--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:33:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -884.27          -890.01
2       -884.22          -887.07
--------------------------------------
TOTAL     -884.25          -889.37
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893195    0.088705    0.367561    1.502073    0.862723   1256.80   1328.45    1.000
r(A<->C){all}   0.170917    0.019601    0.000329    0.447180    0.140154    194.59    236.57    1.000
r(A<->G){all}   0.162792    0.019633    0.000011    0.442165    0.126340    188.57    202.70    1.000
r(A<->T){all}   0.159126    0.018644    0.000056    0.441958    0.122819    226.32    232.60    1.000
r(C<->G){all}   0.159992    0.020049    0.000017    0.438220    0.122750    210.56    305.07    1.014
r(C<->T){all}   0.160912    0.020176    0.000043    0.447143    0.120222     77.86    203.67    1.001
r(G<->T){all}   0.186260    0.022142    0.000055    0.484796    0.147147    127.60    157.60    1.009
pi(A){all}      0.206536    0.000241    0.174930    0.235309    0.206014   1252.26   1332.29    1.000
pi(C){all}      0.280887    0.000304    0.249621    0.317037    0.280492   1303.93   1338.50    1.000
pi(G){all}      0.343722    0.000336    0.308221    0.379382    0.344022   1209.83   1243.75    1.000
pi(T){all}      0.168854    0.000212    0.140854    0.197086    0.168426   1297.62   1308.69    1.000
alpha{1,2}      0.423902    0.235997    0.000206    1.398856    0.253879   1367.36   1373.23    1.000
alpha{3}        0.447536    0.224541    0.000119    1.368161    0.293008   1187.33   1246.66    1.000
pinvar{all}     0.997628    0.000008    0.992391    1.000000    0.998501   1244.17   1372.59    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-842.105997
Model 2: PositiveSelection	-842.106043
Model 0: one-ratio	-842.105984
Model 7: beta	-842.106114
Model 8: beta&w>1	-842.105929


Model 0 vs 1	2.599999993435631E-5

Model 2 vs 1	9.1999999995096E-5

Model 8 vs 7	3.700000002027082E-4
>C1
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C2
VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C3
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C4
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C5
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C6
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219 

C1              -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C2              VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C3              -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C4              -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C5              -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C6              -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
                 *************************************************

C1              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C2              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C3              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C4              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C5              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C6              VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
                **************************************************

C1              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C2              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C3              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C4              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C5              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C6              ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
                **************************************************

C1              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C2              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C3              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C4              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C5              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C6              SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
                **************************************************

C1              GRTGGLVMVRSAIKRGEKo
C2              GRTGGLVMVRSAIKRGEK-
C3              GRTGGLVMVRSAIKRGEKo
C4              GRTGGLVMVRSAIKRGEKo
C5              GRTGGLVMVRSAIKRGEKo
C6              GRTGGLVMVRSAIKRGEKo
                ****************** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  218 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  218 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6580]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6580]--->[6570]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.755 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C2              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C3              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C4              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C5              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C6              MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
                **************************************************

C1              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C2              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C3              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C4              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C5              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C6              QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
                **************************************************

C1              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C2              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C3              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C4              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C5              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C6              LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
                **************************************************

C1              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C2              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C3              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C4              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C5              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C6              IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
                **************************************************

C1              RTGGLVMVRSAIKRGEK
C2              RTGGLVMVRSAIKRGEK
C3              RTGGLVMVRSAIKRGEK
C4              RTGGLVMVRSAIKRGEK
C5              RTGGLVMVRSAIKRGEK
C6              RTGGLVMVRSAIKRGEK
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C2              GTGATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C3              ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C4              ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C5              ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C6              ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
                   ***********************************************

C1              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C2              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C3              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C4              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C5              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C6              ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
                **************************************************

C1              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C2              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C3              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C4              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C5              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C6              CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
                **************************************************

C1              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C2              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C3              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C4              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C5              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C6              GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
                **************************************************

C1              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C2              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C3              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C4              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C5              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C6              GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
                **************************************************

C1              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C2              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C3              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C4              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C5              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C6              AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
                **************************************************

C1              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C2              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C3              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C4              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C5              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C6              GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
                **************************************************

C1              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C2              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C3              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C4              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C5              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C6              GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
                **************************************************

C1              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C2              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C3              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C4              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C5              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C6              GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
                **************************************************

C1              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C2              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C3              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C4              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C5              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C6              TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
                **************************************************

C1              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C2              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C3              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C4              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C5              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C6              GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
                **************************************************

C1              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C2              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C3              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C4              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C5              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C6              ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
                **************************************************

C1              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C2              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C3              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C4              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C5              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C6              GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
                **************************************************

C1              GAAA---
C2              GAAA---
C3              GAAA---
C4              GAAA---
C5              GAAA---
C6              GAAA---
                ****   



>C1
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C2
GTGATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C3
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C4
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C5
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C6
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C1
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C2
VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C3
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C4
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C5
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C6
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 657 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789907
      Setting output file names to "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1021068998
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0062468981
      Seed = 365199252
      Swapseed = 1579789907
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 6 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 6 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1461.128094 -- -24.965149
         Chain 2 -- -1461.128094 -- -24.965149
         Chain 3 -- -1461.128094 -- -24.965149
         Chain 4 -- -1461.128010 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1461.128094 -- -24.965149
         Chain 2 -- -1461.128094 -- -24.965149
         Chain 3 -- -1461.128094 -- -24.965149
         Chain 4 -- -1461.128010 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1461.128] (-1461.128) (-1461.128) (-1461.128) * [-1461.128] (-1461.128) (-1461.128) (-1461.128) 
        500 -- (-910.185) [-913.848] (-912.266) (-914.560) * (-909.590) (-907.122) (-912.123) [-906.217] -- 0:00:00
       1000 -- [-891.978] (-891.092) (-913.956) (-905.449) * (-905.416) (-893.845) (-894.573) [-897.155] -- 0:00:00
       1500 -- [-896.552] (-898.125) (-902.500) (-892.131) * (-903.411) (-892.658) (-905.174) [-892.058] -- 0:00:00
       2000 -- (-898.409) (-891.327) [-895.140] (-895.933) * (-902.705) (-894.888) [-896.508] (-903.896) -- 0:00:00
       2500 -- [-893.536] (-905.515) (-890.331) (-891.155) * (-893.639) (-893.585) [-892.585] (-894.665) -- 0:00:00
       3000 -- [-891.395] (-893.928) (-894.581) (-891.175) * (-899.549) (-890.867) [-895.314] (-894.278) -- 0:00:00
       3500 -- [-894.001] (-895.900) (-894.194) (-897.464) * [-892.274] (-892.805) (-891.367) (-891.571) -- 0:00:00
       4000 -- (-896.888) (-893.312) (-896.963) [-892.347] * (-898.513) (-892.332) [-894.662] (-902.173) -- 0:00:00
       4500 -- (-889.499) (-895.666) [-891.309] (-888.117) * (-894.048) (-892.817) [-892.912] (-893.469) -- 0:00:00
       5000 -- (-891.153) (-891.764) (-889.289) [-897.611] * [-892.437] (-890.913) (-897.362) (-892.680) -- 0:00:00

      Average standard deviation of split frequencies: 0.094281

       5500 -- [-888.262] (-888.602) (-894.549) (-892.799) * [-889.505] (-896.111) (-889.170) (-891.361) -- 0:00:00
       6000 -- [-891.716] (-894.313) (-897.654) (-895.427) * [-894.210] (-898.573) (-893.396) (-895.931) -- 0:00:00
       6500 -- [-890.662] (-898.003) (-890.444) (-890.696) * [-893.668] (-896.553) (-892.178) (-894.131) -- 0:00:00
       7000 -- [-897.373] (-889.654) (-905.457) (-895.783) * (-888.812) (-894.866) [-892.165] (-893.175) -- 0:00:00
       7500 -- (-891.581) (-890.041) [-888.357] (-894.450) * (-897.861) (-903.690) (-890.439) [-895.873] -- 0:02:12
       8000 -- [-891.613] (-896.576) (-891.423) (-893.257) * [-892.383] (-893.124) (-886.983) (-900.318) -- 0:02:04
       8500 -- (-890.594) (-887.535) [-892.891] (-894.773) * (-890.810) [-889.333] (-883.207) (-895.675) -- 0:01:56
       9000 -- (-897.715) (-894.563) (-898.256) [-888.289] * (-901.618) (-894.606) [-883.877] (-887.155) -- 0:01:50
       9500 -- [-886.482] (-904.627) (-891.643) (-887.636) * [-891.449] (-893.041) (-888.280) (-883.207) -- 0:01:44
      10000 -- (-894.972) (-885.398) [-890.911] (-891.112) * (-887.620) (-889.765) [-888.512] (-884.033) -- 0:01:39

      Average standard deviation of split frequencies: 0.061872

      10500 -- [-892.110] (-888.863) (-895.263) (-893.543) * [-899.098] (-884.668) (-887.246) (-883.351) -- 0:01:34
      11000 -- (-897.254) (-886.555) [-887.858] (-893.247) * (-893.487) (-893.221) (-886.415) [-883.297] -- 0:01:29
      11500 -- (-895.520) [-887.145] (-889.006) (-899.750) * (-894.791) (-889.596) (-883.703) [-883.835] -- 0:01:25
      12000 -- [-888.492] (-884.921) (-896.143) (-892.031) * [-897.317] (-890.660) (-883.864) (-883.074) -- 0:01:22
      12500 -- (-902.355) (-883.615) (-893.994) [-891.206] * (-894.748) (-888.143) [-884.401] (-883.346) -- 0:01:19
      13000 -- (-898.903) (-885.162) [-890.638] (-895.684) * (-890.645) (-885.402) (-886.073) [-882.814] -- 0:01:15
      13500 -- (-897.301) (-883.423) [-896.047] (-893.458) * (-892.425) (-887.159) (-888.990) [-883.202] -- 0:01:13
      14000 -- (-894.304) (-883.419) [-889.819] (-889.925) * (-908.536) (-885.388) (-883.805) [-884.371] -- 0:01:10
      14500 -- [-891.100] (-887.723) (-899.637) (-889.142) * (-887.873) (-889.788) (-883.887) [-887.507] -- 0:01:07
      15000 -- (-898.736) [-886.034] (-890.071) (-895.548) * (-887.838) [-885.406] (-888.140) (-884.678) -- 0:01:05

      Average standard deviation of split frequencies: 0.062943

      15500 -- (-897.723) (-884.596) [-897.130] (-900.897) * (-884.074) (-885.872) (-884.660) [-886.041] -- 0:01:03
      16000 -- [-891.801] (-888.278) (-894.863) (-903.475) * (-883.610) (-886.046) [-886.076] (-886.091) -- 0:01:01
      16500 -- (-888.686) (-885.013) [-898.452] (-894.357) * [-884.351] (-885.954) (-888.368) (-884.698) -- 0:00:59
      17000 -- (-893.279) (-884.571) [-895.818] (-890.200) * [-886.473] (-886.124) (-884.485) (-883.401) -- 0:00:57
      17500 -- (-892.912) (-884.933) [-893.557] (-888.562) * (-884.716) (-886.048) (-886.464) [-883.251] -- 0:00:56
      18000 -- [-893.730] (-883.882) (-903.605) (-892.502) * (-884.442) (-886.231) (-885.864) [-883.585] -- 0:00:54
      18500 -- [-896.379] (-885.044) (-896.346) (-896.981) * (-883.963) (-892.457) (-889.550) [-884.207] -- 0:00:53
      19000 -- (-895.153) (-886.446) [-890.213] (-898.275) * (-883.725) (-884.491) [-885.784] (-886.150) -- 0:00:51
      19500 -- [-891.592] (-891.670) (-893.999) (-889.277) * (-886.705) [-885.637] (-885.078) (-885.022) -- 0:00:50
      20000 -- (-887.029) (-884.923) (-900.061) [-901.908] * (-885.521) (-884.536) (-883.746) [-884.468] -- 0:00:49

      Average standard deviation of split frequencies: 0.051622

      20500 -- (-892.302) (-885.539) [-891.308] (-897.984) * (-884.234) [-883.902] (-886.675) (-888.554) -- 0:00:47
      21000 -- (-893.296) (-884.231) (-891.323) [-885.149] * (-885.244) (-886.485) [-883.796] (-884.744) -- 0:01:33
      21500 -- [-895.265] (-884.731) (-894.760) (-885.728) * (-884.124) (-885.300) (-883.794) [-886.807] -- 0:01:31
      22000 -- (-893.449) (-884.568) [-893.128] (-884.986) * [-884.496] (-885.984) (-887.246) (-885.829) -- 0:01:28
      22500 -- (-897.658) [-884.741] (-899.821) (-885.435) * (-888.375) (-885.530) (-886.282) [-885.169] -- 0:01:26
      23000 -- (-894.514) (-886.362) [-892.546] (-885.834) * [-887.810] (-885.246) (-886.900) (-884.598) -- 0:01:24
      23500 -- [-889.935] (-887.319) (-893.381) (-885.659) * (-886.168) [-883.634] (-886.284) (-884.601) -- 0:01:23
      24000 -- (-891.669) [-887.242] (-895.408) (-885.769) * [-885.885] (-888.754) (-889.029) (-884.652) -- 0:01:21
      24500 -- (-890.419) (-889.030) (-891.478) [-884.308] * (-888.965) (-884.332) [-885.240] (-883.114) -- 0:01:19
      25000 -- (-894.015) (-884.566) [-889.675] (-890.934) * [-887.283] (-885.631) (-885.825) (-884.161) -- 0:01:18

      Average standard deviation of split frequencies: 0.043169

      25500 -- [-890.908] (-885.353) (-902.680) (-882.777) * (-883.505) (-886.707) [-885.777] (-884.056) -- 0:01:16
      26000 -- [-895.813] (-886.275) (-900.512) (-884.271) * (-883.870) (-887.032) (-886.761) [-884.723] -- 0:01:14
      26500 -- (-892.679) [-885.159] (-904.676) (-883.756) * [-884.775] (-884.538) (-890.151) (-885.022) -- 0:01:13
      27000 -- [-890.656] (-884.526) (-897.555) (-885.147) * (-887.853) [-884.263] (-885.854) (-884.733) -- 0:01:12
      27500 -- (-894.287) (-884.283) [-890.044] (-884.017) * (-885.198) (-886.472) [-885.555] (-886.853) -- 0:01:10
      28000 -- [-897.939] (-885.786) (-902.963) (-883.700) * (-885.340) (-886.358) [-883.450] (-885.988) -- 0:01:09
      28500 -- (-900.209) (-886.380) (-889.031) [-886.733] * (-885.892) [-886.282] (-885.334) (-884.073) -- 0:01:08
      29000 -- (-894.328) (-885.227) [-887.021] (-885.104) * (-883.561) (-885.425) [-884.256] (-885.515) -- 0:01:06
      29500 -- (-891.166) [-887.161] (-884.064) (-883.803) * (-883.691) [-883.505] (-882.998) (-886.632) -- 0:01:05
      30000 -- [-888.537] (-885.340) (-884.678) (-883.954) * (-883.714) (-884.234) [-883.451] (-885.145) -- 0:01:04

      Average standard deviation of split frequencies: 0.042456

      30500 -- [-897.891] (-886.034) (-884.368) (-884.110) * [-885.717] (-888.348) (-883.896) (-886.476) -- 0:01:03
      31000 -- (-889.170) (-886.058) (-884.316) [-884.381] * (-885.159) (-883.806) (-885.217) [-886.781] -- 0:01:02
      31500 -- (-891.090) (-886.238) [-884.894] (-886.086) * (-886.121) (-883.699) (-888.950) [-883.723] -- 0:01:01
      32000 -- (-896.023) (-885.113) [-886.511] (-885.727) * (-889.007) [-882.985] (-884.006) (-887.955) -- 0:01:00
      32500 -- (-894.166) (-885.879) (-887.267) [-885.726] * (-886.729) [-884.571] (-883.620) (-884.268) -- 0:00:59
      33000 -- (-889.617) [-884.383] (-887.357) (-884.649) * (-885.316) (-883.104) (-885.721) [-883.859] -- 0:00:58
      33500 -- [-891.298] (-885.156) (-889.868) (-885.725) * (-885.364) [-882.988] (-885.059) (-883.645) -- 0:00:57
      34000 -- (-891.816) [-886.033] (-884.697) (-884.899) * [-886.518] (-887.200) (-885.256) (-887.798) -- 0:00:56
      34500 -- [-893.277] (-885.231) (-884.914) (-883.554) * (-884.043) (-883.837) (-886.470) [-885.866] -- 0:00:55
      35000 -- (-899.102) (-884.340) (-884.513) [-884.221] * (-885.597) (-884.842) (-885.516) [-884.037] -- 0:01:22

      Average standard deviation of split frequencies: 0.042040

      35500 -- (-900.538) [-887.888] (-883.886) (-884.196) * (-889.781) (-887.872) [-885.628] (-883.037) -- 0:01:21
      36000 -- (-891.561) [-886.970] (-886.071) (-885.326) * (-887.477) (-884.934) (-885.508) [-884.705] -- 0:01:20
      36500 -- [-892.529] (-883.914) (-883.739) (-887.311) * (-885.710) (-884.929) (-883.434) [-883.904] -- 0:01:19
      37000 -- (-894.797) [-888.739] (-885.756) (-887.059) * (-884.353) (-884.452) (-885.227) [-883.260] -- 0:01:18
      37500 -- (-889.181) (-883.903) [-886.216] (-883.797) * (-884.758) [-886.172] (-882.963) (-882.815) -- 0:01:17
      38000 -- (-883.645) (-885.227) (-883.861) [-886.307] * (-888.154) [-886.733] (-884.657) (-882.862) -- 0:01:15
      38500 -- [-884.412] (-883.379) (-882.962) (-884.235) * (-885.716) (-885.495) (-885.988) [-882.928] -- 0:01:14
      39000 -- [-883.165] (-883.517) (-885.603) (-885.559) * (-883.706) (-883.420) [-885.547] (-883.571) -- 0:01:13
      39500 -- (-885.191) (-886.751) (-884.859) [-886.761] * (-886.032) (-884.297) (-886.153) [-885.688] -- 0:01:12
      40000 -- (-883.073) (-887.402) (-889.640) [-884.749] * (-887.939) (-885.006) [-887.595] (-884.492) -- 0:01:12

      Average standard deviation of split frequencies: 0.028255

      40500 -- [-884.560] (-884.191) (-885.098) (-882.984) * (-884.327) (-885.537) (-888.491) [-885.108] -- 0:01:11
      41000 -- (-887.126) (-885.551) (-884.019) [-885.006] * (-886.435) (-886.047) [-883.485] (-882.949) -- 0:01:10
      41500 -- (-884.314) [-885.526] (-885.668) (-884.885) * (-887.619) (-886.303) (-884.620) [-885.702] -- 0:01:09
      42000 -- (-885.924) (-888.014) [-884.103] (-883.588) * (-885.592) [-884.840] (-882.842) (-883.040) -- 0:01:08
      42500 -- (-885.659) (-884.777) [-888.200] (-886.187) * [-884.843] (-885.795) (-883.356) (-883.651) -- 0:01:07
      43000 -- [-886.564] (-886.360) (-884.803) (-883.525) * (-884.229) [-883.182] (-884.432) (-885.650) -- 0:01:06
      43500 -- (-883.864) (-885.261) (-886.226) [-884.065] * (-883.529) [-883.357] (-883.811) (-887.196) -- 0:01:05
      44000 -- [-885.328] (-887.364) (-887.323) (-884.430) * (-886.470) (-884.897) [-884.971] (-884.552) -- 0:01:05
      44500 -- (-882.813) [-886.188] (-887.000) (-883.985) * (-885.208) [-884.438] (-886.391) (-886.506) -- 0:01:04
      45000 -- (-884.091) (-885.688) [-884.404] (-888.840) * [-885.350] (-883.088) (-885.006) (-886.229) -- 0:01:03

      Average standard deviation of split frequencies: 0.029665

      45500 -- (-883.775) (-885.800) [-887.375] (-889.602) * (-886.262) (-885.727) [-883.820] (-885.407) -- 0:01:02
      46000 -- (-884.356) [-885.771] (-888.294) (-889.467) * [-886.329] (-885.874) (-883.792) (-884.332) -- 0:01:02
      46500 -- (-885.049) [-883.528] (-887.189) (-883.832) * (-885.086) (-885.496) [-883.116] (-887.250) -- 0:01:01
      47000 -- (-884.487) [-883.486] (-884.180) (-884.882) * (-883.907) (-884.949) (-889.714) [-889.488] -- 0:01:00
      47500 -- (-885.610) [-884.491] (-885.363) (-884.712) * (-885.277) (-885.928) (-887.383) [-884.454] -- 0:01:00
      48000 -- [-884.796] (-888.196) (-884.548) (-887.453) * (-888.427) (-883.318) (-885.663) [-884.463] -- 0:00:59
      48500 -- (-884.986) (-889.046) (-883.846) [-884.614] * [-886.211] (-886.358) (-884.702) (-885.319) -- 0:00:58
      49000 -- (-886.384) (-886.215) [-884.513] (-886.192) * [-884.354] (-883.188) (-883.537) (-885.851) -- 0:00:58
      49500 -- (-885.796) [-883.878] (-888.876) (-885.295) * (-888.110) (-884.549) (-884.295) [-884.980] -- 0:01:16
      50000 -- (-886.959) [-885.596] (-887.243) (-883.510) * (-888.178) (-882.667) [-884.589] (-884.617) -- 0:01:16

      Average standard deviation of split frequencies: 0.032047

      50500 -- (-885.538) [-884.996] (-885.143) (-884.922) * (-884.612) (-883.028) (-890.362) [-887.811] -- 0:01:15
      51000 -- (-884.821) (-885.312) [-885.036] (-885.852) * (-883.610) (-886.394) [-889.631] (-888.200) -- 0:01:14
      51500 -- (-886.602) (-883.070) (-884.026) [-886.324] * (-886.546) [-883.794] (-891.542) (-883.024) -- 0:01:13
      52000 -- [-883.557] (-883.070) (-887.249) (-885.740) * (-885.165) (-884.468) (-884.557) [-884.451] -- 0:01:12
      52500 -- [-885.637] (-885.115) (-885.965) (-884.549) * (-885.399) (-887.759) [-886.779] (-886.948) -- 0:01:12
      53000 -- (-883.221) (-886.506) (-882.891) [-883.998] * (-884.986) (-885.918) [-887.264] (-886.420) -- 0:01:11
      53500 -- (-883.585) (-886.278) [-884.487] (-887.726) * (-885.704) [-884.461] (-885.129) (-885.509) -- 0:01:10
      54000 -- [-883.067] (-884.305) (-884.538) (-890.417) * (-884.311) [-882.772] (-886.355) (-885.331) -- 0:01:10
      54500 -- (-884.234) [-883.651] (-887.036) (-887.241) * (-889.364) (-882.973) (-886.494) [-885.314] -- 0:01:09
      55000 -- (-883.187) (-883.557) (-883.830) [-884.270] * (-890.097) [-883.214] (-883.156) (-883.298) -- 0:01:08

