0.012814

      465500 -- (-1143.208) [-1144.290] (-1141.253) (-1143.478) * [-1141.976] (-1145.995) (-1144.854) (-1144.140) -- 0:00:34
      466000 -- (-1143.192) [-1142.923] (-1141.420) (-1143.742) * (-1144.585) (-1145.816) [-1146.009] (-1148.189) -- 0:00:34
      466500 -- (-1143.624) [-1143.292] (-1142.017) (-1142.867) * (-1143.257) [-1143.721] (-1145.752) (-1145.151) -- 0:00:34
      467000 -- [-1144.470] (-1143.414) (-1142.248) (-1143.376) * [-1143.415] (-1142.201) (-1142.546) (-1146.018) -- 0:00:34
      467500 -- (-1142.096) (-1145.504) [-1142.867] (-1144.577) * (-1143.096) (-1146.794) (-1144.230) [-1142.308] -- 0:00:34
      468000 -- (-1144.343) (-1143.932) [-1142.339] (-1143.721) * [-1141.243] (-1142.925) (-1143.979) (-1143.176) -- 0:00:34
      468500 -- [-1142.777] (-1145.314) (-1142.084) (-1149.488) * [-1141.716] (-1143.565) (-1142.249) (-1142.793) -- 0:00:34
      469000 -- (-1143.340) (-1142.549) [-1143.670] (-1145.194) * (-1141.588) (-1142.170) [-1145.780] (-1148.077) -- 0:00:33
      469500 -- (-1145.374) [-1148.880] (-1142.698) (-1145.002) * [-1141.705] (-1144.949) (-1146.848) (-1145.455) -- 0:00:33
      470000 -- (-1145.485) [-1143.668] (-1142.198) (-1144.380) * (-1142.025) (-1145.189) [-1142.720] (-1143.155) -- 0:00:33

      Average standard deviation of split frequencies: 0.012853

      470500 -- (-1142.606) (-1142.500) [-1144.809] (-1144.073) * [-1141.830] (-1142.404) (-1143.103) (-1142.125) -- 0:00:33
      471000 -- (-1142.258) (-1142.189) [-1143.660] (-1153.375) * (-1142.305) (-1143.976) [-1143.059] (-1141.772) -- 0:00:33
      471500 -- (-1143.046) (-1147.010) [-1142.260] (-1150.587) * (-1143.032) [-1143.439] (-1146.241) (-1143.021) -- 0:00:33
      472000 -- (-1142.753) (-1145.025) [-1144.039] (-1143.509) * (-1143.560) (-1145.297) [-1145.136] (-1143.372) -- 0:00:33
      472500 -- (-1141.642) (-1143.597) (-1143.066) [-1144.561] * (-1146.630) (-1144.349) [-1142.910] (-1143.231) -- 0:00:33
      473000 -- (-1142.209) [-1145.026] (-1143.548) (-1144.442) * (-1144.203) (-1147.283) [-1142.924] (-1143.397) -- 0:00:33
      473500 -- (-1143.523) [-1146.137] (-1144.627) (-1145.000) * (-1142.937) (-1141.610) (-1144.944) [-1143.806] -- 0:00:33
      474000 -- (-1142.066) (-1144.188) [-1143.265] (-1144.388) * (-1143.868) (-1140.906) [-1142.595] (-1145.863) -- 0:00:33
      474500 -- (-1147.744) (-1142.246) (-1144.033) [-1143.787] * (-1142.812) [-1145.178] (-1144.513) (-1143.313) -- 0:00:33
      475000 -- (-1141.603) [-1142.228] (-1143.835) (-1143.166) * (-1142.735) (-1142.014) [-1141.890] (-1142.367) -- 0:00:33