      Average standard deviation of split frequencies: 0.035542

      55500 -- (-889.254) (-890.119) (-884.360) [-884.935] * (-885.783) (-886.702) (-885.254) [-883.278] -- 0:01:08
      56000 -- (-889.659) [-884.117] (-884.858) (-884.887) * [-884.986] (-890.885) (-883.800) (-885.453) -- 0:01:07
      56500 -- (-893.204) (-887.011) (-886.154) [-885.331] * [-888.554] (-885.569) (-883.193) (-884.215) -- 0:01:06
      57000 -- (-884.758) (-891.518) (-884.331) [-885.086] * (-887.275) [-887.399] (-883.393) (-886.920) -- 0:01:06
      57500 -- [-883.447] (-884.375) (-887.195) (-885.485) * (-887.980) (-883.348) [-886.010] (-888.592) -- 0:01:05
      58000 -- [-884.430] (-884.496) (-883.282) (-883.410) * (-885.181) (-885.364) (-886.055) [-885.122] -- 0:01:04
      58500 -- (-885.749) [-884.696] (-884.752) (-883.633) * (-883.273) [-883.312] (-885.323) (-886.677) -- 0:01:04
      59000 -- (-886.019) (-888.168) (-885.287) [-884.631] * (-883.616) (-885.021) (-886.545) [-885.782] -- 0:01:03
      59500 -- (-886.067) (-886.487) (-884.909) [-883.259] * (-883.933) (-885.057) [-883.571] (-886.084) -- 0:01:03
      60000 -- (-886.669) (-886.631) (-884.168) [-883.566] * (-887.249) (-883.586) (-894.015) [-882.962] -- 0:01:02

      Average standard deviation of split frequencies: 0.031859

      60500 -- (-884.178) (-888.513) (-884.957) [-883.615] * (-885.758) [-887.006] (-889.711) (-883.877) -- 0:01:02
      61000 -- (-886.425) [-885.969] (-885.668) (-883.253) * (-884.327) [-884.875] (-887.829) (-887.129) -- 0:01:01
      61500 -- (-886.702) (-888.336) (-883.265) [-886.143] * (-889.221) (-883.649) [-884.074] (-890.226) -- 0:01:01
      62000 -- (-886.915) (-884.344) [-883.915] (-884.413) * (-884.452) (-883.165) (-884.360) [-888.804] -- 0:01:00
      62500 -- [-886.367] (-884.203) (-884.878) (-884.913) * (-883.842) (-886.307) [-887.584] (-887.258) -- 0:01:00
      63000 -- (-887.144) [-885.184] (-885.660) (-885.260) * [-884.460] (-886.481) (-884.917) (-885.625) -- 0:00:59
      63500 -- (-887.697) [-885.774] (-883.608) (-886.247) * (-884.107) (-890.864) (-888.180) [-883.833] -- 0:01:13
      64000 -- (-888.393) (-885.027) (-883.074) [-887.375] * (-883.341) (-885.355) (-883.633) [-883.196] -- 0:01:13
      64500 -- (-883.624) [-885.242] (-883.553) (-883.759) * (-883.876) (-883.105) [-884.919] (-884.030) -- 0:01:12
      65000 -- (-887.935) [-885.680] (-883.065) (-886.566) * (-886.597) (-883.176) (-886.826) [-883.932] -- 0:01:11

      Average standard deviation of split frequencies: 0.029590

      65500 -- (-883.479) [-885.415] (-887.390) (-884.231) * (-886.729) (-884.622) (-885.718) [-888.018] -- 0:01:11
      66000 -- (-885.678) [-886.282] (-885.457) (-888.235) * [-884.214] (-887.693) (-884.709) (-883.661) -- 0:01:10
      66500 -- (-885.464) [-886.383] (-885.194) (-883.290) * (-885.265) (-885.445) (-884.423) [-883.997] -- 0:01:10
      67000 -- (-883.521) [-885.526] (-885.894) (-885.967) * (-884.350) [-882.801] (-883.454) (-884.082) -- 0:01:09
      67500 -- [-883.260] (-885.603) (-884.263) (-887.369) * [-883.692] (-883.740) (-886.753) (-885.468) -- 0:01:09
      68000 -- (-883.456) [-886.630] (-886.118) (-887.288) * [-882.771] (-884.920) (-886.143) (-885.811) -- 0:01:08
      68500 -- (-883.659) (-887.988) (-884.393) [-885.919] * (-886.210) [-884.648] (-888.067) (-886.404) -- 0:01:07
      69000 -- (-888.699) [-886.582] (-884.883) (-885.955) * (-885.702) (-882.754) (-886.679) [-884.152] -- 0:01:07
      69500 -- (-890.085) (-884.365) (-885.259) [-887.649] * (-885.562) [-885.063] (-883.933) (-885.885) -- 0:01:06
      70000 -- (-884.826) (-886.757) (-884.707) [-883.820] * (-889.638) (-883.771) [-883.916] (-885.202) -- 0:01:06

      Average standard deviation of split frequencies: 0.029294

      70500 -- (-883.630) (-884.863) (-888.144) [-883.830] * (-888.428) (-888.260) (-882.851) [-884.946] -- 0:01:05
      71000 -- (-885.207) (-885.095) (-889.527) [-886.268] * [-887.911] (-883.820) (-885.358) (-887.017) -- 0:01:05
      71500 -- (-886.975) [-884.860] (-883.200) (-884.596) * (-889.962) (-886.292) [-889.669] (-886.064) -- 0:01:04
      72000 -- (-883.997) [-888.513] (-886.968) (-883.676) * (-891.162) [-887.853] (-887.984) (-889.055) -- 0:01:04
      72500 -- (-883.164) [-884.737] (-883.526) (-883.009) * (-891.017) (-886.286) [-883.815] (-884.584) -- 0:01:03
      73000 -- (-886.391) [-886.721] (-884.189) (-886.466) * (-889.307) (-886.524) (-883.436) [-883.219] -- 0:01:03
      73500 -- [-888.053] (-883.724) (-884.628) (-885.469) * (-887.939) (-886.775) (-883.117) [-883.600] -- 0:01:03
      74000 -- (-886.235) (-883.421) (-885.968) [-884.554] * (-886.128) (-887.544) [-885.254] (-885.839) -- 0:01:02
      74500 -- (-885.637) (-883.664) (-888.182) [-884.691] * (-884.043) (-884.425) [-883.287] (-885.664) -- 0:01:02
      75000 -- [-884.152] (-883.260) (-884.762) (-888.323) * (-884.054) [-884.165] (-885.191) (-889.805) -- 0:01:01

      Average standard deviation of split frequencies: 0.027469

      75500 -- (-888.308) [-883.836] (-887.259) (-887.385) * (-883.394) [-886.056] (-886.365) (-888.875) -- 0:01:01
      76000 -- (-883.710) (-889.136) (-884.445) [-884.236] * (-884.356) (-885.485) [-884.034] (-891.716) -- 0:01:00
      76500 -- (-885.434) [-885.164] (-888.226) (-885.060) * (-885.920) (-886.085) [-886.094] (-889.231) -- 0:01:00
      77000 -- (-883.653) (-884.641) [-886.120] (-884.323) * (-885.587) (-886.845) (-891.256) [-885.551] -- 0:01:11
      77500 -- (-884.329) [-883.745] (-885.202) (-883.759) * (-886.715) (-886.412) [-886.120] (-889.915) -- 0:01:11
      78000 -- (-888.881) (-886.213) [-884.661] (-884.778) * (-886.094) (-885.651) [-884.458] (-886.610) -- 0:01:10
      78500 -- (-885.578) (-885.478) [-883.654] (-885.408) * [-884.711] (-886.856) (-884.626) (-885.646) -- 0:01:10
      79000 -- (-883.388) (-882.855) [-883.235] (-885.170) * (-887.145) (-885.122) (-886.756) [-884.154] -- 0:01:09
      79500 -- (-889.561) [-884.523] (-883.948) (-885.768) * (-885.394) (-885.601) (-884.248) [-883.854] -- 0:01:09
      80000 -- (-885.323) (-885.759) (-884.294) [-883.392] * [-885.339] (-882.965) (-884.532) (-885.665) -- 0:01:09

      Average standard deviation of split frequencies: 0.027758

      80500 -- (-887.327) (-886.048) (-884.443) [-887.886] * (-893.443) [-884.035] (-884.604) (-885.793) -- 0:01:08
      81000 -- [-883.904] (-886.331) (-883.836) (-886.848) * [-882.961] (-883.284) (-883.906) (-885.150) -- 0:01:08
      81500 -- [-886.267] (-890.313) (-897.830) (-883.161) * [-883.184] (-884.778) (-884.510) (-894.388) -- 0:01:07
      82000 -- [-887.190] (-883.568) (-895.341) (-883.406) * (-886.363) [-884.330] (-886.477) (-888.037) -- 0:01:07
      82500 -- [-884.449] (-886.440) (-883.582) (-888.915) * (-884.866) (-886.336) (-884.792) [-885.723] -- 0:01:06
      83000 -- [-882.884] (-883.965) (-884.406) (-885.335) * (-885.854) (-884.130) [-884.105] (-883.606) -- 0:01:06
      83500 -- (-883.973) (-885.478) (-884.671) [-888.791] * [-887.129] (-885.207) (-886.246) (-885.363) -- 0:01:05
      84000 -- (-883.959) (-885.062) [-884.902] (-887.834) * [-885.953] (-884.964) (-884.158) (-883.439) -- 0:01:05
      84500 -- (-883.881) [-883.842] (-885.169) (-893.720) * (-887.277) (-886.218) (-886.890) [-885.828] -- 0:01:05
      85000 -- [-883.539] (-883.206) (-883.858) (-889.631) * (-890.751) [-883.932] (-886.039) (-885.671) -- 0:01:04

      Average standard deviation of split frequencies: 0.025739

      85500 -- [-883.776] (-885.361) (-884.196) (-884.345) * (-885.202) (-884.430) (-884.865) [-883.857] -- 0:01:04
      86000 -- (-886.716) (-885.447) [-885.030] (-882.894) * (-890.999) (-885.318) [-885.559] (-885.867) -- 0:01:03
      86500 -- [-884.419] (-884.440) (-887.757) (-885.262) * [-884.020] (-885.318) (-883.686) (-886.024) -- 0:01:03
      87000 -- (-884.029) (-884.710) (-886.264) [-883.534] * (-885.447) [-884.410] (-882.889) (-888.519) -- 0:01:02
      87500 -- (-883.436) [-884.768] (-889.421) (-884.225) * (-884.256) [-884.112] (-887.106) (-883.978) -- 0:01:02
      88000 -- (-883.484) (-889.394) (-892.072) [-885.347] * (-886.017) (-884.908) (-886.193) [-883.668] -- 0:01:02
      88500 -- (-884.612) (-892.105) (-886.215) [-889.861] * (-884.308) (-884.165) [-886.622] (-884.873) -- 0:01:01
      89000 -- (-886.578) (-886.530) [-888.143] (-886.824) * (-884.627) (-883.441) [-885.760] (-883.318) -- 0:01:11
      89500 -- [-883.748] (-884.540) (-893.999) (-884.173) * (-884.826) (-883.033) (-886.606) [-885.180] -- 0:01:11
      90000 -- [-883.651] (-884.872) (-892.690) (-885.488) * (-883.400) [-883.819] (-888.365) (-884.960) -- 0:01:10

      Average standard deviation of split frequencies: 0.028968

      90500 -- (-884.042) [-885.542] (-884.322) (-886.541) * (-884.057) (-884.522) [-887.242] (-886.372) -- 0:01:10
      91000 -- (-884.374) [-884.964] (-883.704) (-885.406) * (-884.944) (-883.217) (-883.330) [-887.327] -- 0:01:09
      91500 -- (-883.969) (-886.686) [-883.795] (-887.037) * [-884.491] (-883.780) (-883.650) (-884.942) -- 0:01:09
      92000 -- (-885.071) (-888.140) [-883.550] (-886.980) * (-884.276) (-883.785) (-883.024) [-885.542] -- 0:01:09
      92500 -- [-885.046] (-884.865) (-883.686) (-886.773) * (-885.383) (-883.845) [-883.249] (-886.142) -- 0:01:08
      93000 -- (-884.886) (-883.998) [-883.063] (-883.722) * (-886.455) [-884.398] (-884.540) (-885.670) -- 0:01:08
      93500 -- (-884.465) [-883.989] (-883.783) (-884.159) * (-884.708) [-884.658] (-884.609) (-883.912) -- 0:01:07
      94000 -- (-884.480) [-884.470] (-882.660) (-884.053) * [-887.558] (-884.875) (-885.118) (-887.507) -- 0:01:07
      94500 -- (-885.080) (-884.204) [-882.878] (-885.553) * (-890.511) (-883.750) (-887.568) [-884.386] -- 0:01:07
      95000 -- (-886.895) (-884.673) [-882.889] (-886.873) * [-885.775] (-887.307) (-885.122) (-886.253) -- 0:01:06

      Average standard deviation of split frequencies: 0.032588

      95500 -- (-885.188) (-883.880) (-883.103) [-884.707] * (-888.229) [-884.409] (-884.190) (-885.671) -- 0:01:06
      96000 -- (-884.621) (-884.082) (-885.839) [-883.832] * (-885.368) [-886.377] (-885.098) (-885.271) -- 0:01:05
      96500 -- (-890.572) (-882.755) [-883.215] (-883.127) * [-883.170] (-883.605) (-883.169) (-883.078) -- 0:01:05
      97000 -- (-886.507) (-886.313) [-885.287] (-883.169) * [-883.850] (-885.545) (-885.068) (-884.937) -- 0:01:05
      97500 -- [-886.066] (-883.361) (-885.475) (-885.150) * (-884.364) (-884.629) [-883.529] (-886.739) -- 0:01:04
      98000 -- [-883.899] (-882.739) (-885.118) (-887.641) * [-884.361] (-882.853) (-883.900) (-886.351) -- 0:01:04
      98500 -- (-884.080) (-884.115) (-886.615) [-885.087] * (-886.204) (-883.651) [-885.013] (-887.751) -- 0:01:04
      99000 -- [-887.294] (-883.431) (-884.550) (-884.744) * (-884.659) (-882.980) [-886.233] (-883.994) -- 0:01:03
      99500 -- (-884.811) (-883.570) [-884.924] (-887.005) * (-885.746) (-882.980) (-887.508) [-885.407] -- 0:01:03
      100000 -- [-884.508] (-884.074) (-890.154) (-882.917) * [-885.102] (-883.916) (-887.126) (-885.497) -- 0:01:02

      Average standard deviation of split frequencies: 0.032546

      100500 -- (-883.626) [-885.577] (-888.351) (-887.237) * (-883.749) [-883.288] (-887.495) (-884.904) -- 0:01:02
      101000 -- (-883.657) (-887.612) (-885.528) [-884.220] * (-889.093) [-882.917] (-886.168) (-885.808) -- 0:01:02
      101500 -- (-883.494) [-883.169] (-885.630) (-889.269) * (-887.679) [-883.442] (-885.929) (-883.340) -- 0:01:01
      102000 -- [-883.715] (-882.964) (-883.736) (-886.281) * (-885.519) [-886.683] (-884.363) (-885.061) -- 0:01:01
      102500 -- (-884.495) [-888.244] (-883.265) (-884.122) * (-884.656) [-885.989] (-885.402) (-884.963) -- 0:01:10
      103000 -- (-884.543) (-884.572) (-883.392) [-885.850] * [-885.930] (-882.680) (-887.599) (-892.197) -- 0:01:09
      103500 -- (-885.699) (-886.755) (-885.664) [-885.328] * (-885.186) (-882.667) (-886.930) [-883.445] -- 0:01:09
      104000 -- (-888.263) (-885.417) (-885.169) [-883.211] * (-885.511) (-882.747) (-884.002) [-884.410] -- 0:01:08
      104500 -- (-890.154) (-886.448) [-884.964] (-884.382) * (-884.409) (-886.279) [-884.286] (-884.400) -- 0:01:08
      105000 -- (-887.207) (-885.561) (-883.861) [-884.289] * (-884.776) (-885.747) [-884.024] (-883.686) -- 0:01:08

      Average standard deviation of split frequencies: 0.031978

      105500 -- (-884.194) (-884.165) (-883.738) [-884.989] * (-885.289) (-886.286) (-884.827) [-884.464] -- 0:01:07
      106000 -- [-884.410] (-883.350) (-885.073) (-884.607) * (-883.902) (-888.210) (-884.695) [-883.702] -- 0:01:07
      106500 -- (-889.576) (-883.217) (-888.839) [-884.376] * (-884.407) [-884.639] (-887.684) (-885.395) -- 0:01:07
      107000 -- (-889.902) (-883.945) [-885.188] (-885.186) * (-885.880) (-887.099) (-886.349) [-884.492] -- 0:01:06
      107500 -- [-886.548] (-884.357) (-885.849) (-884.326) * (-883.935) (-888.404) [-883.591] (-885.951) -- 0:01:06
      108000 -- (-885.719) (-884.820) [-884.445] (-885.271) * [-885.393] (-889.375) (-883.527) (-882.814) -- 0:01:06
      108500 -- [-885.828] (-885.533) (-885.110) (-887.075) * [-883.471] (-887.885) (-884.297) (-882.838) -- 0:01:05
      109000 -- [-885.950] (-886.477) (-884.932) (-889.703) * (-884.800) (-887.772) (-885.212) [-885.266] -- 0:01:05
      109500 -- [-883.758] (-884.845) (-882.985) (-883.674) * (-883.849) (-883.869) (-886.275) [-884.101] -- 0:01:05
      110000 -- (-885.031) [-883.499] (-884.169) (-885.073) * (-885.582) [-883.518] (-883.924) (-888.069) -- 0:01:04

      Average standard deviation of split frequencies: 0.030426

      110500 -- (-888.935) (-883.850) (-884.859) [-887.188] * (-884.748) (-883.081) [-886.237] (-887.533) -- 0:01:04
      111000 -- (-884.399) [-885.598] (-884.302) (-883.066) * (-886.100) (-883.397) (-884.829) [-885.516] -- 0:01:04
      111500 -- (-886.974) (-884.791) [-883.760] (-883.137) * (-886.630) (-883.103) (-885.489) [-885.511] -- 0:01:03
      112000 -- (-885.883) (-884.222) (-886.843) [-886.385] * (-885.490) (-884.925) (-885.308) [-887.665] -- 0:01:03
      112500 -- (-884.797) (-884.023) [-885.938] (-883.022) * (-885.025) (-888.060) (-884.279) [-884.620] -- 0:01:03
      113000 -- (-884.029) (-883.849) [-884.973] (-885.204) * (-886.031) (-886.370) [-884.240] (-885.344) -- 0:01:02
      113500 -- (-887.045) (-883.548) [-885.942] (-886.494) * (-884.328) [-885.543] (-883.246) (-885.244) -- 0:01:02
      114000 -- [-883.721] (-887.041) (-884.519) (-886.486) * (-886.816) [-884.625] (-883.148) (-885.232) -- 0:01:02
      114500 -- (-887.000) [-884.379] (-884.049) (-887.987) * (-883.368) (-886.670) [-883.320] (-883.595) -- 0:01:01
      115000 -- (-883.778) [-887.007] (-885.497) (-884.815) * (-887.385) [-883.525] (-884.264) (-883.560) -- 0:01:01

      Average standard deviation of split frequencies: 0.029221

      115500 -- [-883.354] (-885.526) (-885.245) (-883.810) * (-887.431) [-885.359] (-885.212) (-884.609) -- 0:01:01
      116000 -- [-883.589] (-885.449) (-883.934) (-889.679) * (-883.951) [-885.082] (-885.937) (-884.130) -- 0:01:00
      116500 -- (-884.308) (-889.436) [-883.687] (-890.335) * (-885.570) [-883.252] (-886.793) (-889.960) -- 0:01:08
      117000 -- (-883.075) (-887.336) [-883.594] (-886.344) * (-886.549) (-883.539) [-885.342] (-883.700) -- 0:01:07
      117500 -- (-885.226) [-884.456] (-885.359) (-886.784) * (-889.317) (-883.326) (-887.078) [-884.834] -- 0:01:07
      118000 -- (-888.244) (-885.421) [-887.828] (-891.650) * [-883.199] (-883.405) (-887.848) (-883.420) -- 0:01:07
      118500 -- (-887.229) (-886.377) [-885.721] (-887.871) * (-883.925) [-886.516] (-885.521) (-883.935) -- 0:01:06
      119000 -- (-885.585) [-886.323] (-883.937) (-886.288) * (-883.529) (-885.870) [-886.051] (-885.369) -- 0:01:06
      119500 -- [-890.773] (-885.469) (-886.561) (-883.516) * (-883.910) (-884.241) [-885.492] (-885.157) -- 0:01:06
      120000 -- [-885.451] (-885.723) (-886.987) (-885.446) * (-884.616) (-885.602) [-883.431] (-886.733) -- 0:01:06

      Average standard deviation of split frequencies: 0.028835

      120500 -- (-886.178) (-885.132) [-885.970] (-884.292) * [-884.734] (-886.290) (-884.038) (-890.600) -- 0:01:05
      121000 -- (-886.452) (-885.043) [-886.217] (-886.046) * [-883.514] (-885.345) (-883.184) (-884.778) -- 0:01:05
      121500 -- (-886.492) [-884.093] (-884.163) (-886.082) * [-884.810] (-889.742) (-884.180) (-888.466) -- 0:01:05
      122000 -- (-889.614) (-884.287) [-886.201] (-885.859) * (-886.092) (-890.501) (-884.823) [-887.775] -- 0:01:04
      122500 -- (-887.045) (-886.180) [-886.345] (-889.010) * (-884.611) [-884.142] (-885.289) (-884.604) -- 0:01:04
      123000 -- (-887.266) (-883.660) [-882.893] (-888.516) * (-888.574) (-883.205) (-885.432) [-887.031] -- 0:01:04
      123500 -- [-883.379] (-884.256) (-884.312) (-886.531) * (-885.076) [-882.946] (-885.159) (-885.821) -- 0:01:03
      124000 -- [-885.755] (-886.189) (-884.193) (-885.259) * (-883.204) (-883.341) (-884.850) [-883.023] -- 0:01:03
      124500 -- (-883.540) [-884.831] (-885.286) (-884.984) * (-885.792) (-883.267) (-885.560) [-884.182] -- 0:01:03
      125000 -- [-887.250] (-885.362) (-889.291) (-885.608) * (-886.787) (-885.165) (-885.401) [-886.242] -- 0:01:03