      Average standard deviation of split frequencies: 0.012819

      475500 -- [-1141.977] (-1144.598) (-1143.323) (-1144.614) * (-1146.015) (-1142.761) (-1141.522) [-1143.119] -- 0:00:34
      476000 -- (-1143.620) (-1142.771) [-1147.645] (-1146.666) * [-1146.478] (-1143.195) (-1142.818) (-1143.267) -- 0:00:34
      476500 -- (-1147.030) (-1144.743) [-1144.613] (-1144.277) * (-1142.008) (-1143.377) (-1150.366) [-1143.351] -- 0:00:34
      477000 -- (-1143.013) (-1143.713) (-1141.965) [-1145.480] * (-1141.238) [-1142.622] (-1145.953) (-1143.245) -- 0:00:33
      477500 -- (-1147.042) [-1143.951] (-1144.488) (-1143.485) * (-1141.281) (-1147.723) (-1144.215) [-1141.304] -- 0:00:33
      478000 -- (-1144.231) (-1143.514) (-1146.814) [-1141.986] * [-1141.401] (-1147.332) (-1144.184) (-1141.837) -- 0:00:33
      478500 -- [-1143.390] (-1143.591) (-1145.011) (-1143.236) * (-1141.669) (-1142.925) (-1142.359) [-1141.649] -- 0:00:33
      479000 -- (-1145.217) (-1143.889) (-1143.748) [-1145.961] * (-1145.034) (-1144.099) (-1144.017) [-1144.355] -- 0:00:33
      479500 -- (-1144.004) (-1143.966) (-1143.773) [-1141.680] * (-1145.467) [-1144.501] (-1143.477) (-1143.859) -- 0:00:33
      480000 -- [-1142.926] (-1146.584) (-1143.296) (-1141.928) * (-1142.927) (-1143.543) (-1144.299) [-1141.813] -- 0:00:33

      Average standard deviation of split frequencies: 0.012749

      480500 -- [-1143.157] (-1144.920) (-1142.937) (-1143.339) * (-1142.140) (-1144.559) [-1141.371] (-1142.031) -- 0:00:33
      481000 -- [-1143.803] (-1142.457) (-1142.399) (-1148.227) * [-1141.684] (-1144.182) (-1145.313) (-1141.451) -- 0:00:33
      481500 -- [-1142.182] (-1143.088) (-1142.826) (-1147.085) * (-1143.793) [-1142.253] (-1146.948) (-1141.932) -- 0:00:33
      482000 -- (-1141.098) [-1142.940] (-1143.038) (-1148.655) * [-1144.011] (-1142.332) (-1144.765) (-1144.231) -- 0:00:33
      482500 -- (-1142.584) (-1143.656) [-1142.349] (-1148.823) * [-1145.437] (-1141.719) (-1143.642) (-1145.444) -- 0:00:33
      483000 -- (-1141.531) (-1142.321) (-1145.557) [-1142.200] * (-1141.551) (-1142.519) [-1141.933] (-1144.807) -- 0:00:33
      483500 -- (-1143.167) (-1144.015) [-1146.232] (-1142.237) * (-1141.494) (-1142.078) (-1141.442) [-1144.262] -- 0:00:33
      484000 -- (-1143.632) (-1145.421) [-1148.129] (-1144.387) * [-1143.520] (-1144.354) (-1147.974) (-1146.676) -- 0:00:33
      484500 -- [-1142.750] (-1144.776) (-1144.799) (-1147.169) * (-1143.450) (-1144.816) (-1142.007) [-1142.347] -- 0:00:32
      485000 -- (-1143.373) [-1143.960] (-1143.664) (-1146.026) * [-1143.949] (-1146.139) (-1142.531) (-1146.941) -- 0:00:32

      Average standard deviation of split frequencies: 0.013364

      485500 -- (-1143.026) [-1143.606] (-1141.817) (-1150.631) * (-1145.766) (-1143.955) (-1146.355) [-1144.204] -- 0:00:32
      486000 -- (-1144.533) (-1143.095) [-1141.528] (-1144.442) * (-1141.811) (-1141.285) [-1144.986] (-1145.830) -- 0:00:32
      486500 -- (-1141.844) (-1144.600) [-1142.686] (-1148.798) * (-1147.016) (-1145.881) (-1144.908) [-1145.005] -- 0:00:32
      487000 -- (-1146.557) (-1144.684) [-1143.099] (-1150.998) * (-1143.587) [-1142.371] (-1149.714) (-1145.155) -- 0:00:32
      487500 -- [-1147.756] (-1144.351) (-1146.164) (-1145.348) * [-1142.831] (-1144.989) (-1143.490) (-1144.487) -- 0:00:32
      488000 -- [-1141.846] (-1142.614) (-1142.536) (-1144.847) * (-1142.127) (-1141.801) [-1143.118] (-1142.609) -- 0:00:32
      488500 -- (-1143.494) [-1142.505] (-1145.035) (-1143.757) * [-1142.394] (-1144.086) (-1143.257) (-1143.116) -- 0:00:32
      489000 -- [-1141.805] (-1142.210) (-1143.831) (-1148.491) * [-1143.911] (-1145.204) (-1142.794) (-1142.583) -- 0:00:32
      489500 -- (-1144.648) (-1141.702) [-1145.492] (-1147.393) * (-1142.705) (-1143.284) [-1145.906] (-1143.383) -- 0:00:32
      490000 -- (-1143.547) (-1142.834) [-1144.660] (-1142.537) * (-1142.989) (-1145.484) (-1144.002) [-1141.810] -- 0:00:32