      Average standard deviation of split frequencies: 0.030643

      125500 -- [-888.486] (-884.533) (-887.227) (-885.968) * (-884.195) [-885.560] (-885.021) (-885.529) -- 0:01:02
      126000 -- (-885.147) [-884.046] (-885.505) (-889.251) * (-884.837) (-886.583) [-886.146] (-886.443) -- 0:01:02
      126500 -- [-885.181] (-884.309) (-885.948) (-886.830) * [-886.125] (-883.609) (-883.929) (-885.819) -- 0:01:02
      127000 -- (-883.210) [-884.076] (-883.923) (-886.095) * (-889.080) [-883.461] (-883.761) (-887.213) -- 0:01:01
      127500 -- (-884.992) [-886.562] (-887.042) (-883.896) * [-883.015] (-883.281) (-883.649) (-887.044) -- 0:01:01
      128000 -- [-884.377] (-887.025) (-885.284) (-886.405) * (-883.807) (-887.950) (-885.663) [-884.746] -- 0:01:01
      128500 -- (-883.293) (-886.491) [-883.359] (-884.087) * (-885.648) (-886.894) (-884.175) [-883.931] -- 0:01:01
      129000 -- [-886.542] (-883.354) (-883.371) (-883.107) * (-885.271) [-885.169] (-884.922) (-883.009) -- 0:01:00
      129500 -- [-884.847] (-886.176) (-882.900) (-884.411) * (-890.396) (-885.084) [-883.662] (-885.117) -- 0:01:00
      130000 -- (-884.852) (-888.809) [-882.820] (-884.288) * (-885.727) [-886.808] (-886.448) (-886.134) -- 0:01:00

      Average standard deviation of split frequencies: 0.030579

      130500 -- (-885.981) [-883.107] (-886.254) (-883.956) * (-884.143) (-885.444) [-885.963] (-883.760) -- 0:01:06
      131000 -- (-883.401) (-885.741) [-884.903] (-884.064) * [-886.184] (-883.508) (-885.275) (-884.040) -- 0:01:06
      131500 -- (-884.192) (-886.996) [-886.326] (-891.875) * (-885.652) [-883.759] (-891.578) (-885.296) -- 0:01:06
      132000 -- (-882.862) [-885.462] (-887.383) (-888.416) * (-885.107) (-886.006) [-886.214] (-883.428) -- 0:01:05
      132500 -- (-888.640) (-888.123) [-885.091] (-883.694) * (-885.727) (-886.670) (-887.253) [-882.949] -- 0:01:05
      133000 -- (-885.915) (-884.312) (-885.092) [-883.191] * [-885.424] (-884.303) (-884.721) (-884.368) -- 0:01:05
      133500 -- (-888.179) (-883.767) [-885.239] (-884.654) * (-885.350) [-883.537] (-882.918) (-885.198) -- 0:01:04
      134000 -- (-890.115) (-882.986) (-884.692) [-885.281] * (-885.732) (-884.589) [-884.287] (-884.489) -- 0:01:04
      134500 -- (-886.382) [-883.858] (-886.645) (-883.081) * (-883.205) [-884.836] (-887.073) (-884.037) -- 0:01:04
      135000 -- (-886.262) (-887.460) (-886.996) [-883.320] * [-886.251] (-884.788) (-883.868) (-887.092) -- 0:01:04

      Average standard deviation of split frequencies: 0.029215

      135500 -- (-884.496) (-885.017) [-885.800] (-885.571) * (-886.559) [-883.087] (-885.955) (-886.032) -- 0:01:03
      136000 -- (-884.566) (-883.838) [-885.038] (-885.620) * [-885.020] (-885.283) (-887.103) (-888.209) -- 0:01:03
      136500 -- (-884.154) [-885.724] (-886.519) (-887.463) * (-884.900) (-884.483) [-885.227] (-888.470) -- 0:01:03
      137000 -- (-886.525) [-885.108] (-884.469) (-884.231) * (-882.918) (-885.321) (-886.268) [-889.102] -- 0:01:02
      137500 -- [-883.856] (-885.679) (-883.740) (-886.476) * (-883.953) [-883.103] (-884.575) (-887.076) -- 0:01:02
      138000 -- [-883.646] (-884.401) (-886.271) (-885.855) * (-886.635) (-891.494) [-883.721] (-887.475) -- 0:01:02
      138500 -- (-883.405) [-888.604] (-883.782) (-888.269) * (-884.538) [-888.711] (-886.423) (-885.448) -- 0:01:02
      139000 -- (-884.039) (-887.031) [-884.669] (-896.044) * (-888.756) (-886.612) (-885.441) [-883.730] -- 0:01:01
      139500 -- [-886.225] (-885.178) (-885.562) (-888.478) * (-886.990) [-883.587] (-883.700) (-884.977) -- 0:01:01
      140000 -- (-885.139) (-886.731) (-883.898) [-885.205] * (-884.522) [-885.396] (-883.530) (-893.975) -- 0:01:01

      Average standard deviation of split frequencies: 0.027648

      140500 -- [-885.546] (-886.061) (-884.597) (-884.094) * [-883.580] (-884.781) (-884.860) (-886.376) -- 0:01:01
      141000 -- (-883.960) [-890.080] (-883.691) (-886.509) * (-885.085) (-888.018) (-884.594) [-883.037] -- 0:01:00
      141500 -- (-884.297) [-882.812] (-886.024) (-886.967) * (-886.284) (-886.414) (-883.535) [-884.314] -- 0:01:00
      142000 -- (-883.174) (-885.316) [-888.652] (-884.287) * (-883.932) (-886.477) [-886.122] (-885.159) -- 0:01:00
      142500 -- (-884.640) (-888.914) (-883.722) [-888.312] * (-885.919) (-883.562) [-884.266] (-885.211) -- 0:01:00
      143000 -- (-883.352) [-883.449] (-885.636) (-883.763) * [-886.335] (-886.126) (-883.505) (-886.070) -- 0:00:59
      143500 -- [-885.034] (-884.347) (-887.389) (-883.288) * (-883.190) [-883.371] (-884.922) (-890.831) -- 0:00:59
      144000 -- (-888.810) [-883.665] (-892.235) (-887.462) * (-882.935) [-883.836] (-884.263) (-887.693) -- 0:00:59
      144500 -- (-885.123) (-885.812) [-884.395] (-883.312) * (-883.110) (-883.479) (-883.721) [-886.813] -- 0:01:05
      145000 -- (-884.562) (-894.062) (-884.365) [-885.505] * (-884.655) (-886.380) [-883.453] (-883.341) -- 0:01:04

      Average standard deviation of split frequencies: 0.028032

      145500 -- (-883.839) (-884.136) (-884.226) [-883.895] * (-886.270) [-884.544] (-883.818) (-883.426) -- 0:01:04
      146000 -- [-883.470] (-884.959) (-883.984) (-884.768) * (-886.088) [-887.590] (-886.567) (-883.047) -- 0:01:04
      146500 -- (-883.433) (-884.747) (-888.221) [-884.822] * (-887.927) (-884.377) (-887.751) [-883.593] -- 0:01:04
      147000 -- (-885.115) (-883.153) (-885.190) [-888.755] * (-882.730) (-886.053) [-890.584] (-886.215) -- 0:01:03
      147500 -- (-884.566) [-885.854] (-883.469) (-883.579) * [-883.544] (-885.791) (-884.533) (-884.368) -- 0:01:03
      148000 -- (-885.122) (-883.641) [-887.058] (-884.847) * (-886.700) (-886.221) (-884.737) [-884.641] -- 0:01:03
      148500 -- [-883.894] (-883.903) (-883.573) (-886.089) * (-885.499) (-883.953) (-883.852) [-884.933] -- 0:01:03
      149000 -- (-884.494) [-884.221] (-884.546) (-889.379) * (-883.468) [-884.301] (-885.824) (-886.887) -- 0:01:02
      149500 -- [-884.443] (-883.962) (-884.033) (-886.708) * (-883.420) (-886.108) (-883.059) [-884.502] -- 0:01:02
      150000 -- (-884.483) [-886.348] (-884.629) (-888.634) * [-884.429] (-883.759) (-884.254) (-890.886) -- 0:01:02

      Average standard deviation of split frequencies: 0.026967

      150500 -- (-884.010) (-886.272) (-887.084) [-886.776] * (-884.428) (-885.555) (-883.982) [-885.751] -- 0:01:02
      151000 -- [-884.206] (-883.035) (-884.980) (-887.449) * (-884.455) (-885.258) (-884.034) [-883.472] -- 0:01:01
      151500 -- [-883.813] (-884.457) (-885.558) (-884.261) * (-885.317) [-885.535] (-882.860) (-886.486) -- 0:01:01
      152000 -- (-885.134) (-883.096) (-885.251) [-883.564] * (-884.454) (-887.641) (-887.439) [-884.334] -- 0:01:01
      152500 -- (-888.504) [-882.825] (-884.865) (-885.223) * (-883.405) [-886.612] (-883.676) (-883.745) -- 0:01:01
      153000 -- [-892.725] (-885.131) (-885.416) (-884.303) * (-883.581) (-883.378) [-883.618] (-883.497) -- 0:01:00
      153500 -- (-885.491) [-885.131] (-888.091) (-884.944) * (-883.793) [-885.821] (-885.964) (-885.627) -- 0:01:00
      154000 -- (-884.586) (-886.258) [-890.023] (-886.387) * (-883.991) (-885.730) [-883.327] (-888.825) -- 0:01:00
      154500 -- (-886.372) (-883.861) [-884.788] (-887.706) * [-883.482] (-884.780) (-889.776) (-886.755) -- 0:01:00
      155000 -- [-886.321] (-886.664) (-884.788) (-887.961) * (-884.808) (-884.883) (-886.980) [-884.830] -- 0:00:59

      Average standard deviation of split frequencies: 0.026333

      155500 -- (-884.364) [-882.975] (-885.308) (-888.836) * (-882.682) (-883.704) (-883.634) [-883.700] -- 0:00:59
      156000 -- (-883.445) [-884.274] (-886.390) (-885.243) * (-884.465) [-885.153] (-885.090) (-883.470) -- 0:00:59
      156500 -- (-883.511) (-889.064) (-887.725) [-883.647] * [-884.601] (-884.782) (-883.651) (-885.526) -- 0:00:59
      157000 -- (-884.386) (-883.154) [-884.060] (-886.705) * [-883.342] (-887.613) (-883.388) (-886.429) -- 0:00:59
      157500 -- (-883.588) (-883.380) (-886.038) [-884.703] * (-884.754) (-888.304) (-884.626) [-885.748] -- 0:00:58
      158000 -- (-884.280) (-884.689) (-884.939) [-886.620] * (-884.329) [-885.949] (-884.957) (-887.668) -- 0:01:03
      158500 -- (-887.328) (-886.379) [-883.935] (-883.029) * (-884.530) [-885.910] (-886.573) (-887.434) -- 0:01:03
      159000 -- (-887.843) (-887.441) (-886.945) [-883.590] * [-891.555] (-885.371) (-884.195) (-885.145) -- 0:01:03
      159500 -- (-885.455) [-884.986] (-886.434) (-884.878) * (-886.878) (-884.519) (-882.623) [-884.152] -- 0:01:03
      160000 -- (-884.111) (-884.271) [-882.814] (-883.906) * (-887.642) (-890.527) [-886.853] (-884.544) -- 0:01:02

      Average standard deviation of split frequencies: 0.022634

      160500 -- (-884.051) (-885.145) (-883.685) [-884.493] * (-883.000) (-892.997) (-883.801) [-886.022] -- 0:01:02
      161000 -- (-887.887) [-885.862] (-883.058) (-884.477) * [-884.099] (-886.318) (-885.385) (-884.543) -- 0:01:02
      161500 -- (-888.610) [-884.027] (-884.103) (-885.535) * (-885.552) [-883.901] (-883.733) (-885.135) -- 0:01:02
      162000 -- [-889.317] (-884.946) (-884.519) (-883.713) * [-887.011] (-884.782) (-884.746) (-882.708) -- 0:01:02
      162500 -- (-889.732) [-885.363] (-885.418) (-883.489) * (-886.747) (-882.684) (-885.358) [-883.426] -- 0:01:01
      163000 -- (-884.706) (-883.080) [-884.023] (-885.177) * (-885.591) (-883.449) [-888.148] (-883.671) -- 0:01:01
      163500 -- (-885.631) (-883.103) [-884.060] (-885.581) * (-885.369) [-883.747] (-886.620) (-883.357) -- 0:01:01
      164000 -- (-883.447) (-882.940) (-884.314) [-887.875] * (-883.525) (-885.932) [-885.253] (-883.610) -- 0:01:01
      164500 -- (-884.007) (-884.062) (-884.477) [-892.702] * (-883.129) (-886.232) (-884.881) [-884.307] -- 0:01:00
      165000 -- (-887.976) (-887.551) [-884.797] (-885.434) * (-885.196) (-886.530) (-883.526) [-885.386] -- 0:01:00

      Average standard deviation of split frequencies: 0.022177

      165500 -- (-883.983) (-887.301) [-884.162] (-884.898) * (-884.619) [-888.474] (-884.489) (-885.245) -- 0:01:00
      166000 -- [-886.851] (-887.477) (-888.855) (-887.550) * (-886.988) (-883.932) (-883.777) [-885.409] -- 0:01:00
      166500 -- (-885.496) (-883.803) [-886.244] (-886.265) * (-886.040) (-884.715) (-883.430) [-883.640] -- 0:01:00
      167000 -- (-884.903) (-883.877) [-884.827] (-887.419) * (-883.846) (-884.364) [-885.196] (-886.873) -- 0:00:59
      167500 -- (-884.407) (-887.739) [-885.485] (-885.611) * (-887.219) (-884.041) (-885.080) [-884.906] -- 0:00:59
      168000 -- (-884.805) [-885.957] (-886.597) (-884.844) * (-884.056) (-887.310) [-884.629] (-885.588) -- 0:00:59
      168500 -- [-885.198] (-883.136) (-887.534) (-882.883) * (-885.127) [-884.394] (-884.143) (-883.638) -- 0:00:59
      169000 -- (-887.269) (-883.605) (-885.581) [-885.650] * (-883.485) (-884.675) (-883.562) [-884.377] -- 0:00:59
      169500 -- (-885.434) [-885.227] (-887.150) (-883.320) * (-883.230) [-885.422] (-884.358) (-884.336) -- 0:00:58
      170000 -- (-883.692) [-886.512] (-884.197) (-884.594) * [-886.968] (-883.964) (-886.800) (-884.259) -- 0:00:58

      Average standard deviation of split frequencies: 0.019887

      170500 -- (-884.162) [-883.148] (-885.464) (-884.195) * [-887.514] (-883.235) (-892.040) (-884.325) -- 0:00:58
      171000 -- (-884.389) [-885.024] (-885.418) (-886.629) * (-889.406) [-883.346] (-887.799) (-884.711) -- 0:00:58
      171500 -- (-885.908) (-884.162) (-886.274) [-883.684] * (-885.577) (-883.296) [-890.711] (-885.244) -- 0:00:57
      172000 -- (-890.267) [-883.690] (-884.127) (-884.498) * (-885.926) (-883.423) (-888.983) [-887.856] -- 0:01:02
      172500 -- [-886.506] (-885.080) (-884.388) (-884.982) * (-885.378) (-883.722) [-885.144] (-884.611) -- 0:01:02
      173000 -- (-884.347) [-884.031] (-888.645) (-883.429) * (-883.839) (-883.912) (-886.687) [-886.342] -- 0:01:02
      173500 -- (-884.906) (-883.479) (-885.053) [-887.017] * (-883.391) (-885.081) (-887.115) [-886.572] -- 0:01:01
      174000 -- (-885.199) (-886.885) (-883.849) [-886.901] * (-886.345) (-890.119) [-884.558] (-884.619) -- 0:01:01
      174500 -- (-883.597) (-885.455) [-885.674] (-883.686) * (-885.104) (-886.242) (-885.794) [-884.594] -- 0:01:01
      175000 -- (-885.925) (-886.336) [-886.125] (-884.670) * (-888.458) [-884.805] (-887.769) (-886.178) -- 0:01:01

      Average standard deviation of split frequencies: 0.021287

      175500 -- (-885.102) [-884.315] (-884.712) (-882.989) * (-886.841) (-884.472) [-885.703] (-886.984) -- 0:01:01
      176000 -- (-892.972) [-883.617] (-884.938) (-887.118) * (-885.928) [-885.718] (-886.602) (-886.120) -- 0:01:00
      176500 -- (-882.734) (-885.004) (-886.800) [-886.712] * [-885.398] (-883.269) (-887.632) (-885.380) -- 0:01:00
      177000 -- (-883.420) [-883.490] (-886.888) (-884.664) * (-886.160) [-883.171] (-886.739) (-884.688) -- 0:01:00
      177500 -- (-884.447) [-885.199] (-888.042) (-885.127) * (-884.497) [-886.166] (-891.536) (-883.323) -- 0:01:00
      178000 -- (-884.165) (-886.560) (-892.525) [-885.644] * (-884.489) [-883.700] (-885.388) (-885.047) -- 0:01:00
      178500 -- (-884.265) (-884.279) (-887.640) [-885.299] * (-883.296) (-883.430) (-884.828) [-883.962] -- 0:00:59
      179000 -- (-883.835) (-887.788) [-887.814] (-883.818) * (-885.567) [-886.253] (-887.036) (-883.499) -- 0:00:59
      179500 -- (-882.857) (-886.524) [-883.380] (-887.336) * (-883.884) (-885.367) (-888.299) [-885.358] -- 0:00:59
      180000 -- [-884.745] (-888.709) (-886.310) (-885.853) * [-883.383] (-883.429) (-888.063) (-885.140) -- 0:00:59

      Average standard deviation of split frequencies: 0.021164

      180500 -- [-883.183] (-883.864) (-885.363) (-884.952) * (-883.020) (-888.462) (-890.146) [-885.800] -- 0:00:59
      181000 -- (-884.972) (-885.765) [-885.364] (-889.232) * (-884.562) (-889.397) (-886.501) [-883.869] -- 0:00:58
      181500 -- (-884.041) [-885.155] (-883.223) (-887.574) * (-883.471) (-885.232) [-885.763] (-884.164) -- 0:00:58
      182000 -- (-885.221) (-885.836) [-883.225] (-886.802) * [-885.119] (-883.669) (-884.131) (-885.856) -- 0:00:58
      182500 -- (-886.095) (-885.197) (-886.221) [-884.341] * (-884.624) [-884.763] (-884.189) (-885.507) -- 0:00:58
      183000 -- (-886.352) (-884.956) (-884.610) [-885.049] * (-888.306) (-890.830) [-886.004] (-886.316) -- 0:00:58
      183500 -- [-884.219] (-885.643) (-884.616) (-884.170) * (-885.665) (-883.889) [-884.777] (-886.353) -- 0:00:57
      184000 -- (-883.732) [-883.420] (-885.758) (-884.942) * (-885.027) (-883.128) [-885.805] (-884.540) -- 0:00:57
      184500 -- [-884.990] (-885.598) (-883.580) (-883.361) * [-883.382] (-887.032) (-884.903) (-888.198) -- 0:00:57
      185000 -- (-884.081) (-882.768) (-886.926) [-886.023] * (-888.011) (-888.984) (-889.323) [-885.486] -- 0:00:57

      Average standard deviation of split frequencies: 0.018882

      185500 -- (-887.119) (-883.685) [-885.105] (-885.244) * [-883.622] (-886.064) (-885.408) (-886.089) -- 0:00:57
      186000 -- (-886.423) (-885.547) [-884.464] (-884.479) * (-887.538) [-883.482] (-885.654) (-886.237) -- 0:01:01
      186500 -- [-885.090] (-883.193) (-887.792) (-884.732) * (-888.422) (-885.580) [-885.478] (-885.745) -- 0:01:01
      187000 -- (-886.572) (-882.608) (-884.547) [-884.105] * (-887.516) (-883.172) (-884.631) [-883.083] -- 0:01:00
      187500 -- (-883.954) [-884.383] (-883.567) (-888.120) * (-885.895) (-884.485) (-883.658) [-885.193] -- 0:01:00
      188000 -- [-883.239] (-883.039) (-885.904) (-890.527) * (-884.368) (-885.201) (-885.021) [-884.741] -- 0:01:00
      188500 -- (-884.080) (-887.196) [-886.152] (-889.758) * (-887.105) (-883.737) (-885.912) [-888.070] -- 0:01:00
      189000 -- [-885.214] (-884.523) (-885.397) (-890.424) * (-885.366) (-886.875) [-887.287] (-885.589) -- 0:01:00
      189500 -- (-884.521) (-884.256) [-885.496] (-886.585) * (-882.987) [-887.011] (-886.055) (-885.691) -- 0:00:59
      190000 -- (-883.096) [-888.131] (-885.386) (-887.974) * [-888.603] (-884.311) (-886.514) (-885.581) -- 0:00:59

      Average standard deviation of split frequencies: 0.018348

      190500 -- (-884.102) [-884.707] (-885.566) (-888.796) * [-886.942] (-883.819) (-885.843) (-888.245) -- 0:00:59
      191000 -- (-884.700) (-886.843) (-884.884) [-886.433] * (-887.679) (-884.204) [-885.020] (-885.304) -- 0:00:59
      191500 -- (-884.270) [-886.289] (-889.219) (-886.839) * (-884.161) (-883.735) [-883.141] (-885.460) -- 0:00:59
      192000 -- (-889.067) [-883.982] (-888.779) (-885.513) * (-885.953) (-883.639) [-883.718] (-885.178) -- 0:00:58
      192500 -- (-888.421) [-885.110] (-885.491) (-885.871) * (-884.410) (-884.326) [-886.137] (-885.014) -- 0:00:58
      193000 -- (-885.364) (-884.018) [-883.051] (-886.880) * (-885.569) (-884.368) [-882.903] (-888.977) -- 0:00:58
      193500 -- (-889.332) [-883.358] (-885.161) (-884.907) * (-884.904) (-884.454) (-883.951) [-886.452] -- 0:00:58
      194000 -- (-888.944) [-883.347] (-887.980) (-883.859) * (-890.116) [-884.069] (-887.210) (-883.265) -- 0:00:58
      194500 -- [-886.552] (-883.852) (-883.392) (-888.376) * (-885.249) (-887.359) (-886.332) [-884.166] -- 0:00:57
      195000 -- (-888.498) [-884.743] (-883.585) (-885.622) * (-884.407) (-885.585) [-886.055] (-886.006) -- 0:00:57

      Average standard deviation of split frequencies: 0.018608

      195500 -- (-891.583) [-884.785] (-883.704) (-886.665) * [-886.107] (-890.024) (-884.346) (-885.307) -- 0:00:57
      196000 -- (-884.636) (-883.950) [-884.681] (-887.308) * (-887.063) (-888.494) (-884.438) [-885.561] -- 0:00:57
      196500 -- (-884.479) (-888.436) [-884.668] (-888.017) * (-891.125) (-884.140) (-883.728) [-884.086] -- 0:00:57
      197000 -- (-890.282) (-885.174) [-883.859] (-886.484) * (-888.878) [-885.661] (-883.430) (-885.355) -- 0:00:57
      197500 -- (-885.799) (-887.324) [-886.237] (-884.854) * (-888.047) (-889.333) [-884.030] (-885.643) -- 0:00:56
      198000 -- (-885.491) (-884.797) [-885.695] (-884.017) * (-884.992) [-886.065] (-886.808) (-887.129) -- 0:00:56
      198500 -- (-885.001) (-885.349) [-888.835] (-883.129) * (-884.552) (-883.451) (-884.013) [-884.389] -- 0:00:56
      199000 -- (-884.572) (-885.618) [-886.349] (-895.618) * (-885.641) (-886.183) (-883.582) [-883.123] -- 0:00:56
      199500 -- [-884.460] (-886.350) (-884.878) (-889.496) * (-885.172) (-883.619) [-883.436] (-884.675) -- 0:01:00
      200000 -- (-885.554) [-884.639] (-885.830) (-885.307) * (-885.095) (-883.678) (-885.208) [-884.992] -- 0:00:59

      Average standard deviation of split frequencies: 0.018299

      200500 -- (-884.852) (-884.340) (-884.289) [-885.802] * [-884.521] (-883.425) (-886.335) (-884.463) -- 0:00:59
      201000 -- (-885.513) [-890.637] (-884.519) (-886.617) * [-884.954] (-884.265) (-885.815) (-884.794) -- 0:00:59
      201500 -- (-885.869) (-890.623) [-884.305] (-889.130) * [-883.394] (-886.645) (-884.465) (-890.460) -- 0:00:59
      202000 -- (-888.719) (-888.772) [-885.538] (-886.654) * (-882.952) (-884.918) [-883.070] (-888.203) -- 0:00:59
      202500 -- (-883.807) (-885.138) (-882.738) [-884.894] * (-888.387) [-885.995] (-883.328) (-886.832) -- 0:00:59
      203000 -- (-883.749) [-885.978] (-883.179) (-883.207) * (-890.429) (-886.871) (-884.756) [-889.136] -- 0:00:58
      203500 -- (-883.648) (-885.475) [-885.127] (-883.306) * (-887.434) (-884.004) [-884.271] (-885.322) -- 0:00:58
      204000 -- (-882.956) (-886.313) (-884.935) [-883.853] * [-884.308] (-884.027) (-884.172) (-884.320) -- 0:00:58
      204500 -- (-883.016) (-884.690) (-885.001) [-883.309] * [-883.099] (-885.614) (-883.924) (-882.786) -- 0:00:58
      205000 -- [-886.222] (-886.111) (-884.983) (-884.765) * [-883.674] (-889.216) (-884.284) (-884.025) -- 0:00:58

      Average standard deviation of split frequencies: 0.016133

      205500 -- (-886.832) [-884.394] (-883.401) (-883.126) * [-883.237] (-884.388) (-884.776) (-885.470) -- 0:00:57
      206000 -- (-885.570) [-883.428] (-883.641) (-885.520) * (-883.103) (-883.825) [-884.607] (-885.788) -- 0:00:57
      206500 -- [-883.005] (-885.960) (-883.600) (-885.080) * (-882.856) (-884.571) [-884.316] (-886.119) -- 0:00:57
      207000 -- (-884.021) (-889.643) [-883.128] (-885.160) * (-888.781) (-886.499) (-888.863) [-887.846] -- 0:00:57
      207500 -- (-886.627) (-887.960) (-885.275) [-884.459] * (-882.871) [-885.085] (-887.866) (-886.031) -- 0:00:57
      208000 -- (-885.179) [-887.268] (-883.623) (-883.561) * [-884.441] (-885.589) (-883.920) (-885.856) -- 0:00:57
      208500 -- (-884.766) (-886.760) (-882.693) [-883.434] * (-883.683) [-886.162] (-883.571) (-884.484) -- 0:00:56
      209000 -- [-883.788] (-887.878) (-886.647) (-886.007) * (-884.717) [-883.856] (-885.734) (-889.512) -- 0:00:56
      209500 -- (-884.476) (-888.682) [-884.808] (-885.292) * (-885.267) (-883.943) (-885.006) [-885.640] -- 0:00:56
      210000 -- [-885.091] (-887.888) (-885.629) (-886.784) * [-886.855] (-883.334) (-884.252) (-885.423) -- 0:00:56

      Average standard deviation of split frequencies: 0.015166

      210500 -- (-886.776) (-892.435) (-883.042) [-885.436] * (-884.494) (-884.788) (-884.676) [-884.589] -- 0:00:56
      211000 -- (-884.372) [-883.681] (-883.563) (-883.101) * (-885.243) (-885.417) [-883.928] (-884.624) -- 0:00:56
      211500 -- (-886.279) (-888.999) (-885.029) [-883.859] * [-884.795] (-883.641) (-884.484) (-891.693) -- 0:00:55
      212000 -- (-884.091) (-884.475) (-884.134) [-883.539] * (-883.282) (-884.322) [-884.968] (-888.927) -- 0:00:55
      212500 -- (-883.441) [-885.359] (-884.094) (-883.630) * (-887.946) [-884.515] (-883.859) (-885.269) -- 0:00:55
      213000 -- (-887.671) (-884.682) (-883.901) [-885.815] * (-888.895) [-884.614] (-883.930) (-885.651) -- 0:00:55
      213500 -- [-886.591] (-883.397) (-890.294) (-885.815) * (-886.656) (-886.344) [-883.688] (-883.324) -- 0:00:58
      214000 -- (-888.828) (-885.995) (-886.115) [-885.523] * (-885.689) (-887.330) [-882.772] (-883.990) -- 0:00:58
      214500 -- [-884.896] (-885.670) (-885.914) (-884.051) * (-885.997) [-890.626] (-883.088) (-884.013) -- 0:00:58
      215000 -- (-883.721) (-887.780) [-884.413] (-886.429) * (-885.774) (-888.858) (-883.026) [-884.182] -- 0:00:58

      Average standard deviation of split frequencies: 0.015736

      215500 -- (-884.853) [-885.581] (-884.971) (-883.406) * (-886.418) [-887.177] (-883.023) (-884.727) -- 0:00:58
      216000 -- (-885.542) (-883.922) [-883.851] (-884.091) * (-883.223) [-885.963] (-883.301) (-883.180) -- 0:00:58
      216500 -- (-888.818) [-884.300] (-886.455) (-884.528) * (-887.272) (-887.060) (-884.845) [-882.629] -- 0:00:57
      217000 -- [-885.888] (-892.049) (-885.730) (-885.886) * (-885.748) (-886.890) (-884.664) [-884.061] -- 0:00:57
      217500 -- (-891.262) (-887.082) [-886.422] (-886.084) * (-885.351) [-886.517] (-885.816) (-884.246) -- 0:00:57
      218000 -- (-886.061) (-882.805) (-885.063) [-885.817] * (-885.278) (-891.529) (-885.877) [-882.898] -- 0:00:57
      218500 -- (-883.855) (-883.327) (-884.015) [-883.016] * (-887.496) [-886.556] (-883.458) (-887.440) -- 0:00:57
      219000 -- (-884.434) (-884.261) (-883.987) [-884.029] * (-884.617) [-885.147] (-883.044) (-884.437) -- 0:00:57
      219500 -- [-885.237] (-883.454) (-886.497) (-887.406) * (-883.840) [-884.815] (-883.039) (-883.539) -- 0:00:56
      220000 -- [-888.283] (-883.972) (-884.895) (-885.253) * (-884.111) (-884.557) (-884.143) [-882.951] -- 0:00:56

      Average standard deviation of split frequencies: 0.015966

      220500 -- (-886.136) [-884.250] (-885.445) (-884.296) * [-884.314] (-883.341) (-884.336) (-883.008) -- 0:00:56
      221000 -- (-886.744) (-882.685) (-885.210) [-883.231] * (-884.045) (-884.503) (-884.217) [-883.169] -- 0:00:56
      221500 -- (-885.431) [-884.050] (-886.630) (-884.237) * (-884.881) (-884.267) (-888.643) [-883.590] -- 0:00:56
      222000 -- (-885.333) [-884.775] (-884.010) (-885.571) * [-885.259] (-888.534) (-885.203) (-885.106) -- 0:00:56
      222500 -- (-887.165) (-884.757) [-885.685] (-886.369) * (-883.891) (-884.859) [-886.016] (-883.702) -- 0:00:55
      223000 -- [-888.532] (-885.307) (-883.352) (-884.531) * [-884.322] (-884.948) (-885.298) (-883.961) -- 0:00:55
      223500 -- (-885.201) (-885.212) [-886.493] (-887.522) * (-884.440) (-884.878) (-883.229) [-884.374] -- 0:00:55
      224000 -- (-886.389) [-885.331] (-884.049) (-889.399) * (-883.839) (-889.735) (-886.468) [-883.404] -- 0:00:55
      224500 -- [-886.132] (-885.083) (-887.896) (-889.497) * (-887.340) (-885.757) (-886.534) [-884.021] -- 0:00:55
      225000 -- (-883.446) (-886.496) (-883.855) [-886.255] * [-885.001] (-886.518) (-886.273) (-884.298) -- 0:00:55

      Average standard deviation of split frequencies: 0.015644

      225500 -- (-886.598) (-887.565) [-885.074] (-885.805) * (-884.814) (-883.832) (-886.714) [-885.483] -- 0:00:54
      226000 -- (-882.870) (-884.919) (-886.426) [-885.887] * (-883.343) (-886.405) (-885.102) [-883.884] -- 0:00:54
      226500 -- (-885.447) (-889.749) [-885.776] (-884.633) * (-883.625) (-887.035) (-887.361) [-888.122] -- 0:00:54
      227000 -- (-885.358) (-890.008) [-885.347] (-887.229) * (-883.325) [-884.594] (-884.613) (-883.713) -- 0:00:54
      227500 -- (-883.161) (-887.835) [-886.930] (-885.562) * [-883.143] (-883.979) (-884.679) (-886.508) -- 0:00:57
      228000 -- [-884.851] (-887.558) (-884.482) (-887.188) * (-886.579) (-887.999) [-883.608] (-888.400) -- 0:00:57
      228500 -- (-885.368) [-883.968] (-884.415) (-888.505) * (-884.018) [-884.126] (-884.618) (-891.719) -- 0:00:57
      229000 -- (-884.382) [-884.290] (-889.693) (-886.178) * (-886.262) (-885.030) (-886.089) [-889.086] -- 0:00:57
      229500 -- (-884.376) (-883.563) [-885.522] (-885.580) * (-888.591) (-884.794) [-884.046] (-886.678) -- 0:00:57
      230000 -- [-885.792] (-886.314) (-885.991) (-886.263) * [-883.361] (-885.970) (-888.718) (-887.231) -- 0:00:56

      Average standard deviation of split frequencies: 0.015736

      230500 -- [-885.264] (-887.483) (-885.967) (-882.882) * (-885.108) [-885.371] (-887.107) (-885.000) -- 0:00:56
      231000 -- [-884.880] (-884.291) (-884.018) (-885.334) * (-884.205) (-883.973) [-886.944] (-885.681) -- 0:00:56
      231500 -- (-887.661) (-886.452) [-885.923] (-886.800) * (-884.829) (-885.512) [-885.552] (-884.138) -- 0:00:56
      232000 -- (-884.930) (-884.232) [-885.493] (-889.586) * (-885.301) [-884.189] (-885.041) (-883.997) -- 0:00:56
      232500 -- (-886.678) (-884.405) [-885.460] (-884.995) * [-884.216] (-886.834) (-884.671) (-885.776) -- 0:00:56
      233000 -- (-884.288) [-883.744] (-887.780) (-883.509) * (-888.823) (-883.458) (-886.551) [-886.917] -- 0:00:55
      233500 -- (-885.091) [-888.295] (-886.923) (-884.127) * (-885.696) (-882.804) (-884.664) [-883.483] -- 0:00:55
      234000 -- (-886.387) [-885.015] (-883.789) (-886.434) * (-886.305) (-884.089) (-888.533) [-884.277] -- 0:00:55
      234500 -- (-885.284) [-886.741] (-883.826) (-886.178) * [-886.500] (-884.189) (-883.653) (-884.259) -- 0:00:55
      235000 -- (-883.922) (-886.881) [-883.287] (-883.918) * (-885.805) [-885.774] (-883.503) (-884.712) -- 0:00:55

      Average standard deviation of split frequencies: 0.015880

      235500 -- (-883.757) [-887.932] (-884.057) (-883.099) * (-884.810) (-884.030) (-884.133) [-884.087] -- 0:00:55
      236000 -- (-883.913) (-883.926) (-883.280) [-884.073] * (-886.590) (-885.999) [-883.904] (-884.258) -- 0:00:55
      236500 -- [-885.081] (-886.729) (-883.051) (-884.197) * [-886.242] (-885.511) (-890.149) (-888.546) -- 0:00:54
      237000 -- [-884.001] (-885.255) (-886.654) (-883.529) * [-882.906] (-884.276) (-883.891) (-895.796) -- 0:00:54
      237500 -- (-883.582) (-886.586) [-886.316] (-885.508) * [-884.737] (-885.142) (-892.899) (-894.819) -- 0:00:54
      238000 -- [-885.109] (-883.276) (-884.231) (-885.286) * (-885.379) [-885.055] (-885.322) (-887.598) -- 0:00:54
      238500 -- [-884.012] (-889.918) (-885.517) (-883.549) * (-886.323) (-884.426) (-886.465) [-883.420] -- 0:00:54
      239000 -- (-883.959) (-887.884) [-884.338] (-885.110) * (-885.436) (-885.473) [-886.433] (-884.210) -- 0:00:54
      239500 -- (-884.844) [-887.062] (-884.946) (-885.799) * (-883.520) [-883.453] (-884.111) (-885.402) -- 0:00:53
      240000 -- [-884.770] (-889.430) (-885.545) (-887.461) * [-883.086] (-886.138) (-883.274) (-886.155) -- 0:00:53

      Average standard deviation of split frequencies: 0.014948

      240500 -- (-885.248) (-886.772) (-885.160) [-884.253] * (-885.217) (-884.947) [-885.005] (-888.252) -- 0:00:53
      241000 -- (-884.728) [-884.828] (-884.406) (-886.482) * (-886.711) (-883.018) (-886.513) [-885.817] -- 0:00:56
      241500 -- (-886.180) (-886.644) [-887.916] (-885.578) * (-885.563) (-883.497) [-883.088] (-882.704) -- 0:00:56
      242000 -- [-886.482] (-887.322) (-884.297) (-888.460) * (-891.913) (-884.135) [-883.056] (-883.596) -- 0:00:56
      242500 -- (-885.580) (-883.002) [-884.928] (-888.662) * (-884.720) [-883.611] (-883.544) (-886.390) -- 0:00:56
      243000 -- (-884.705) (-883.910) [-883.672] (-884.964) * [-884.216] (-884.749) (-883.580) (-887.651) -- 0:00:56
      243500 -- (-885.470) [-884.623] (-883.364) (-883.118) * (-883.669) [-882.782] (-885.051) (-883.864) -- 0:00:55
      244000 -- [-884.396] (-884.182) (-887.102) (-883.268) * [-883.789] (-885.041) (-885.541) (-886.580) -- 0:00:55
      244500 -- (-886.273) [-882.619] (-887.886) (-883.593) * [-888.180] (-884.276) (-883.716) (-884.448) -- 0:00:55
      245000 -- (-885.288) (-882.937) (-882.671) [-884.012] * (-885.013) (-884.757) (-884.076) [-883.542] -- 0:00:55

      Average standard deviation of split frequencies: 0.014221

      245500 -- [-883.227] (-883.423) (-885.786) (-885.485) * (-886.107) (-889.266) [-883.818] (-886.803) -- 0:00:55
      246000 -- [-883.666] (-883.525) (-886.162) (-884.341) * (-886.298) [-886.485] (-885.969) (-890.528) -- 0:00:55
      246500 -- (-886.173) [-884.693] (-884.459) (-883.667) * (-885.504) (-883.506) (-886.426) [-884.130] -- 0:00:55
      247000 -- (-891.173) [-883.473] (-885.561) (-888.692) * [-885.464] (-886.455) (-887.270) (-884.752) -- 0:00:54
      247500 -- (-887.342) (-885.390) [-883.939] (-887.975) * [-884.469] (-883.955) (-884.071) (-884.421) -- 0:00:54
      248000 -- (-884.790) (-889.127) (-884.839) [-885.083] * [-883.997] (-884.928) (-884.729) (-883.682) -- 0:00:54
      248500 -- [-885.257] (-884.012) (-884.467) (-884.377) * [-884.325] (-884.184) (-883.750) (-884.667) -- 0:00:54
      249000 -- (-886.970) (-884.247) [-883.837] (-884.053) * [-884.503] (-884.566) (-892.007) (-883.001) -- 0:00:54
      249500 -- (-888.622) (-883.680) (-884.947) [-887.164] * [-885.608] (-883.564) (-884.428) (-885.252) -- 0:00:54
      250000 -- (-886.993) (-885.498) [-883.362] (-889.896) * [-886.614] (-884.496) (-885.110) (-884.222) -- 0:00:54

      Average standard deviation of split frequencies: 0.012224

      250500 -- (-886.462) (-884.158) (-883.364) [-884.362] * (-888.153) (-888.596) [-884.223] (-884.839) -- 0:00:53
      251000 -- [-884.353] (-886.944) (-884.929) (-884.888) * (-885.689) (-887.551) [-884.462] (-884.775) -- 0:00:53
      251500 -- [-883.315] (-889.623) (-886.858) (-885.481) * [-884.528] (-886.602) (-883.394) (-884.676) -- 0:00:53
      252000 -- (-884.494) (-884.817) (-883.896) [-886.446] * (-885.576) (-882.844) (-883.522) [-885.719] -- 0:00:53
      252500 -- (-884.396) (-883.547) (-884.214) [-883.420] * [-885.681] (-884.138) (-884.563) (-887.217) -- 0:00:53
      253000 -- [-884.375] (-883.850) (-886.634) (-885.602) * (-883.481) (-885.486) (-883.506) [-883.265] -- 0:00:53
      253500 -- (-885.984) (-885.031) (-885.561) [-884.720] * (-885.840) (-885.286) (-883.517) [-886.328] -- 0:00:53
      254000 -- (-884.837) [-886.240] (-889.838) (-883.771) * (-885.349) [-884.723] (-882.722) (-888.077) -- 0:00:52
      254500 -- (-882.813) (-884.213) (-886.489) [-884.116] * (-886.755) [-885.352] (-883.738) (-887.013) -- 0:00:52
      255000 -- [-882.818] (-886.436) (-882.695) (-883.625) * (-887.184) [-885.255] (-884.666) (-885.524) -- 0:00:55

      Average standard deviation of split frequencies: 0.010742

      255500 -- (-884.471) (-884.174) [-884.669] (-883.172) * (-883.814) (-884.096) [-885.771] (-884.800) -- 0:00:55
      256000 -- (-885.703) (-883.676) (-884.461) [-883.077] * (-884.242) (-883.406) [-885.156] (-883.068) -- 0:00:55
      256500 -- [-884.283] (-886.574) (-886.473) (-883.514) * (-884.995) [-884.771] (-886.808) (-884.042) -- 0:00:55
      257000 -- (-888.814) (-884.972) [-885.901] (-885.289) * (-888.082) (-884.938) (-885.974) [-883.476] -- 0:00:54
      257500 -- [-883.305] (-885.592) (-884.695) (-886.350) * [-888.189] (-884.174) (-888.148) (-883.649) -- 0:00:54
      258000 -- (-884.069) (-883.999) (-887.696) [-884.712] * (-885.474) (-883.085) (-885.705) [-885.228] -- 0:00:54
      258500 -- [-884.114] (-885.361) (-883.432) (-886.205) * [-882.843] (-883.849) (-883.491) (-883.543) -- 0:00:54
      259000 -- (-883.895) (-884.849) [-884.697] (-886.699) * (-885.978) [-886.362] (-883.962) (-884.195) -- 0:00:54
      259500 -- (-884.519) (-884.427) (-885.337) [-884.937] * [-883.689] (-886.272) (-885.135) (-886.113) -- 0:00:54
      260000 -- (-885.629) (-883.525) [-883.195] (-886.070) * (-885.724) (-889.275) (-885.158) [-887.792] -- 0:00:54

      Average standard deviation of split frequencies: 0.010650

      260500 -- (-883.434) (-884.996) [-884.725] (-886.551) * [-886.194] (-887.955) (-886.136) (-884.932) -- 0:00:53
      261000 -- (-884.028) (-886.563) [-883.876] (-885.173) * (-889.199) (-886.416) (-886.725) [-883.302] -- 0:00:53
      261500 -- (-884.122) [-887.379] (-883.749) (-889.521) * (-889.099) [-884.954] (-892.823) (-883.544) -- 0:00:53
      262000 -- (-887.912) (-885.954) (-884.267) [-885.463] * (-888.517) (-888.119) [-884.558] (-883.544) -- 0:00:53
      262500 -- (-886.719) (-884.955) (-884.072) [-885.989] * (-889.040) (-884.672) [-883.206] (-883.544) -- 0:00:53
      263000 -- (-886.336) (-885.689) (-884.446) [-883.785] * [-884.624] (-883.425) (-884.308) (-883.550) -- 0:00:53
      263500 -- (-884.109) (-884.369) [-885.056] (-883.136) * [-884.779] (-887.342) (-883.988) (-883.605) -- 0:00:53
      264000 -- (-884.879) (-888.964) [-886.994] (-885.057) * (-888.439) (-885.423) [-886.004] (-883.578) -- 0:00:52
      264500 -- (-884.638) (-883.681) (-883.463) [-885.224] * (-882.805) [-883.903] (-884.419) (-885.885) -- 0:00:52
      265000 -- (-885.035) [-884.118] (-883.915) (-884.295) * (-885.712) [-885.732] (-884.084) (-884.350) -- 0:00:52