      Average standard deviation of split frequencies: 0.012917

      490500 -- (-1143.984) [-1141.520] (-1143.547) (-1145.676) * (-1142.561) (-1144.134) [-1146.515] (-1142.705) -- 0:00:33
      491000 -- (-1142.830) (-1143.127) [-1146.902] (-1145.532) * (-1143.360) (-1145.775) (-1141.934) [-1142.172] -- 0:00:33
      491500 -- (-1142.372) (-1142.718) (-1143.943) [-1146.142] * (-1145.151) [-1142.410] (-1143.738) (-1147.420) -- 0:00:33
      492000 -- (-1144.803) (-1151.511) (-1142.000) [-1141.966] * [-1143.767] (-1141.243) (-1142.372) (-1145.238) -- 0:00:33
      492500 -- (-1144.771) [-1142.758] (-1144.739) (-1145.183) * (-1142.863) (-1141.664) [-1143.303] (-1143.533) -- 0:00:32
      493000 -- [-1146.305] (-1142.689) (-1144.224) (-1142.233) * [-1145.603] (-1141.903) (-1141.336) (-1141.769) -- 0:00:32
      493500 -- [-1145.864] (-1144.363) (-1144.837) (-1146.556) * (-1142.034) (-1146.765) [-1141.450] (-1141.289) -- 0:00:32
      494000 -- (-1144.424) (-1142.594) [-1143.660] (-1144.724) * [-1142.609] (-1147.124) (-1141.332) (-1141.023) -- 0:00:32
      494500 -- (-1145.378) (-1142.348) (-1148.248) [-1146.048] * [-1143.203] (-1146.504) (-1141.358) (-1141.912) -- 0:00:32
      495000 -- (-1147.370) (-1142.348) [-1143.016] (-1145.182) * (-1144.406) (-1143.439) (-1141.677) [-1146.168] -- 0:00:32

      Average standard deviation of split frequencies: 0.013095

      495500 -- (-1141.957) (-1143.824) [-1143.635] (-1145.742) * (-1142.713) (-1142.960) (-1141.874) [-1142.926] -- 0:00:32
      496000 -- [-1142.097] (-1142.266) (-1142.093) (-1144.535) * [-1142.000] (-1141.602) (-1143.654) (-1148.665) -- 0:00:32
      496500 -- (-1149.878) [-1143.205] (-1142.182) (-1142.608) * (-1141.338) [-1142.286] (-1143.938) (-1143.740) -- 0:00:32
      497000 -- (-1144.503) [-1145.370] (-1143.434) (-1146.072) * (-1149.330) (-1144.380) (-1145.692) [-1144.523] -- 0:00:32
      497500 -- (-1146.198) [-1144.703] (-1144.701) (-1141.950) * (-1142.421) (-1145.982) (-1145.600) [-1144.375] -- 0:00:32
      498000 -- [-1147.351] (-1141.970) (-1144.015) (-1141.861) * (-1147.408) (-1142.304) (-1146.321) [-1147.297] -- 0:00:32
      498500 -- (-1144.678) (-1145.061) [-1143.538] (-1142.225) * (-1144.788) [-1142.317] (-1147.933) (-1147.481) -- 0:00:32
      499000 -- [-1146.452] (-1145.061) (-1143.996) (-1142.327) * (-1145.710) (-1141.880) (-1144.716) [-1145.947] -- 0:00:32
      4