      Average standard deviation of split frequencies: 0.010338

      265500 -- [-885.176] (-886.077) (-884.025) (-887.741) * (-885.148) (-884.241) (-886.301) [-883.445] -- 0:00:52
      266000 -- [-885.477] (-886.955) (-885.610) (-885.042) * [-884.748] (-883.199) (-883.547) (-885.720) -- 0:00:52
      266500 -- (-885.409) (-885.885) (-883.562) [-884.430] * [-883.446] (-883.234) (-882.841) (-884.960) -- 0:00:52
      267000 -- [-886.656] (-885.643) (-885.109) (-887.390) * (-884.940) [-883.432] (-885.162) (-884.967) -- 0:00:52
      267500 -- (-884.588) [-884.629] (-883.419) (-885.150) * (-884.218) [-884.848] (-887.609) (-885.050) -- 0:00:52
      268000 -- (-883.392) [-886.041] (-885.095) (-884.484) * (-883.302) (-885.445) (-886.281) [-889.389] -- 0:00:51
      268500 -- (-885.383) (-888.377) [-885.811] (-884.324) * (-885.400) (-886.152) (-886.475) [-883.708] -- 0:00:51
      269000 -- [-886.123] (-887.556) (-884.475) (-883.615) * (-885.407) (-885.873) [-887.144] (-884.111) -- 0:00:54
      269500 -- (-883.608) (-888.975) [-883.619] (-883.629) * (-889.490) (-886.785) [-885.235] (-883.515) -- 0:00:54
      270000 -- [-885.775] (-883.878) (-883.559) (-883.024) * [-885.943] (-889.712) (-884.757) (-886.163) -- 0:00:54

      Average standard deviation of split frequencies: 0.011577

      270500 -- (-887.565) [-885.389] (-883.798) (-884.497) * (-883.686) (-886.362) [-883.719] (-886.215) -- 0:00:53
      271000 -- (-887.379) (-885.611) (-886.478) [-884.066] * (-883.205) (-888.184) [-886.621] (-887.373) -- 0:00:53
      271500 -- (-889.244) [-882.973] (-886.386) (-885.484) * (-886.820) (-884.636) [-883.856] (-884.963) -- 0:00:53
      272000 -- (-885.605) [-883.840] (-888.224) (-885.261) * (-890.033) (-885.578) [-885.348] (-884.783) -- 0:00:53
      272500 -- (-883.834) [-884.469] (-886.517) (-884.345) * [-884.182] (-886.755) (-884.196) (-884.497) -- 0:00:53
      273000 -- (-883.126) [-885.600] (-885.208) (-887.915) * [-884.913] (-888.660) (-884.549) (-885.024) -- 0:00:53
      273500 -- [-882.940] (-890.924) (-885.323) (-892.428) * (-885.868) (-883.182) [-885.018] (-883.184) -- 0:00:53
      274000 -- (-884.919) [-887.116] (-884.733) (-882.896) * (-885.387) (-888.525) [-887.802] (-886.382) -- 0:00:52
      274500 -- (-885.306) (-885.595) (-883.377) [-885.715] * [-885.321] (-888.526) (-886.375) (-888.669) -- 0:00:52
      275000 -- [-884.267] (-885.094) (-884.179) (-885.642) * (-884.551) (-886.034) (-883.278) [-883.808] -- 0:00:52

      Average standard deviation of split frequencies: 0.010533

      275500 -- (-887.626) [-883.464] (-884.140) (-884.745) * [-884.387] (-885.049) (-884.228) (-885.765) -- 0:00:52
      276000 -- (-884.444) [-888.368] (-884.056) (-886.037) * (-884.599) (-885.435) (-883.850) [-883.773] -- 0:00:52
      276500 -- [-884.235] (-885.224) (-882.868) (-889.886) * (-887.241) (-884.434) [-883.715] (-883.751) -- 0:00:52
      277000 -- (-883.963) (-884.600) (-884.332) [-885.084] * [-884.979] (-885.910) (-887.304) (-883.607) -- 0:00:52
      277500 -- (-883.988) (-885.156) (-883.059) [-887.723] * [-887.594] (-885.565) (-885.555) (-886.756) -- 0:00:52
      278000 -- (-884.859) [-882.980] (-883.788) (-885.827) * (-889.634) [-884.828] (-886.933) (-885.147) -- 0:00:51
      278500 -- [-883.521] (-884.502) (-883.736) (-891.536) * (-882.853) (-886.252) [-884.061] (-883.224) -- 0:00:51
      279000 -- (-888.384) (-884.277) [-885.857] (-889.988) * (-884.775) (-884.081) (-884.687) [-884.019] -- 0:00:51
      279500 -- (-887.012) (-884.673) [-886.519] (-884.901) * (-885.898) [-883.585] (-887.258) (-885.298) -- 0:00:51
      280000 -- [-885.169] (-883.833) (-885.798) (-886.517) * [-884.351] (-883.415) (-886.374) (-886.675) -- 0:00:51

      Average standard deviation of split frequencies: 0.010637

      280500 -- [-884.517] (-883.885) (-883.857) (-884.248) * [-885.013] (-884.532) (-890.648) (-885.836) -- 0:00:51
      281000 -- (-885.624) (-884.991) (-884.892) [-885.013] * (-886.071) (-883.824) [-884.571] (-886.950) -- 0:00:51
      281500 -- (-884.571) [-884.449] (-883.722) (-883.498) * [-883.581] (-884.687) (-884.636) (-883.915) -- 0:00:51
      282000 -- (-883.123) (-883.374) [-883.784] (-883.530) * (-883.645) (-884.563) [-885.350] (-884.530) -- 0:00:50
      282500 -- (-883.498) (-883.689) (-885.830) [-884.126] * (-885.140) (-884.222) (-886.696) [-884.063] -- 0:00:50
      283000 -- (-882.980) (-885.720) (-885.286) [-884.038] * (-883.281) (-883.400) (-884.194) [-886.532] -- 0:00:53
      283500 -- (-887.444) (-885.144) [-883.791] (-890.526) * (-884.273) (-884.020) (-887.649) [-883.359] -- 0:00:53
      284000 -- (-885.201) (-882.963) [-884.205] (-889.786) * (-883.952) [-885.481] (-885.118) (-883.049) -- 0:00:52
      284500 -- (-884.676) (-883.557) [-888.408] (-887.095) * (-884.725) [-883.849] (-886.189) (-885.979) -- 0:00:52
      285000 -- (-883.965) (-884.584) (-886.207) [-883.681] * (-890.230) [-883.323] (-885.897) (-884.731) -- 0:00:52

      Average standard deviation of split frequencies: 0.011104

      285500 -- (-885.038) (-887.696) (-886.178) [-886.964] * [-884.424] (-886.899) (-887.886) (-885.351) -- 0:00:52
      286000 -- (-885.666) (-883.561) (-884.833) [-885.564] * (-884.351) (-884.973) (-884.285) [-886.137] -- 0:00:52
      286500 -- (-888.599) [-885.050] (-885.673) (-888.135) * [-883.875] (-886.798) (-883.777) (-886.051) -- 0:00:52
      287000 -- (-884.665) (-885.782) (-886.494) [-884.222] * [-884.759] (-887.301) (-884.394) (-884.158) -- 0:00:52
      287500 -- [-884.960] (-888.466) (-883.520) (-884.739) * (-882.806) (-887.308) (-884.038) [-884.080] -- 0:00:52
      288000 -- (-883.731) [-885.989] (-887.832) (-885.316) * (-885.730) [-886.683] (-883.703) (-886.689) -- 0:00:51
      288500 -- (-883.691) [-886.407] (-887.102) (-884.321) * (-883.990) (-886.695) [-884.162] (-886.159) -- 0:00:51
      289000 -- [-883.714] (-886.480) (-886.011) (-887.111) * (-887.684) (-884.879) (-888.753) [-883.525] -- 0:00:51
      289500 -- (-886.276) [-883.844] (-886.671) (-888.466) * (-884.203) (-883.838) (-887.710) [-887.884] -- 0:00:51
      290000 -- (-884.941) [-884.413] (-882.841) (-890.864) * (-883.654) (-888.440) (-888.234) [-883.302] -- 0:00:51

      Average standard deviation of split frequencies: 0.011925

      290500 -- (-883.802) [-884.377] (-883.021) (-887.508) * (-884.805) [-883.089] (-884.590) (-884.075) -- 0:00:51
      291000 -- (-883.554) (-883.733) [-883.334] (-883.804) * (-884.804) (-885.779) (-885.752) [-885.233] -- 0:00:51
      291500 -- (-885.529) (-884.150) [-883.618] (-883.948) * (-884.588) [-884.944] (-889.229) (-885.562) -- 0:00:51
      292000 -- (-884.836) [-883.341] (-885.000) (-885.969) * (-883.945) (-884.014) [-884.944] (-890.586) -- 0:00:50
      292500 -- [-886.215] (-885.037) (-884.652) (-883.953) * [-885.976] (-890.309) (-890.269) (-883.716) -- 0:00:50
      293000 -- [-885.124] (-886.122) (-887.289) (-888.339) * (-885.018) (-885.839) [-889.992] (-882.996) -- 0:00:50
      293500 -- [-883.776] (-886.706) (-885.031) (-883.676) * (-883.482) (-885.916) (-883.124) [-884.103] -- 0:00:50
      294000 -- (-885.484) (-884.645) [-883.137] (-882.985) * (-882.798) (-887.591) [-884.676] (-884.064) -- 0:00:50
      294500 -- (-885.203) (-883.631) [-883.277] (-882.869) * (-883.190) (-883.047) [-885.219] (-891.016) -- 0:00:50
      295000 -- (-885.527) [-884.067] (-883.208) (-887.568) * (-885.112) [-883.098] (-883.908) (-885.499) -- 0:00:50

      Average standard deviation of split frequencies: 0.011898

      295500 -- (-884.177) (-883.637) (-886.389) [-883.796] * (-885.321) [-885.497] (-887.223) (-886.972) -- 0:00:50
      296000 -- [-883.891] (-882.789) (-882.742) (-883.631) * [-885.492] (-887.395) (-885.551) (-886.325) -- 0:00:52
      296500 -- (-886.522) (-884.477) (-884.419) [-887.549] * (-886.581) [-886.559] (-884.533) (-887.696) -- 0:00:52
      297000 -- [-887.221] (-883.295) (-887.160) (-883.916) * [-885.855] (-885.369) (-883.329) (-891.608) -- 0:00:52
      297500 -- (-887.115) (-886.963) [-886.419] (-883.534) * (-889.844) (-883.645) (-885.086) [-886.948] -- 0:00:51
      298000 -- (-885.136) [-885.033] (-882.806) (-886.208) * (-884.160) [-885.889] (-884.096) (-886.685) -- 0:00:51
      298500 -- (-884.492) (-883.239) [-884.562] (-884.075) * [-884.007] (-886.107) (-886.334) (-884.648) -- 0:00:51
      299000 -- (-886.762) [-884.766] (-890.096) (-887.664) * (-885.381) (-887.478) [-882.957] (-883.713) -- 0:00:51
      299500 -- (-887.120) (-886.372) [-887.187] (-887.365) * (-884.516) [-887.709] (-886.583) (-886.321) -- 0:00:51
      300000 -- (-887.687) [-883.988] (-885.203) (-884.272) * (-883.645) (-884.764) [-882.707] (-888.545) -- 0:00:51

      Average standard deviation of split frequencies: 0.010698

      300500 -- (-888.442) (-883.834) [-888.303] (-883.363) * (-884.411) (-884.474) (-883.156) [-885.985] -- 0:00:51
      301000 -- (-886.139) (-886.715) (-891.706) [-884.625] * (-885.489) [-883.268] (-885.085) (-885.061) -- 0:00:51
      301500 -- [-884.897] (-887.457) (-885.121) (-887.404) * (-887.084) (-885.974) [-885.807] (-885.290) -- 0:00:50
      302000 -- (-883.523) (-885.593) (-883.384) [-887.975] * [-886.137] (-885.583) (-885.480) (-884.126) -- 0:00:50
      302500 -- (-883.797) (-887.860) [-886.647] (-882.832) * [-884.709] (-884.492) (-887.349) (-886.829) -- 0:00:50
      303000 -- (-886.175) (-886.044) [-885.977] (-884.287) * (-885.735) (-886.395) (-887.341) [-882.897] -- 0:00:50
      303500 -- [-890.836] (-884.412) (-886.978) (-884.308) * (-886.433) [-886.689] (-884.786) (-884.091) -- 0:00:50
      304000 -- (-885.353) (-882.873) (-884.344) [-883.425] * (-885.439) (-885.942) (-883.342) [-883.759] -- 0:00:50
      304500 -- (-886.377) (-883.254) [-884.317] (-885.630) * (-885.495) (-885.937) (-886.459) [-884.357] -- 0:00:50
      305000 -- (-890.235) (-885.098) [-883.303] (-884.383) * (-884.023) [-886.476] (-883.898) (-885.469) -- 0:00:50

      Average standard deviation of split frequencies: 0.010099

      305500 -- (-884.391) (-884.813) [-885.937] (-884.474) * (-883.170) [-884.045] (-884.693) (-886.651) -- 0:00:50
      306000 -- [-884.445] (-884.270) (-887.411) (-884.222) * (-884.147) [-885.893] (-884.305) (-884.130) -- 0:00:49
      306500 -- [-885.084] (-887.502) (-887.760) (-886.616) * (-884.838) (-885.392) (-882.834) [-884.752] -- 0:00:49
      307000 -- (-885.168) [-887.577] (-888.390) (-891.281) * (-886.552) (-885.383) [-882.715] (-883.182) -- 0:00:49
      307500 -- (-884.513) [-883.768] (-884.659) (-885.820) * (-883.761) [-885.424] (-883.041) (-884.785) -- 0:00:49
      308000 -- [-888.649] (-885.356) (-884.395) (-884.327) * (-884.197) (-886.050) [-883.726] (-884.782) -- 0:00:49
      308500 -- (-883.272) (-884.524) [-885.292] (-883.563) * (-882.623) (-884.901) [-885.255] (-885.281) -- 0:00:49
      309000 -- (-883.670) (-887.578) [-882.880] (-885.794) * [-883.061] (-883.147) (-885.055) (-889.665) -- 0:00:49
      309500 -- [-884.629] (-886.611) (-884.228) (-884.503) * [-883.601] (-883.396) (-884.740) (-885.067) -- 0:00:49
      310000 -- (-884.095) (-885.634) (-891.764) [-888.298] * (-884.002) [-883.173] (-887.552) (-884.660) -- 0:00:51

      Average standard deviation of split frequencies: 0.010717

      310500 -- (-886.168) (-884.834) (-885.632) [-884.241] * (-883.091) (-885.436) [-885.619] (-885.031) -- 0:00:51
      311000 -- [-885.780] (-884.493) (-883.918) (-883.944) * (-886.848) (-883.375) (-882.951) [-887.864] -- 0:00:50
      311500 -- (-884.788) [-884.656] (-885.892) (-885.416) * [-886.727] (-885.034) (-882.833) (-884.793) -- 0:00:50
      312000 -- [-884.407] (-883.675) (-887.178) (-884.614) * (-885.025) (-886.026) [-884.323] (-884.147) -- 0:00:50
      312500 -- (-884.602) (-885.061) [-883.569] (-884.976) * [-884.943] (-887.416) (-883.355) (-886.356) -- 0:00:50
      313000 -- (-884.420) (-887.568) [-884.305] (-886.442) * (-884.300) (-889.189) [-886.272] (-884.324) -- 0:00:50
      313500 -- [-886.488] (-888.427) (-886.023) (-885.298) * [-883.221] (-887.819) (-890.243) (-884.602) -- 0:00:50
      314000 -- (-885.269) [-890.228] (-883.491) (-885.096) * [-885.720] (-888.287) (-883.232) (-885.260) -- 0:00:50
      314500 -- (-885.826) (-884.353) [-883.524] (-884.128) * (-883.596) (-885.290) (-883.654) [-884.773] -- 0:00:50
      315000 -- (-885.321) [-883.842] (-883.840) (-884.529) * [-885.171] (-884.480) (-884.603) (-886.651) -- 0:00:50

      Average standard deviation of split frequencies: 0.010070

      315500 -- [-887.295] (-883.376) (-885.054) (-887.277) * (-885.244) [-885.389] (-891.976) (-883.772) -- 0:00:49
      316000 -- (-885.880) (-887.518) [-882.985] (-885.226) * (-885.443) [-884.413] (-886.008) (-888.212) -- 0:00:49
      316500 -- (-886.980) (-884.051) [-883.396] (-887.006) * (-885.853) (-884.054) (-882.978) [-884.557] -- 0:00:49
      317000 -- [-884.769] (-883.500) (-884.174) (-884.765) * (-883.452) (-883.760) (-883.459) [-884.698] -- 0:00:49
      317500 -- (-887.656) (-886.299) (-883.906) [-883.432] * (-884.837) (-882.887) [-883.671] (-888.181) -- 0:00:49
      318000 -- (-886.345) (-884.219) [-884.570] (-883.253) * (-886.358) (-883.637) [-884.641] (-885.791) -- 0:00:49
      318500 -- (-883.652) [-890.872] (-884.167) (-883.647) * [-884.913] (-887.247) (-884.028) (-885.327) -- 0:00:49
      319000 -- (-885.557) [-883.969] (-885.940) (-884.429) * (-882.832) (-884.404) [-883.635] (-884.134) -- 0:00:49
      319500 -- (-887.122) (-883.698) (-885.297) [-884.133] * (-882.835) (-890.139) (-884.163) [-882.998] -- 0:00:48
      320000 -- (-888.025) (-882.954) [-882.674] (-884.537) * (-884.700) [-887.053] (-884.627) (-883.622) -- 0:00:48

      Average standard deviation of split frequencies: 0.009372

      320500 -- (-888.044) (-885.481) [-883.227] (-883.335) * [-884.264] (-884.821) (-883.129) (-886.737) -- 0:00:48
      321000 -- [-886.784] (-886.114) (-883.748) (-884.039) * (-884.097) [-883.322] (-885.979) (-890.109) -- 0:00:48
      321500 -- (-883.692) [-884.075] (-885.408) (-884.429) * (-885.816) [-885.257] (-885.510) (-886.022) -- 0:00:48
      322000 -- (-883.071) [-884.944] (-885.575) (-883.618) * (-887.110) [-884.990] (-886.323) (-884.199) -- 0:00:48
      322500 -- (-888.427) (-884.243) (-884.111) [-883.736] * (-885.057) (-885.268) [-885.768] (-888.778) -- 0:00:48
      323000 -- (-886.496) (-884.896) (-883.939) [-884.012] * [-884.632] (-883.744) (-884.302) (-885.785) -- 0:00:48
      323500 -- (-888.342) (-884.255) [-885.163] (-884.125) * (-886.810) (-883.753) (-885.629) [-885.142] -- 0:00:48
      324000 -- (-884.590) (-887.542) [-884.103] (-884.027) * (-884.607) (-884.085) (-884.686) [-883.978] -- 0:00:50
      324500 -- (-885.678) (-884.240) [-884.080] (-884.733) * (-883.170) [-887.283] (-889.137) (-885.718) -- 0:00:49
      325000 -- (-885.182) [-886.336] (-885.530) (-884.844) * (-885.005) (-884.141) [-886.875] (-883.504) -- 0:00:49

      Average standard deviation of split frequencies: 0.009580

      325500 -- (-887.335) (-886.080) [-883.674] (-883.827) * (-885.416) [-883.512] (-883.523) (-887.079) -- 0:00:49
      326000 -- (-887.477) (-885.854) (-885.205) [-885.765] * (-885.942) [-884.675] (-883.309) (-883.487) -- 0:00:49
      326500 -- (-884.718) (-884.902) [-884.524] (-883.807) * (-885.035) (-884.305) [-884.446] (-884.264) -- 0:00:49
      327000 -- (-887.771) [-884.643] (-885.257) (-885.480) * (-884.142) (-883.333) (-884.950) [-886.229] -- 0:00:49
      327500 -- [-885.022] (-884.110) (-890.973) (-885.083) * (-882.939) (-883.033) [-884.549] (-888.967) -- 0:00:49
      328000 -- [-888.861] (-883.095) (-885.065) (-885.013) * [-884.122] (-884.828) (-886.977) (-889.588) -- 0:00:49
      328500 -- (-884.547) (-883.560) [-885.004] (-885.245) * (-887.100) (-883.420) [-882.923] (-882.962) -- 0:00:49
      329000 -- (-883.645) [-889.176] (-883.605) (-883.947) * (-884.027) (-885.621) [-883.978] (-884.407) -- 0:00:48
      329500 -- (-883.870) (-890.093) (-884.824) [-885.140] * [-883.365] (-886.595) (-884.178) (-886.894) -- 0:00:48
      330000 -- (-886.437) [-884.679] (-884.770) (-884.705) * (-884.078) (-885.211) (-883.959) [-885.415] -- 0:00:48

      Average standard deviation of split frequencies: 0.009267

      330500 -- (-883.737) (-884.336) (-884.710) [-882.991] * (-886.178) (-886.919) [-884.525] (-886.852) -- 0:00:48
      331000 -- (-884.932) (-884.691) (-884.439) [-884.256] * (-883.878) (-884.713) (-883.451) [-888.323] -- 0:00:48
      331500 -- (-886.489) (-883.908) [-883.405] (-887.753) * [-884.594] (-884.568) (-887.314) (-885.931) -- 0:00:48
      332000 -- (-883.223) (-886.376) (-883.508) [-882.949] * (-883.510) [-886.530] (-885.597) (-885.139) -- 0:00:48
      332500 -- (-883.780) (-889.084) (-885.592) [-883.031] * (-885.209) [-884.342] (-889.724) (-885.677) -- 0:00:48
      333000 -- [-882.753] (-885.958) (-883.542) (-885.791) * (-889.885) (-885.770) [-887.484] (-886.381) -- 0:00:48
      333500 -- [-882.754] (-885.170) (-885.022) (-885.663) * (-885.326) (-883.618) (-884.246) [-885.224] -- 0:00:47
      334000 -- (-883.253) [-883.534] (-884.730) (-886.194) * (-886.099) (-886.886) [-882.877] (-883.289) -- 0:00:47
      334500 -- (-885.812) (-884.152) [-884.665] (-888.363) * (-884.083) (-884.240) [-883.111] (-884.432) -- 0:00:47
      335000 -- (-885.223) (-884.087) (-884.919) [-883.746] * (-884.857) [-883.396] (-885.229) (-886.130) -- 0:00:47

      Average standard deviation of split frequencies: 0.009821

      335500 -- [-885.624] (-884.310) (-885.314) (-883.841) * [-883.367] (-886.600) (-884.031) (-883.754) -- 0:00:47
      336000 -- (-884.797) [-886.311] (-883.095) (-886.386) * (-884.860) (-886.728) [-884.349] (-884.747) -- 0:00:47
      336500 -- (-888.751) (-892.219) [-883.546] (-892.025) * (-887.781) [-884.695] (-889.724) (-885.634) -- 0:00:47
      337000 -- (-888.815) (-883.938) [-884.575] (-888.883) * (-886.110) (-885.923) [-885.721] (-883.743) -- 0:00:47
      337500 -- (-885.157) (-886.191) (-886.143) [-886.443] * (-884.629) (-887.212) (-886.163) [-885.963] -- 0:00:47
      338000 -- (-883.929) [-885.388] (-886.718) (-886.529) * (-889.239) (-885.513) [-882.858] (-883.570) -- 0:00:48
      338500 -- [-883.256] (-884.771) (-888.498) (-885.107) * [-889.700] (-884.521) (-885.110) (-889.023) -- 0:00:48
      339000 -- (-884.551) (-884.780) (-889.409) [-884.974] * (-884.758) (-884.411) [-884.992] (-886.330) -- 0:00:48
      339500 -- (-885.523) (-888.895) [-885.070] (-885.694) * (-886.032) [-886.743] (-884.703) (-884.014) -- 0:00:48
      340000 -- (-887.766) [-889.416] (-885.762) (-884.126) * (-884.385) (-885.466) [-883.582] (-883.448) -- 0:00:48

      Average standard deviation of split frequencies: 0.010638

      340500 -- (-883.654) (-886.744) [-883.250] (-883.808) * [-888.963] (-885.197) (-883.442) (-888.358) -- 0:00:48
      341000 -- (-885.950) [-884.925] (-884.058) (-890.318) * (-887.879) (-885.497) (-887.626) [-885.993] -- 0:00:48
      341500 -- (-884.207) (-884.294) [-889.281] (-883.892) * [-888.217] (-883.883) (-884.253) (-886.589) -- 0:00:48
      342000 -- (-887.134) (-883.503) (-887.341) [-882.779] * (-885.622) [-883.603] (-890.340) (-884.006) -- 0:00:48
      342500 -- (-884.482) [-884.766] (-884.055) (-886.115) * (-884.530) [-883.984] (-885.456) (-886.051) -- 0:00:47
      343000 -- [-884.660] (-884.510) (-885.040) (-884.202) * [-884.524] (-885.247) (-883.973) (-883.958) -- 0:00:47
      343500 -- (-885.374) (-883.873) (-883.240) [-882.952] * (-883.575) (-882.925) [-884.612] (-884.153) -- 0:00:47
      344000 -- (-886.129) (-883.798) (-884.671) [-883.094] * (-884.392) [-883.824] (-885.273) (-884.869) -- 0:00:47
      344500 -- (-885.295) (-883.961) [-884.615] (-885.621) * (-883.383) (-884.178) (-883.321) [-886.736] -- 0:00:47
      345000 -- (-886.421) (-885.387) [-886.643] (-885.678) * (-886.145) [-884.374] (-883.544) (-885.140) -- 0:00:47

      Average standard deviation of split frequencies: 0.009452

      345500 -- [-884.375] (-884.440) (-886.474) (-885.611) * (-887.166) (-886.057) [-884.684] (-884.572) -- 0:00:47
      346000 -- [-884.960] (-889.583) (-884.353) (-885.882) * [-888.196] (-885.979) (-883.429) (-882.924) -- 0:00:47
      346500 -- [-885.268] (-884.878) (-884.640) (-887.020) * (-883.775) (-885.945) [-883.076] (-883.536) -- 0:00:47
      347000 -- (-883.046) (-884.077) [-883.301] (-883.898) * (-886.537) [-884.764] (-885.265) (-883.234) -- 0:00:47
      347500 -- (-885.001) (-883.368) [-883.746] (-889.646) * (-883.780) [-886.523] (-885.382) (-883.631) -- 0:00:46
      348000 -- (-890.482) (-884.091) (-883.600) [-882.669] * (-884.303) (-886.711) [-884.236] (-883.759) -- 0:00:46
      348500 -- (-887.503) (-884.513) (-885.025) [-884.492] * (-894.197) [-883.253] (-884.539) (-884.291) -- 0:00:46
      349000 -- (-886.014) [-885.563] (-884.628) (-886.061) * (-885.669) (-884.991) [-884.795] (-883.379) -- 0:00:46
      349500 -- (-885.243) [-884.991] (-883.548) (-884.981) * [-884.764] (-884.400) (-885.583) (-883.657) -- 0:00:46
      350000 -- (-886.674) (-884.987) [-884.054] (-887.641) * (-884.208) (-889.466) (-886.311) [-884.828] -- 0:00:46

      Average standard deviation of split frequencies: 0.009830

      350500 -- (-884.662) [-885.690] (-883.673) (-888.713) * (-885.269) (-888.971) (-885.526) [-884.785] -- 0:00:46
      351000 -- (-884.061) (-887.051) (-889.894) [-884.618] * (-890.506) (-886.563) [-883.767] (-890.383) -- 0:00:46
      351500 -- [-885.594] (-883.686) (-888.212) (-888.048) * (-888.541) (-885.841) [-884.793] (-889.850) -- 0:00:46
      352000 -- (-887.929) (-883.734) [-883.184] (-884.492) * (-886.080) (-885.983) [-883.936] (-884.266) -- 0:00:47
      352500 -- (-885.310) [-883.853] (-884.129) (-885.017) * (-884.316) (-882.925) [-885.446] (-883.409) -- 0:00:47
      353000 -- (-884.350) [-887.673] (-883.732) (-887.411) * (-886.722) [-884.276] (-884.406) (-883.780) -- 0:00:47
      353500 -- [-887.320] (-887.281) (-883.748) (-883.693) * (-885.174) (-888.578) [-883.444] (-894.607) -- 0:00:47
      354000 -- (-883.814) (-883.195) [-883.797] (-883.863) * (-890.275) (-885.694) (-885.338) [-883.472] -- 0:00:47
      354500 -- [-885.209] (-885.302) (-887.076) (-889.703) * (-883.804) (-884.429) (-884.587) [-883.205] -- 0:00:47
      355000 -- [-884.354] (-885.085) (-889.397) (-883.389) * (-886.568) (-886.063) [-884.415] (-885.501) -- 0:00:47

      Average standard deviation of split frequencies: 0.009931

      355500 -- (-883.320) (-885.209) [-886.160] (-883.279) * (-887.636) (-884.486) [-885.835] (-885.297) -- 0:00:47
      356000 -- (-886.923) (-887.364) (-884.226) [-884.455] * (-889.593) [-885.097] (-884.301) (-884.990) -- 0:00:47
      356500 -- (-885.545) (-885.343) (-885.587) [-883.361] * [-884.555] (-883.361) (-885.294) (-885.228) -- 0:00:46
      357000 -- (-885.670) [-889.537] (-885.323) (-885.361) * [-885.429] (-884.785) (-884.618) (-885.164) -- 0:00:46
      357500 -- (-886.862) (-885.296) [-885.811] (-886.883) * (-884.575) (-886.563) [-887.407] (-885.996) -- 0:00:46
      358000 -- [-884.772] (-884.942) (-885.606) (-885.656) * [-883.419] (-887.085) (-885.391) (-886.301) -- 0:00:46
      358500 -- (-885.842) [-888.858] (-884.795) (-885.056) * [-886.761] (-889.228) (-883.228) (-885.573) -- 0:00:46
      359000 -- (-886.999) (-884.667) (-884.389) [-885.070] * (-884.472) (-888.970) [-883.086] (-883.748) -- 0:00:46
      359500 -- (-883.267) [-883.669] (-885.447) (-884.427) * (-887.519) [-884.982] (-884.485) (-886.391) -- 0:00:46
      360000 -- (-885.723) (-884.461) (-887.143) [-885.478] * (-887.882) [-885.744] (-884.117) (-889.277) -- 0:00:46

      Average standard deviation of split frequencies: 0.008659

      360500 -- (-891.181) (-883.861) (-887.631) [-884.369] * (-885.159) (-883.648) (-884.921) [-883.849] -- 0:00:46
      361000 -- (-889.262) (-884.661) [-884.773] (-885.500) * (-884.712) (-884.706) [-884.813] (-883.883) -- 0:00:46
      361500 -- (-885.532) (-883.805) (-886.283) [-886.653] * (-885.422) (-884.646) [-883.687] (-886.645) -- 0:00:45
      362000 -- (-888.507) (-883.828) [-883.569] (-894.704) * [-890.310] (-883.725) (-883.488) (-884.135) -- 0:00:45
      362500 -- [-884.839] (-883.479) (-884.721) (-893.170) * [-883.020] (-883.246) (-886.421) (-884.164) -- 0:00:45
      363000 -- (-884.769) (-885.206) (-884.493) [-885.580] * (-883.433) [-885.506] (-885.143) (-884.158) -- 0:00:45
      363500 -- [-884.873] (-885.395) (-883.261) (-883.446) * [-883.034] (-883.273) (-887.964) (-886.268) -- 0:00:45
      364000 -- (-884.997) (-885.446) (-885.563) [-884.567] * (-885.682) (-885.148) (-886.466) [-883.942] -- 0:00:45
      364500 -- (-885.763) [-883.863] (-889.081) (-888.894) * (-883.534) (-885.795) [-883.961] (-884.198) -- 0:00:45
      365000 -- [-884.942] (-886.329) (-886.340) (-885.763) * (-883.444) (-884.084) [-882.963] (-885.194) -- 0:00:45

      Average standard deviation of split frequencies: 0.008050

      365500 -- [-883.352] (-884.650) (-887.300) (-886.471) * (-884.075) [-888.270] (-883.093) (-888.134) -- 0:00:46
      366000 -- (-883.982) (-884.971) [-884.647] (-885.707) * [-886.893] (-883.595) (-885.527) (-886.953) -- 0:00:46
      366500 -- [-882.934] (-884.988) (-888.632) (-888.760) * [-886.718] (-884.254) (-884.142) (-884.536) -- 0:00:46
      367000 -- (-889.218) (-886.168) (-887.425) [-892.890] * (-887.033) (-885.281) (-887.664) [-884.465] -- 0:00:46
      367500 -- (-887.358) (-885.941) [-886.005] (-888.668) * (-886.669) (-885.835) [-887.836] (-892.432) -- 0:00:46
      368000 -- (-886.333) (-884.152) [-886.223] (-884.622) * (-886.005) (-884.264) (-891.718) [-885.784] -- 0:00:46
      368500 -- [-884.190] (-886.020) (-889.177) (-885.302) * (-884.661) [-888.482] (-889.035) (-886.131) -- 0:00:46
      369000 -- (-883.816) (-887.197) [-884.634] (-883.235) * (-883.663) (-884.895) [-883.217] (-887.264) -- 0:00:46
      369500 -- [-884.061] (-886.444) (-886.254) (-884.402) * [-882.864] (-884.043) (-883.939) (-884.145) -- 0:00:46
      370000 -- (-884.964) (-893.086) (-884.561) [-887.235] * [-883.608] (-884.278) (-883.952) (-886.590) -- 0:00:45

      Average standard deviation of split frequencies: 0.008664

      370500 -- [-885.363] (-886.788) (-883.286) (-885.906) * (-884.414) (-884.118) [-884.509] (-885.711) -- 0:00:45
      371000 -- (-890.488) [-882.891] (-883.163) (-887.635) * (-889.580) [-884.006] (-889.081) (-885.736) -- 0:00:45
      371500 -- [-888.719] (-883.132) (-887.016) (-884.642) * (-888.563) [-885.707] (-888.183) (-886.328) -- 0:00:45
      372000 -- (-886.815) (-884.648) (-889.483) [-886.257] * (-887.673) (-888.101) (-883.398) [-889.046] -- 0:00:45
      372500 -- (-886.520) (-883.979) [-883.665] (-886.483) * [-885.045] (-885.406) (-883.633) (-884.104) -- 0:00:45
      373000 -- (-888.246) [-885.060] (-883.125) (-887.308) * (-885.170) (-884.790) [-884.163] (-885.692) -- 0:00:45
      373500 -- (-885.647) [-886.048] (-886.491) (-884.436) * (-889.769) [-883.782] (-886.314) (-885.131) -- 0:00:45
      374000 -- (-895.609) (-886.516) (-884.012) [-883.682] * (-885.217) [-883.537] (-884.779) (-889.968) -- 0:00:45
      374500 -- (-893.028) (-884.326) (-885.439) [-883.325] * [-885.604] (-890.722) (-888.699) (-888.155) -- 0:00:45
      375000 -- (-883.512) (-887.477) (-884.567) [-885.105] * (-883.374) (-890.419) (-886.803) [-886.384] -- 0:00:45

      Average standard deviation of split frequencies: 0.008384

      375500 -- [-883.213] (-884.764) (-884.834) (-888.383) * (-886.213) (-885.963) (-884.375) [-882.968] -- 0:00:44
      376000 -- [-883.101] (-886.191) (-884.032) (-890.430) * (-884.679) (-884.280) [-884.107] (-885.320) -- 0:00:44
      376500 -- [-883.979] (-888.970) (-882.675) (-884.363) * (-886.689) (-887.129) [-884.002] (-883.999) -- 0:00:44
      377000 -- (-884.387) (-886.721) (-884.006) [-886.775] * (-883.266) (-889.424) [-885.300] (-883.711) -- 0:00:44
      377500 -- (-884.833) [-885.493] (-885.906) (-884.902) * (-888.902) (-883.524) (-883.738) [-886.503] -- 0:00:44
      378000 -- (-886.623) (-884.318) [-883.796] (-886.329) * [-884.700] (-889.903) (-883.287) (-882.975) -- 0:00:44
      378500 -- (-889.315) (-885.638) [-883.918] (-886.618) * (-885.169) [-889.034] (-885.262) (-883.151) -- 0:00:44
      379000 -- [-883.966] (-885.058) (-883.732) (-887.001) * (-886.002) (-887.011) (-886.315) [-883.628] -- 0:00:45
      379500 -- (-885.334) [-883.342] (-884.744) (-886.414) * (-884.648) (-885.428) [-884.368] (-883.692) -- 0:00:45
      380000 -- (-884.424) (-883.767) (-884.557) [-884.029] * [-885.710] (-884.858) (-888.140) (-884.217) -- 0:00:45

      Average standard deviation of split frequencies: 0.008436

      380500 -- [-885.927] (-887.965) (-883.792) (-883.899) * [-884.677] (-883.706) (-884.379) (-885.823) -- 0:00:45
      381000 -- (-883.649) (-888.987) [-886.397] (-883.919) * (-883.319) [-883.983] (-885.687) (-886.934) -- 0:00:45
      381500 -- (-884.619) (-885.496) [-886.704] (-884.072) * (-884.034) (-883.348) (-885.673) [-887.723] -- 0:00:45
      382000 -- (-883.889) (-883.531) [-882.964] (-884.255) * (-885.372) (-885.865) [-883.794] (-886.585) -- 0:00:45
      382500 -- (-887.256) (-884.775) [-884.706] (-888.476) * (-890.138) (-889.896) [-883.836] (-882.905) -- 0:00:45
      383000 -- (-886.002) (-885.162) [-884.042] (-884.753) * [-886.956] (-884.387) (-884.334) (-886.187) -- 0:00:45
      383500 -- [-885.091] (-887.712) (-883.774) (-885.586) * [-884.940] (-885.752) (-886.700) (-889.274) -- 0:00:45
      384000 -- (-885.730) (-885.781) [-883.881] (-884.916) * (-884.640) [-885.680] (-885.298) (-888.446) -- 0:00:44
      384500 -- [-888.413] (-888.137) (-883.915) (-885.474) * (-887.649) (-887.034) (-887.315) [-884.652] -- 0:00:44
      385000 -- (-887.308) (-888.733) [-886.220] (-885.257) * (-886.379) (-887.246) (-885.343) [-884.379] -- 0:00:44

      Average standard deviation of split frequencies: 0.008014

      385500 -- (-885.579) [-886.376] (-888.506) (-887.044) * (-886.502) (-885.148) [-884.134] (-885.884) -- 0:00:44
      386000 -- (-885.035) (-884.783) [-886.350] (-888.897) * [-886.752] (-884.066) (-886.745) (-884.148) -- 0:00:44
      386500 -- (-887.086) (-884.783) (-886.822) [-887.759] * (-883.635) (-885.771) [-885.553] (-883.651) -- 0:00:44
      387000 -- (-882.982) (-887.450) (-885.453) [-884.686] * [-886.938] (-888.914) (-884.366) (-883.874) -- 0:00:44
      387500 -- [-884.429] (-884.180) (-884.316) (-889.088) * [-885.809] (-884.446) (-884.522) (-884.343) -- 0:00:44
      388000 -- (-887.102) [-885.067] (-883.685) (-884.146) * (-886.238) (-883.147) (-885.862) [-883.717] -- 0:00:44
      388500 -- (-884.103) [-884.735] (-885.664) (-884.086) * (-883.780) [-883.569] (-886.832) (-885.384) -- 0:00:44
      389000 -- [-883.527] (-893.725) (-887.102) (-883.195) * (-888.313) (-884.765) (-884.430) [-885.826] -- 0:00:43
      389500 -- [-883.630] (-890.201) (-887.244) (-885.295) * (-886.683) (-885.913) (-884.556) [-884.266] -- 0:00:43
      390000 -- (-886.259) [-885.016] (-884.141) (-886.764) * (-884.975) [-885.371] (-885.019) (-882.959) -- 0:00:43

      Average standard deviation of split frequencies: 0.008145

      390500 -- [-882.793] (-884.439) (-884.369) (-886.717) * [-883.342] (-885.764) (-885.862) (-883.618) -- 0:00:43
      391000 -- (-884.171) (-883.960) (-885.476) [-885.603] * [-883.480] (-886.809) (-886.586) (-884.512) -- 0:00:43
      391500 -- (-886.903) [-885.149] (-884.460) (-888.462) * [-883.188] (-891.871) (-887.794) (-885.959) -- 0:00:43
      392000 -- (-885.767) (-886.775) [-883.987] (-888.056) * (-884.453) (-885.226) [-883.652] (-883.609) -- 0:00:44
      392500 -- (-886.347) (-885.481) (-885.325) [-883.399] * (-884.538) (-890.372) (-884.955) [-883.965] -- 0:00:44
      393000 -- (-888.038) (-886.474) [-884.382] (-885.826) * (-887.067) (-886.520) [-888.797] (-883.554) -- 0:00:44
      393500 -- [-884.507] (-883.566) (-884.760) (-888.070) * [-885.515] (-883.977) (-887.253) (-883.762) -- 0:00:44
      394000 -- (-886.881) [-883.061] (-884.191) (-884.256) * (-884.355) [-883.301] (-887.733) (-884.061) -- 0:00:44
      394500 -- [-886.290] (-884.065) (-887.802) (-882.898) * (-887.134) (-883.939) (-886.396) [-885.817] -- 0:00:44
      395000 -- (-884.297) (-884.801) (-885.705) [-883.111] * (-885.387) (-884.861) (-884.704) [-885.964] -- 0:00:44

      Average standard deviation of split frequencies: 0.008035

      395500 -- (-884.306) (-886.380) [-886.788] (-883.503) * (-884.666) [-884.517] (-886.537) (-886.802) -- 0:00:44
      396000 -- (-885.021) (-886.767) [-883.695] (-886.446) * (-883.791) (-884.239) (-885.494) [-889.274] -- 0:00:44
      396500 -- [-885.174] (-885.453) (-885.691) (-887.751) * (-882.800) [-883.454] (-885.455) (-885.434) -- 0:00:44
      397000 -- (-884.407) (-886.716) (-885.726) [-885.159] * (-884.408) (-884.235) (-885.983) [-885.935] -- 0:00:44
      397500 -- (-885.840) [-884.225] (-887.701) (-886.109) * (-885.129) [-884.452] (-883.813) (-883.355) -- 0:00:43
      398000 -- (-886.592) [-882.793] (-883.672) (-883.868) * (-888.166) (-883.477) [-883.820] (-885.173) -- 0:00:43
      398500 -- (-887.199) [-883.250] (-883.727) (-885.277) * [-884.528] (-885.146) (-884.915) (-885.708) -- 0:00:43
      399000 -- (-887.860) [-883.016] (-885.161) (-884.337) * (-883.853) [-886.115] (-886.279) (-884.432) -- 0:00:43
      399500 -- (-884.940) (-883.767) (-884.421) [-883.057] * (-886.041) (-886.380) [-883.769] (-885.301) -- 0:00:43
      400000 -- (-884.820) (-886.850) (-884.787) [-886.180] * (-885.698) (-885.397) (-886.124) [-882.971] -- 0:00:43

      Average standard deviation of split frequencies: 0.008530

      400500 -- (-885.152) (-886.654) (-886.343) [-886.847] * (-885.275) (-884.561) [-883.423] (-886.608) -- 0:00:43
      401000 -- (-883.420) [-884.306] (-886.265) (-891.529) * [-886.962] (-887.586) (-885.941) (-884.882) -- 0:00:43
      401500 -- [-885.002] (-887.965) (-885.631) (-888.203) * (-884.852) [-887.753] (-884.952) (-886.292) -- 0:00:43
      402000 -- (-883.904) [-887.190] (-885.641) (-889.037) * (-886.437) (-885.696) [-882.802] (-885.964) -- 0:00:43
      402500 -- [-884.498] (-886.326) (-883.957) (-886.169) * (-886.446) [-886.147] (-884.292) (-885.595) -- 0:00:43
      403000 -- [-884.314] (-885.706) (-883.460) (-891.805) * (-883.929) (-889.794) (-883.813) [-886.156] -- 0:00:42
      403500 -- (-886.321) (-885.218) [-884.028] (-887.620) * [-884.542] (-885.083) (-888.067) (-883.735) -- 0:00:42
      404000 -- (-886.643) [-885.914] (-886.109) (-885.179) * [-885.528] (-887.347) (-890.209) (-884.680) -- 0:00:42
      404500 -- [-886.177] (-883.182) (-885.012) (-884.951) * [-883.523] (-884.645) (-884.435) (-887.563) -- 0:00:42
      405000 -- (-885.141) (-885.704) (-885.993) [-883.596] * (-885.537) [-889.437] (-886.097) (-885.395) -- 0:00:42

      Average standard deviation of split frequencies: 0.008055

      405500 -- (-885.771) (-887.198) (-892.171) [-883.217] * (-884.110) [-885.470] (-887.368) (-887.639) -- 0:00:42
      406000 -- [-883.798] (-886.358) (-890.361) (-884.151) * [-887.421] (-884.946) (-887.447) (-883.950) -- 0:00:43
      406500 -- (-886.330) (-885.345) (-886.534) [-883.516] * (-888.132) (-884.033) (-889.103) [-884.906] -- 0:00:43
      407000 -- (-886.649) (-886.096) [-883.064] (-885.429) * [-886.417] (-885.665) (-885.949) (-884.116) -- 0:00:43
      407500 -- (-884.450) (-889.059) (-883.027) [-884.976] * [-884.707] (-888.856) (-884.522) (-884.262) -- 0:00:43
      408000 -- (-889.976) (-887.865) (-884.157) [-884.726] * [-883.361] (-883.606) (-887.543) (-883.841) -- 0:00:43
      408500 -- (-889.516) [-885.564] (-884.190) (-884.516) * [-883.285] (-884.681) (-885.664) (-883.138) -- 0:00:43
      409000 -- (-889.930) [-885.852] (-884.846) (-884.642) * [-887.775] (-886.990) (-884.072) (-888.106) -- 0:00:43
      409500 -- (-887.100) (-884.820) (-885.894) [-884.058] * [-885.257] (-884.027) (-884.028) (-886.796) -- 0:00:43
      410000 -- [-886.828] (-884.166) (-885.038) (-884.958) * (-883.246) (-885.480) (-886.835) [-883.268] -- 0:00:43

      Average standard deviation of split frequencies: 0.007246

      410500 -- [-888.908] (-886.251) (-884.991) (-884.993) * (-886.990) (-885.765) (-885.763) [-883.251] -- 0:00:43
      411000 -- [-886.060] (-888.045) (-883.288) (-887.069) * (-884.677) (-887.034) (-883.422) [-883.221] -- 0:00:42
      411500 -- [-886.458] (-884.369) (-883.359) (-884.538) * [-884.640] (-885.273) (-884.306) (-884.334) -- 0:00:42
      412000 -- (-883.885) [-888.494] (-883.359) (-884.110) * (-883.828) (-886.845) (-885.008) [-885.029] -- 0:00:42
      412500 -- [-885.334] (-884.209) (-887.687) (-884.589) * (-883.426) (-891.837) [-886.350] (-889.308) -- 0:00:42
      413000 -- (-885.300) (-886.807) [-889.390] (-887.179) * (-885.231) (-888.442) (-884.399) [-885.100] -- 0:00:42
      413500 -- (-885.642) (-885.939) [-888.997] (-887.195) * (-883.905) [-884.767] (-883.486) (-886.368) -- 0:00:42
      414000 -- (-883.525) [-884.772] (-886.777) (-885.012) * (-884.864) (-883.916) [-882.982] (-884.016) -- 0:00:42
      414500 -- (-883.258) [-883.113] (-885.247) (-884.099) * (-884.981) (-883.635) [-884.999] (-886.550) -- 0:00:42
      415000 -- (-885.677) (-884.835) [-882.652] (-886.518) * (-891.912) (-884.094) [-884.332] (-885.896) -- 0:00:42

      Average standard deviation of split frequencies: 0.007437

      415500 -- (-888.138) (-883.452) (-887.285) [-885.452] * [-883.964] (-886.987) (-888.500) (-885.634) -- 0:00:42
      416000 -- [-884.055] (-885.339) (-884.212) (-884.150) * (-883.476) [-884.870] (-887.097) (-885.065) -- 0:00:42
      416500 -- (-885.159) (-885.745) (-885.946) [-885.272] * [-888.505] (-885.530) (-885.888) (-888.010) -- 0:00:42
      417000 -- (-886.784) (-885.098) [-887.222] (-885.450) * (-883.676) [-886.265] (-885.255) (-883.917) -- 0:00:41
      417500 -- (-885.939) (-886.934) (-886.278) [-884.694] * (-884.167) (-887.150) [-889.024] (-885.678) -- 0:00:41
      418000 -- (-885.283) (-883.539) (-884.319) [-884.082] * (-883.999) [-883.873] (-887.765) (-883.385) -- 0:00:41
      418500 -- (-887.343) [-884.904] (-883.680) (-884.420) * (-885.220) (-886.439) [-885.085] (-885.334) -- 0:00:41
      419000 -- (-883.007) (-883.774) (-887.943) [-884.199] * [-884.095] (-886.978) (-889.734) (-885.294) -- 0:00:41
      419500 -- [-886.472] (-889.771) (-887.114) (-886.874) * (-882.888) [-883.932] (-887.359) (-886.043) -- 0:00:42
      420000 -- (-883.700) [-888.173] (-886.665) (-888.426) * (-883.739) (-883.222) [-885.013] (-883.193) -- 0:00:42

      Average standard deviation of split frequencies: 0.008124

      420500 -- (-886.992) (-886.721) [-885.377] (-886.013) * (-884.592) (-884.658) [-886.408] (-883.479) -- 0:00:42
      421000 -- (-883.747) (-888.396) [-889.376] (-885.368) * (-885.576) (-885.594) [-884.168] (-885.339) -- 0:00:42
      421500 -- (-885.339) [-887.803] (-885.660) (-887.649) * (-886.432) [-883.757] (-888.321) (-884.247) -- 0:00:42
      422000 -- (-884.220) (-885.308) (-890.246) [-885.365] * (-887.067) [-885.448] (-883.911) (-886.137) -- 0:00:42
      422500 -- [-886.529] (-885.693) (-888.882) (-883.452) * (-889.966) (-884.852) (-886.918) [-883.591] -- 0:00:42
      423000 -- (-884.409) (-882.755) [-883.790] (-884.651) * (-887.697) (-883.146) [-886.849] (-884.952) -- 0:00:42
      423500 -- [-887.149] (-884.765) (-884.005) (-886.045) * (-883.445) (-883.770) (-888.411) [-883.924] -- 0:00:42
      424000 -- (-883.212) (-889.755) [-883.807] (-883.935) * [-882.865] (-889.231) (-884.589) (-884.881) -- 0:00:42
      424500 -- (-890.637) (-886.573) [-885.583] (-884.447) * [-886.121] (-888.184) (-884.093) (-886.498) -- 0:00:42
      425000 -- (-889.985) [-883.878] (-885.558) (-886.355) * [-884.740] (-885.583) (-882.909) (-883.431) -- 0:00:41

      Average standard deviation of split frequencies: 0.006778

      425500 -- (-885.781) (-884.540) (-885.044) [-883.318] * (-883.148) (-884.388) [-885.396] (-884.538) -- 0:00:41
      426000 -- (-887.494) (-888.605) (-888.939) [-883.832] * (-883.873) (-886.057) (-884.447) [-884.684] -- 0:00:41
      426500 -- [-883.894] (-886.887) (-886.245) (-885.166) * (-883.612) (-884.531) (-884.479) [-884.836] -- 0:00:41
      427000 -- (-884.318) (-887.125) [-885.606] (-885.006) * (-885.460) [-886.197] (-884.793) (-882.992) -- 0:00:41
      427500 -- (-884.820) (-886.157) [-883.897] (-885.706) * (-885.293) (-885.839) (-883.171) [-884.521] -- 0:00:41
      428000 -- [-884.381] (-888.726) (-883.893) (-883.950) * (-884.935) [-885.007] (-883.708) (-884.273) -- 0:00:41
      428500 -- (-883.972) [-886.712] (-883.686) (-884.274) * (-886.326) (-884.301) (-885.304) [-883.972] -- 0:00:41
      429000 -- (-884.068) (-887.847) [-882.993] (-885.754) * (-884.458) (-885.182) (-888.428) [-883.129] -- 0:00:41
      429500 -- [-885.489] (-885.723) (-883.356) (-883.513) * [-883.327] (-885.301) (-884.000) (-885.735) -- 0:00:41
      430000 -- (-888.771) [-886.906] (-889.162) (-884.648) * (-887.778) [-886.152] (-884.761) (-883.964) -- 0:00:41

      Average standard deviation of split frequencies: 0.007252

      430500 -- (-883.034) [-885.102] (-884.090) (-887.203) * (-889.576) [-884.720] (-890.280) (-884.117) -- 0:00:41
      431000 -- (-883.959) (-884.917) [-885.607] (-885.809) * (-883.545) [-884.577] (-885.509) (-883.622) -- 0:00:40
      431500 -- [-885.842] (-883.959) (-883.943) (-884.901) * [-885.711] (-883.455) (-883.612) (-883.364) -- 0:00:40
      432000 -- [-886.089] (-885.633) (-884.500) (-883.787) * (-887.129) [-884.441] (-883.363) (-883.192) -- 0:00:40
      432500 -- (-885.823) (-883.753) [-886.641] (-884.058) * (-886.885) (-884.427) (-887.430) [-887.216] -- 0:00:40
      433000 -- (-883.689) (-884.131) [-884.174] (-885.780) * (-886.404) [-885.062] (-888.504) (-886.286) -- 0:00:40
      433500 -- [-886.183] (-885.256) (-884.922) (-884.588) * (-885.082) [-885.371] (-885.195) (-885.679) -- 0:00:41
      434000 -- [-884.390] (-884.992) (-884.000) (-891.160) * (-890.811) (-887.384) [-883.984] (-886.313) -- 0:00:41
      434500 -- (-883.616) (-887.245) [-884.190] (-886.286) * [-885.775] (-886.871) (-883.902) (-886.559) -- 0:00:41
      435000 -- [-884.186] (-883.618) (-884.686) (-887.787) * (-884.675) (-885.349) (-887.544) [-883.914] -- 0:00:41

      Average standard deviation of split frequencies: 0.007298

      435500 -- (-885.447) (-883.621) [-884.526] (-883.925) * (-885.403) (-883.672) [-885.629] (-888.415) -- 0:00:41
      436000 -- (-887.710) [-887.046] (-884.369) (-887.871) * (-887.558) (-890.543) [-888.167] (-883.247) -- 0:00:41
      436500 -- (-885.860) [-883.466] (-883.776) (-887.343) * (-883.510) (-886.849) [-888.219] (-884.955) -- 0:00:41
      437000 -- (-888.859) (-886.156) (-883.747) [-887.552] * [-883.107] (-885.321) (-884.682) (-884.981) -- 0:00:41
      437500 -- (-884.970) (-886.912) (-883.834) [-886.970] * (-883.476) [-886.767] (-885.510) (-885.809) -- 0:00:41
      438000 -- (-886.497) (-883.286) [-884.417] (-884.869) * [-884.076] (-887.198) (-885.147) (-893.734) -- 0:00:41
      438500 -- (-886.926) (-884.289) (-887.031) [-883.822] * (-883.676) (-893.697) [-886.653] (-885.388) -- 0:00:40
      439000 -- [-885.470] (-886.892) (-885.206) (-887.134) * [-884.081] (-886.064) (-884.179) (-888.080) -- 0:00:40
      439500 -- (-885.861) (-883.925) [-885.773] (-890.896) * [-884.844] (-883.900) (-885.178) (-884.284) -- 0:00:40
      440000 -- (-886.632) (-885.376) (-886.460) [-886.059] * [-884.564] (-884.810) (-887.012) (-887.491) -- 0:00:40

      Average standard deviation of split frequencies: 0.007154

      440500 -- (-885.775) (-886.739) (-887.360) [-886.125] * (-883.689) [-885.806] (-888.666) (-885.600) -- 0:00:40
      441000 -- [-886.882] (-888.362) (-886.418) (-885.810) * [-883.818] (-885.081) (-883.095) (-883.299) -- 0:00:40
      441500 -- (-886.471) (-885.914) (-884.496) [-883.855] * (-887.281) [-887.137] (-884.852) (-886.950) -- 0:00:40
      442000 -- (-886.893) (-884.808) [-883.329] (-886.595) * [-883.938] (-884.297) (-885.112) (-883.398) -- 0:00:40
      442500 -- [-886.061] (-884.777) (-883.733) (-885.295) * (-883.422) (-884.661) [-885.385] (-882.892) -- 0:00:40
      443000 -- (-883.584) (-887.174) (-883.586) [-883.737] * (-884.195) (-887.277) (-886.168) [-882.840] -- 0:00:40
      443500 -- (-884.574) (-883.320) (-885.608) [-885.043] * [-882.928] (-887.117) (-883.348) (-882.930) -- 0:00:40
      444000 -- (-886.539) (-885.608) (-885.649) [-884.676] * [-882.759] (-884.970) (-885.878) (-884.291) -- 0:00:40
      444500 -- (-884.409) (-884.152) [-885.001] (-885.116) * [-884.978] (-885.674) (-883.585) (-885.479) -- 0:00:39
      445000 -- (-884.141) (-883.145) [-885.700] (-885.056) * (-885.466) (-885.675) (-888.389) [-882.672] -- 0:00:39

      Average standard deviation of split frequencies: 0.007993

      445500 -- (-888.572) (-884.667) (-891.078) [-887.790] * (-885.059) [-883.983] (-885.595) (-884.062) -- 0:00:39
      446000 -- (-885.491) (-890.362) [-883.860] (-885.695) * (-886.491) (-884.713) [-883.391] (-886.534) -- 0:00:39
      446500 -- (-883.180) (-885.684) [-886.820] (-884.292) * (-890.529) (-885.110) (-884.500) [-884.269] -- 0:00:39
      447000 -- [-883.987] (-885.089) (-888.730) (-884.663) * (-884.530) (-883.017) [-887.438] (-882.951) -- 0:00:39
      447500 -- [-884.354] (-884.540) (-883.006) (-883.867) * (-884.829) (-883.525) [-884.373] (-885.646) -- 0:00:40
      448000 -- (-883.659) [-889.147] (-884.460) (-884.286) * (-886.555) [-884.705] (-884.551) (-887.610) -- 0:00:40
      448500 -- (-885.899) (-887.322) (-883.910) [-883.851] * [-883.055] (-884.070) (-884.452) (-885.435) -- 0:00:40
      449000 -- (-884.329) [-883.715] (-883.958) (-884.494) * [-884.395] (-885.056) (-884.944) (-886.165) -- 0:00:40
      449500 -- (-884.067) (-883.633) [-884.035] (-884.007) * (-883.340) [-883.480] (-886.778) (-884.018) -- 0:00:40
      450000 -- (-885.628) [-883.710] (-883.460) (-883.935) * (-885.664) (-885.507) (-887.113) [-884.261] -- 0:00:40

      Average standard deviation of split frequencies: 0.007910

      450500 -- (-886.490) (-886.544) [-883.250] (-883.895) * [-885.797] (-883.729) (-890.729) (-886.361) -- 0:00:40
      451000 -- (-884.114) [-887.810] (-883.856) (-883.808) * (-885.764) (-883.673) (-886.761) [-887.955] -- 0:00:40
      451500 -- (-884.102) [-885.255] (-883.600) (-884.495) * [-887.069] (-883.505) (-890.671) (-885.773) -- 0:00:40
      452000 -- (-886.658) (-885.853) [-883.944] (-884.058) * (-885.428) (-883.469) (-885.943) [-885.107] -- 0:00:40
      452500 -- [-887.361] (-882.706) (-887.373) (-884.081) * (-885.254) [-887.002] (-884.267) (-884.660) -- 0:00:39
      453000 -- (-887.869) (-883.206) [-883.803] (-887.446) * (-891.070) (-885.943) [-882.862] (-886.287) -- 0:00:39
      453500 -- (-887.075) [-884.465] (-884.449) (-883.167) * (-886.928) [-887.625] (-883.706) (-885.415) -- 0:00:39
      454000 -- [-887.200] (-884.292) (-884.809) (-883.484) * [-885.171] (-885.088) (-883.667) (-886.774) -- 0:00:39
      454500 -- (-891.690) (-886.074) [-891.785] (-884.445) * (-884.217) (-883.921) [-883.636] (-888.613) -- 0:00:39
      455000 -- (-887.701) (-888.649) (-885.981) [-885.211] * (-885.239) [-883.496] (-883.934) (-884.675) -- 0:00:39

      Average standard deviation of split frequencies: 0.008206

      455500 -- (-885.644) (-885.012) (-883.818) [-890.989] * [-888.249] (-887.108) (-883.230) (-883.562) -- 0:00:39
      456000 -- (-883.961) (-886.913) [-885.314] (-885.630) * (-889.479) (-886.446) [-883.611] (-884.066) -- 0:00:39
      456500 -- (-887.081) (-883.870) (-884.844) [-886.047] * (-885.743) [-887.186] (-885.344) (-885.245) -- 0:00:39
      457000 -- (-884.541) (-883.397) [-883.289] (-884.182) * (-886.565) (-888.432) [-884.088] (-888.728) -- 0:00:39
      457500 -- [-884.302] (-883.552) (-884.868) (-884.145) * [-885.403] (-885.715) (-886.856) (-887.985) -- 0:00:39
      458000 -- (-884.557) [-887.950] (-887.580) (-884.666) * (-883.701) [-883.888] (-886.132) (-886.623) -- 0:00:39
      458500 -- (-887.072) (-883.574) [-883.960] (-884.893) * (-887.775) (-885.174) [-885.447] (-883.856) -- 0:00:38
      459000 -- (-886.884) (-883.167) [-886.117] (-884.159) * (-884.039) [-883.483] (-887.138) (-883.245) -- 0:00:38
      459500 -- (-885.909) [-885.268] (-884.655) (-884.697) * (-884.891) (-885.143) (-883.103) [-883.232] -- 0:00:38
      460000 -- [-890.203] (-883.605) (-887.188) (-885.552) * (-884.693) (-886.490) [-889.156] (-885.124) -- 0:00:38

      Average standard deviation of split frequencies: 0.008186

      460500 -- (-883.769) [-883.835] (-884.935) (-889.970) * (-884.266) [-885.053] (-884.445) (-883.329) -- 0:00:38
      461000 -- [-884.230] (-885.822) (-890.430) (-886.045) * (-884.478) (-888.522) [-884.482] (-883.646) -- 0:00:38
      461500 -- [-885.666] (-883.840) (-884.773) (-884.743) * (-887.044) (-884.726) [-883.603] (-888.520) -- 0:00:39
      462000 -- (-884.282) (-885.332) (-886.847) [-884.872] * (-883.721) [-883.932] (-886.040) (-884.272) -- 0:00:39
      462500 -- (-883.387) (-885.217) (-883.752) [-884.390] * (-883.902) (-884.879) (-884.631) [-884.230] -- 0:00:39
      463000 -- (-883.270) [-885.396] (-884.464) (-883.472) * (-883.839) [-885.925] (-884.195) (-883.236) -- 0:00:39
      463500 -- [-884.112] (-885.722) (-888.921) (-883.884) * (-884.628) (-883.484) [-885.662] (-882.866) -- 0:00:39
      464000 -- (-883.231) (-883.334) (-885.416) [-883.478] * (-886.061) (-885.610) (-889.254) [-883.965] -- 0:00:39
      464500 -- [-883.476] (-883.423) (-884.662) (-883.210) * (-883.812) (-886.137) (-884.923) [-884.245] -- 0:00:39
      465000 -- [-883.851] (-884.027) (-883.989) (-884.050) * (-886.185) (-892.849) (-883.700) [-883.737] -- 0:00:39

      Average standard deviation of split frequencies: 0.008219

      465500 -- (-884.493) [-885.842] (-883.688) (-884.823) * (-884.110) (-883.790) (-883.705) [-884.786] -- 0:00:39
      466000 -- (-884.940) (-886.028) [-883.803] (-885.158) * (-886.454) (-882.791) [-883.706] (-884.797) -- 0:00:38
      466500 -- (-884.860) (-883.045) [-885.262] (-883.273) * (-888.037) (-884.165) (-885.359) [-885.438] -- 0:00:38
      467000 -- (-884.926) (-883.621) [-884.255] (-884.414) * [-885.802] (-883.783) (-887.260) (-890.904) -- 0:00:38
      467500 -- (-886.165) [-883.542] (-885.824) (-884.058) * (-884.319) [-886.500] (-883.674) (-884.995) -- 0:00:38
      468000 -- (-885.608) (-885.318) (-884.660) [-885.146] * (-885.343) [-884.053] (-885.788) (-884.341) -- 0:00:38
      468500 -- (-883.292) (-883.900) [-884.048] (-886.709) * (-887.087) (-886.842) (-887.392) [-883.494] -- 0:00:38
      469000 -- [-883.763] (-884.396) (-883.723) (-884.239) * (-884.854) (-891.364) [-885.670] (-886.449) -- 0:00:38
      469500 -- (-883.647) [-885.324] (-882.966) (-885.286) * (-884.511) [-885.765] (-884.679) (-887.705) -- 0:00:38
      470000 -- (-886.730) [-886.106] (-884.132) (-885.303) * (-886.530) (-886.243) [-884.699] (-883.302) -- 0:00:38

      Average standard deviation of split frequencies: 0.007387

      470500 -- (-891.923) (-883.212) [-882.664] (-883.587) * (-885.417) (-883.501) [-887.979] (-883.241) -- 0:00:38
      471000 -- (-886.212) (-883.872) [-883.010] (-885.189) * (-884.322) (-885.498) [-889.293] (-885.905) -- 0:00:38
      471500 -- (-885.484) [-883.747] (-883.292) (-886.529) * (-884.014) (-886.544) (-889.961) [-886.296] -- 0:00:38
      472000 -- [-884.867] (-891.063) (-886.591) (-885.595) * (-883.126) [-886.853] (-888.526) (-885.597) -- 0:00:38
      472500 -- (-887.579) (-884.532) (-885.036) [-884.675] * (-882.933) [-883.078] (-885.664) (-883.930) -- 0:00:37
      473000 -- (-883.613) (-885.381) [-887.873] (-884.520) * (-882.810) [-882.833] (-884.103) (-885.164) -- 0:00:37
      473500 -- (-885.071) [-883.136] (-888.184) (-884.257) * (-884.525) (-885.334) [-886.012] (-883.153) -- 0:00:37
      474000 -- (-885.358) [-883.373] (-887.905) (-884.772) * (-886.666) (-884.082) [-887.142] (-884.233) -- 0:00:37
      474500 -- (-885.707) (-886.412) (-884.485) [-884.337] * [-884.475] (-886.476) (-883.459) (-883.101) -- 0:00:37
      475000 -- (-885.392) (-887.714) (-888.731) [-888.211] * (-883.269) [-885.535] (-883.813) (-884.815) -- 0:00:37

      Average standard deviation of split frequencies: 0.007489

      475500 -- (-885.385) (-891.038) [-884.920] (-885.372) * (-885.974) (-884.396) [-890.105] (-884.701) -- 0:00:38
      476000 -- (-884.935) (-886.440) (-887.041) [-886.353] * (-886.002) [-884.018] (-885.232) (-883.664) -- 0:00:38
      476500 -- (-883.614) (-886.649) [-886.739] (-887.085) * (-883.817) [-886.375] (-885.403) (-883.350) -- 0:00:38
      477000 -- [-883.645] (-886.122) (-883.448) (-886.097) * [-883.141] (-887.682) (-885.462) (-883.130) -- 0:00:38
      477500 -- [-884.755] (-884.336) (-886.639) (-883.801) * (-884.849) (-890.021) [-883.673] (-884.034) -- 0:00:38
      478000 -- (-883.314) [-883.628] (-884.579) (-883.448) * (-884.387) (-885.652) (-883.911) [-884.095] -- 0:00:38
      478500 -- (-888.475) (-883.555) (-886.359) [-883.630] * (-885.057) (-887.337) [-882.969] (-883.508) -- 0:00:38
      479000 -- [-883.843] (-883.579) (-885.891) (-884.531) * (-885.409) (-884.401) (-892.391) [-885.283] -- 0:00:38
      479500 -- (-886.607) (-884.133) [-883.970] (-885.449) * (-887.149) [-884.373] (-889.767) (-885.413) -- 0:00:37
      480000 -- [-884.751] (-886.596) (-885.905) (-884.983) * (-884.167) (-885.297) [-890.542] (-883.206) -- 0:00:37

      Average standard deviation of split frequencies: 0.007049

      480500 -- [-886.029] (-885.316) (-883.688) (-885.498) * [-884.306] (-885.092) (-884.324) (-883.372) -- 0:00:37
      481000 -- [-884.300] (-884.764) (-885.938) (-884.965) * (-883.818) (-885.299) (-883.692) [-886.001] -- 0:00:37
      481500 -- (-887.045) [-885.979] (-883.651) (-883.927) * (-882.937) (-883.743) (-887.089) [-884.213] -- 0:00:37
      482000 -- [-884.127] (-884.784) (-884.968) (-884.548) * [-884.340] (-883.628) (-885.262) (-890.758) -- 0:00:37
      482500 -- [-883.722] (-884.857) (-885.369) (-884.946) * [-884.629] (-884.353) (-888.848) (-889.612) -- 0:00:37
      483000 -- (-883.715) (-883.097) [-888.858] (-885.816) * [-884.485] (-883.693) (-888.713) (-888.020) -- 0:00:37
      483500 -- (-887.678) (-883.879) (-884.504) [-886.831] * (-884.264) (-885.178) [-888.352] (-887.306) -- 0:00:37
      484000 -- (-884.602) (-888.843) [-887.039] (-885.862) * [-885.707] (-884.833) (-886.902) (-884.106) -- 0:00:37
      484500 -- [-883.101] (-888.497) (-886.856) (-888.098) * [-884.263] (-883.628) (-884.870) (-885.560) -- 0:00:37
      485000 -- (-883.404) (-886.593) [-888.300] (-886.374) * [-885.374] (-885.705) (-883.342) (-884.171) -- 0:00:37

      Average standard deviation of split frequencies: 0.006608

      485500 -- [-883.890] (-890.085) (-886.779) (-885.366) * (-888.956) [-885.011] (-886.082) (-886.149) -- 0:00:37
      486000 -- (-884.137) [-885.530] (-887.390) (-886.161) * (-883.632) (-884.694) (-883.358) [-885.023] -- 0:00:37
      486500 -- [-884.193] (-886.952) (-886.225) (-883.649) * [-882.791] (-882.835) (-885.169) (-884.157) -- 0:00:36
      487000 -- (-885.480) [-884.247] (-883.375) (-883.805) * (-883.040) (-884.905) [-886.424] (-886.854) -- 0:00:36
      487500 -- [-885.938] (-887.903) (-882.935) (-883.607) * (-885.944) [-883.285] (-890.857) (-884.107) -- 0:00:36
      488000 -- [-884.182] (-885.769) (-885.543) (-885.543) * [-883.705] (-884.175) (-884.449) (-885.399) -- 0:00:36
      488500 -- [-884.962] (-886.332) (-889.604) (-887.396) * (-882.942) (-889.660) (-883.821) [-885.454] -- 0:00:37
      489000 -- (-884.569) [-886.276] (-888.113) (-886.802) * [-885.189] (-886.015) (-885.215) (-883.645) -- 0:00:37
      489500 -- (-883.181) (-887.092) (-887.160) [-889.837] * (-883.497) (-884.941) (-886.799) [-884.321] -- 0:00:37
      490000 -- (-886.159) [-883.979] (-885.592) (-883.670) * [-884.514] (-884.243) (-883.622) (-882.629) -- 0:00:37

      Average standard deviation of split frequencies: 0.006605

      490500 -- (-883.294) [-885.340] (-883.444) (-887.591) * (-885.139) (-882.730) [-884.704] (-882.628) -- 0:00:37
      491000 -- (-884.433) [-884.565] (-883.448) (-884.743) * (-886.905) (-887.624) [-883.614] (-883.524) -- 0:00:37
      491500 -- (-885.697) [-884.628] (-883.480) (-887.688) * (-888.064) (-885.379) (-886.672) [-884.496] -- 0:00:37
      492000 -- (-887.484) [-883.047] (-883.403) (-883.772) * [-883.085] (-884.101) (-885.003) (-886.400) -- 0:00:37
      492500 -- (-884.777) [-884.304] (-884.248) (-884.991) * [-884.407] (-884.101) (-886.190) (-889.225) -- 0:00:37
      493000 -- [-882.856] (-886.822) (-885.501) (-887.382) * [-883.175] (-884.440) (-883.970) (-883.234) -- 0:00:37
      493500 -- (-884.254) (-885.621) [-885.236] (-886.921) * [-884.384] (-883.790) (-884.844) (-885.068) -- 0:00:36
      494000 -- (-884.103) (-884.070) [-883.350] (-886.518) * (-883.365) (-887.334) (-889.572) [-884.275] -- 0:00:36
      494500 -- (-885.310) [-887.286] (-884.969) (-884.838) * (-887.340) [-884.144] (-885.923) (-887.668) -- 0:00:36
      495000 -- (-886.551) (-883.814) [-885.699] (-885.883) * [-884.193] (-884.426) (-884.963) (-887.552) -- 0:00:36

      Average standard deviation of split frequencies: 0.006118

      495500 -- [-885.289] (-882.951) (-883.707) (-884.687) * (-884.376) (-884.904) (-883.520) [-884.724] -- 0:00:36
      496000 -- (-885.969) (-885.754) (-884.578) [-887.543] * (-883.686) [-885.303] (-884.501) (-887.848) -- 0:00:36
      496500 -- (-885.528) (-885.230) (-883.338) [-884.487] * [-883.572] (-886.008) (-883.994) (-886.214) -- 0:00:36
      497000 -- (-883.343) (-883.677) [-884.107] (-885.648) * (-885.181) (-883.450) [-885.364] (-887.225) -- 0:00:36
      497500 -- (-883.365) (-884.611) [-884.392] (-883.649) * (-883.264) [-884.678] (-884.399) (-888.166) -- 0:00:36
      498000 -- (-883.264) [-888.294] (-882.655) (-883.371) * (-888.304) (-885.623) [-884.690] (-885.843) -- 0:00:36
      498500 -- (-886.187) [-889.218] (-883.982) (-883.992) * (-886.301) (-887.564) [-884.429] (-887.039) -- 0:00:36
      499000 -- (-887.994) [-884.160] (-884.961) (-884.362) * [-886.073] (-886.245) (-884.110) (-884.495) -- 0:00:36
      499500 -- (-886.796) (-883.469) [-882.817] (-885.347) * (-884.044) (-885.857) (-885.083) [-884.854] -- 0:00:36
      500000 -- (-885.061) (-885.234) [-884.747] (-884.790) * [-884.361] (-885.590) (-884.805) (-883.414) -- 0:00:36

      Average standard deviation of split frequencies: 0.006179

      500500 -- [-884.793] (-885.719) (-884.873) (-883.271) * (-887.317) (-883.905) (-883.256) [-883.250] -- 0:00:35
      501000 -- (-886.439) (-884.109) [-886.509] (-885.809) * (-886.699) (-884.772) (-883.278) [-883.895] -- 0:00:35
      501500 -- [-883.985] (-884.789) (-884.726) (-885.648) * (-883.668) [-884.780] (-884.188) (-885.613) -- 0:00:35
      502000 -- [-884.402] (-884.354) (-884.301) (-884.900) * [-884.173] (-883.816) (-883.929) (-886.685) -- 0:00:35
      502500 -- (-884.922) (-887.217) [-886.767] (-884.853) * [-883.851] (-884.906) (-889.030) (-888.132) -- 0:00:36
      503000 -- (-889.592) [-883.817] (-883.962) (-885.390) * (-888.994) [-885.896] (-883.885) (-886.778) -- 0:00:36
      503500 -- (-886.731) (-883.299) (-885.241) [-884.220] * [-886.573] (-884.324) (-886.228) (-887.691) -- 0:00:36
      504000 -- (-883.700) [-884.247] (-885.131) (-887.314) * (-883.235) (-884.178) (-883.584) [-885.732] -- 0:00:36
      504500 -- (-883.131) [-886.187] (-883.277) (-889.115) * [-883.343] (-885.090) (-884.410) (-884.619) -- 0:00:36
      505000 -- (-884.121) (-883.139) [-882.895] (-886.207) * (-884.301) [-886.171] (-884.339) (-887.469) -- 0:00:36

      Average standard deviation of split frequencies: 0.005939

      505500 -- (-886.079) [-883.757] (-884.556) (-885.999) * (-886.011) (-885.422) [-890.058] (-885.812) -- 0:00:36
      506000 -- [-884.241] (-885.171) (-884.471) (-892.151) * (-891.990) (-885.236) (-885.343) [-883.066] -- 0:00:36
      506500 -- [-883.761] (-884.932) (-886.693) (-884.978) * (-885.480) (-886.646) [-885.740] (-884.630) -- 0:00:36
      507000 -- (-887.104) [-885.524] (-884.679) (-883.609) * (-887.518) [-886.616] (-887.699) (-883.813) -- 0:00:35
      507500 -- (-887.198) (-884.450) (-888.117) [-887.824] * (-890.018) [-884.541] (-885.214) (-885.311) -- 0:00:35
      508000 -- [-884.724] (-884.781) (-889.693) (-885.248) * [-886.640] (-889.541) (-885.178) (-886.295) -- 0:00:35
      508500 -- [-887.050] (-883.730) (-887.552) (-883.504) * (-885.916) (-886.240) (-888.056) [-884.065] -- 0:00:35
      509000 -- (-885.697) (-883.730) (-888.664) [-886.306] * (-886.986) (-890.108) (-886.554) [-882.903] -- 0:00:35
      509500 -- (-887.084) (-884.946) (-884.393) [-884.611] * (-885.563) (-884.354) (-884.427) [-883.913] -- 0:00:35
      510000 -- (-888.046) [-886.136] (-886.096) (-889.303) * (-883.911) (-883.109) [-883.362] (-884.955) -- 0:00:35

      Average standard deviation of split frequencies: 0.006577

      510500 -- (-890.983) (-885.486) (-884.042) [-885.452] * (-883.947) (-888.168) (-887.341) [-886.806] -- 0:00:35
      511000 -- (-886.484) (-887.646) [-883.498] (-886.158) * (-885.156) (-883.349) [-885.886] (-885.919) -- 0:00:35
      511500 -- (-883.107) (-884.018) [-882.940] (-884.717) * (-888.669) (-885.557) (-884.766) [-883.604] -- 0:00:35
      512000 -- (-883.600) [-886.147] (-885.752) (-883.423) * (-883.893) (-884.597) (-884.360) [-884.929] -- 0:00:35
      512500 -- (-883.640) (-884.348) (-887.747) [-884.138] * (-886.660) (-884.573) (-884.581) [-884.623] -- 0:00:35
      513000 -- (-884.589) (-886.552) [-886.328] (-882.848) * [-888.231] (-893.442) (-888.638) (-884.551) -- 0:00:35
      513500 -- (-888.019) (-887.601) (-884.260) [-891.927] * [-886.208] (-885.846) (-884.148) (-884.027) -- 0:00:35
      514000 -- [-883.537] (-888.954) (-886.547) (-893.882) * (-887.022) (-889.448) (-884.748) [-883.495] -- 0:00:34
      514500 -- [-885.346] (-885.942) (-884.027) (-892.708) * [-884.105] (-888.067) (-884.089) (-884.574) -- 0:00:34
      515000 -- (-883.747) (-885.324) (-887.132) [-885.261] * (-882.946) (-885.890) (-885.479) [-884.730] -- 0:00:34

      Average standard deviation of split frequencies: 0.006338

      515500 -- (-886.416) (-884.869) [-883.360] (-887.824) * (-886.412) (-888.536) (-887.149) [-884.187] -- 0:00:34
      516000 -- (-883.508) (-886.133) [-884.804] (-884.925) * (-884.120) [-883.072] (-890.660) (-892.675) -- 0:00:35
      516500 -- (-885.146) (-882.833) (-885.063) [-884.457] * (-884.063) (-886.386) [-886.083] (-886.450) -- 0:00:35
      517000 -- [-885.391] (-884.536) (-884.680) (-884.421) * [-886.720] (-883.729) (-884.072) (-887.396) -- 0:00:35
      517500 -- (-886.293) [-882.879] (-885.214) (-888.841) * (-883.994) [-885.514] (-883.513) (-884.155) -- 0:00:35
      518000 -- [-884.102] (-883.666) (-889.889) (-887.373) * (-887.001) [-884.595] (-884.148) (-883.397) -- 0:00:35
      518500 -- [-884.458] (-883.437) (-889.342) (-887.285) * (-886.169) (-885.331) (-883.443) [-884.086] -- 0:00:35
      519000 -- (-884.421) (-886.701) [-886.905] (-885.954) * (-890.101) (-884.683) [-883.366] (-884.901) -- 0:00:35
      519500 -- (-885.290) [-886.257] (-883.096) (-883.731) * (-888.659) (-887.225) (-884.773) [-885.668] -- 0:00:35
      520000 -- (-883.063) (-885.697) (-883.971) [-887.280] * (-886.699) [-887.202] (-884.912) (-889.141) -- 0:00:35

      Average standard deviation of split frequencies: 0.006281

      520500 -- (-883.203) (-882.981) [-883.167] (-883.561) * (-885.276) (-884.981) [-884.313] (-883.104) -- 0:00:35
      521000 -- (-885.164) [-886.476] (-883.621) (-883.591) * (-887.920) [-884.516] (-887.340) (-882.742) -- 0:00:34
      521500 -- (-884.524) [-884.303] (-885.325) (-883.075) * [-883.923] (-887.304) (-885.766) (-883.827) -- 0:00:34
      522000 -- (-891.528) (-885.655) (-884.402) [-884.245] * (-884.187) [-883.570] (-885.671) (-883.665) -- 0:00:34
      522500 -- (-888.692) (-886.659) (-889.123) [-884.368] * [-885.485] (-883.797) (-887.790) (-884.005) -- 0:00:34
      523000 -- [-884.688] (-884.773) (-894.543) (-882.758) * [-885.302] (-884.585) (-884.750) (-890.436) -- 0:00:34
      523500 -- (-884.188) (-884.426) (-886.857) [-887.670] * (-884.038) [-883.375] (-882.868) (-890.942) -- 0:00:34
      524000 -- (-885.954) (-883.827) [-886.208] (-884.439) * (-885.163) [-884.050] (-883.802) (-885.599) -- 0:00:34
      524500 -- (-886.322) (-884.285) (-885.926) [-885.139] * [-886.535] (-883.630) (-883.999) (-887.142) -- 0:00:34
      525000 -- (-885.795) [-886.503] (-883.913) (-888.860) * [-884.413] (-884.442) (-886.761) (-884.007) -- 0:00:34

      Average standard deviation of split frequencies: 0.005209

      525500 -- (-886.039) [-883.651] (-884.949) (-883.905) * (-885.743) (-889.256) [-886.841] (-884.093) -- 0:00:34
      526000 -- (-884.311) (-883.384) (-886.425) [-885.573] * (-887.258) (-888.898) [-887.241] (-882.975) -- 0:00:34
      526500 -- (-888.326) (-884.518) [-885.028] (-888.970) * (-887.535) (-884.578) [-885.688] (-883.360) -- 0:00:34
      527000 -- (-889.293) (-884.894) [-885.758] (-885.042) * (-886.788) (-885.668) [-886.168] (-888.840) -- 0:00:34
      527500 -- (-888.352) (-886.730) (-888.675) [-885.662] * (-885.906) (-889.527) (-883.987) [-884.668] -- 0:00:34
      528000 -- (-883.432) (-886.646) (-885.921) [-884.580] * [-887.625] (-887.611) (-885.755) (-883.773) -- 0:00:33
      528500 -- (-883.993) (-891.642) (-885.801) [-884.631] * (-886.385) [-888.304] (-885.792) (-886.914) -- 0:00:33
      529000 -- (-882.853) [-890.746] (-885.868) (-885.540) * (-890.795) [-883.388] (-883.483) (-887.814) -- 0:00:33
      529500 -- (-882.929) (-887.877) [-885.483] (-884.722) * (-892.121) [-883.575] (-884.328) (-888.999) -- 0:00:34
      530000 -- [-883.972] (-885.497) (-885.457) (-883.783) * (-885.081) [-883.941] (-883.779) (-884.801) -- 0:00:34

      Average standard deviation of split frequencies: 0.005274

      530500 -- (-883.476) (-887.705) (-884.435) [-885.118] * (-885.023) (-883.779) [-883.511] (-885.082) -- 0:00:34
      531000 -- (-887.061) [-883.956] (-886.286) (-887.410) * [-883.952] (-883.264) (-885.008) (-887.259) -- 0:00:34
      531500 -- (-886.067) [-886.633] (-887.577) (-885.214) * (-885.739) (-886.874) (-884.961) [-887.502] -- 0:00:34
      532000 -- (-884.069) (-887.340) (-886.642) [-886.171] * [-883.909] (-886.919) (-886.432) (-885.755) -- 0:00:34
      532500 -- [-886.215] (-885.982) (-886.276) (-883.358) * (-883.656) (-884.846) (-889.031) [-883.544] -- 0:00:34
      533000 -- [-883.267] (-887.691) (-884.154) (-885.665) * (-883.142) (-883.913) (-886.596) [-885.777] -- 0:00:34
      533500 -- (-887.220) (-893.889) [-886.554] (-891.841) * (-883.142) [-883.643] (-888.069) (-883.669) -- 0:00:34
      534000 -- (-886.811) (-886.016) (-884.782) [-886.591] * [-884.617] (-883.505) (-885.321) (-888.895) -- 0:00:34
      534500 -- (-884.464) (-886.081) [-885.511] (-887.572) * (-884.007) (-883.766) [-885.103] (-888.036) -- 0:00:33
      535000 -- (-883.887) [-886.098] (-888.917) (-887.135) * (-883.086) [-883.550] (-882.890) (-883.029) -- 0:00:33

      Average standard deviation of split frequencies: 0.005662

      535500 -- (-883.769) (-892.503) (-883.506) [-884.548] * (-883.086) [-882.881] (-883.572) (-884.252) -- 0:00:33
      536000 -- (-884.843) (-888.359) (-888.430) [-883.629] * (-882.899) [-885.044] (-884.111) (-885.207) -- 0:00:33
      536500 -- (-887.761) (-886.263) (-883.786) [-886.153] * [-885.209] (-883.543) (-887.542) (-883.483) -- 0:00:33
      537000 -- (-883.807) (-885.217) [-886.834] (-883.059) * (-884.742) [-884.025] (-884.173) (-886.248) -- 0:00:33
      537500 -- (-884.612) [-884.638] (-884.286) (-886.315) * (-884.078) (-885.780) (-884.552) [-888.604] -- 0:00:33
      538000 -- (-885.088) (-883.466) (-883.848) [-884.727] * (-885.748) [-890.513] (-884.663) (-889.195) -- 0:00:33
      538500 -- (-885.832) (-883.855) [-887.237] (-888.530) * (-883.474) (-888.639) [-888.546] (-885.287) -- 0:00:33
      539000 -- (-888.454) [-883.352] (-883.717) (-885.371) * (-884.907) [-885.038] (-886.989) (-885.529) -- 0:00:33
      539500 -- (-883.708) (-883.995) [-884.122] (-884.081) * (-884.371) (-883.338) [-887.449] (-887.003) -- 0:00:33
      540000 -- (-885.665) (-885.895) (-886.016) [-883.863] * [-884.463] (-885.218) (-884.641) (-884.625) -- 0:00:33

      Average standard deviation of split frequencies: 0.005449

      540500 -- (-884.515) (-884.848) (-887.660) [-885.729] * [-890.219] (-886.607) (-886.771) (-885.615) -- 0:00:33
      541000 -- (-885.145) [-885.670] (-884.749) (-885.370) * (-890.354) (-887.640) (-883.626) [-883.376] -- 0:00:33
      541500 -- (-883.721) [-885.458] (-885.188) (-883.848) * (-889.434) (-886.798) (-883.637) [-883.354] -- 0:00:33
      542000 -- (-886.610) (-886.463) [-885.127] (-884.931) * (-885.858) (-886.290) [-883.255] (-884.705) -- 0:00:32
      542500 -- (-886.611) [-883.779] (-882.964) (-886.441) * (-885.845) [-886.995] (-886.248) (-884.604) -- 0:00:32
      543000 -- [-883.913] (-886.068) (-884.701) (-887.652) * (-885.880) (-885.890) [-884.496] (-886.819) -- 0:00:33
      543500 -- (-884.443) (-884.770) [-885.811] (-888.920) * (-884.998) (-886.018) [-886.843] (-885.469) -- 0:00:33
      544000 -- [-885.508] (-886.655) (-884.217) (-883.775) * [-886.889] (-885.494) (-890.011) (-885.459) -- 0:00:33
      544500 -- (-887.460) (-888.210) [-883.855] (-885.464) * [-884.822] (-883.687) (-886.777) (-883.409) -- 0:00:33
      545000 -- [-886.561] (-885.643) (-887.532) (-885.731) * (-883.574) [-887.420] (-884.656) (-885.444) -- 0:00:33

      Average standard deviation of split frequencies: 0.006098

      545500 -- (-886.977) (-884.539) (-885.755) [-883.922] * (-884.413) (-885.324) (-883.257) [-883.458] -- 0:00:33
      546000 -- (-883.128) [-884.943] (-885.704) (-885.052) * (-886.024) [-883.460] (-885.723) (-890.835) -- 0:00:33
      546500 -- (-883.566) (-884.297) [-885.371] (-883.069) * (-883.592) (-883.392) [-884.297] (-885.199) -- 0:00:33
      547000 -- (-887.876) (-883.174) (-884.280) [-883.298] * [-884.447] (-883.572) (-884.808) (-884.317) -- 0:00:33
      547500 -- (-885.381) [-885.286] (-883.758) (-887.838) * [-885.835] (-883.961) (-886.757) (-887.044) -- 0:00:33
      548000 -- (-883.760) [-885.343] (-884.036) (-888.959) * (-883.777) [-884.687] (-887.281) (-883.977) -- 0:00:32
      548500 -- (-882.672) (-886.647) (-885.642) [-882.968] * (-883.907) [-885.595] (-886.011) (-886.206) -- 0:00:32
      549000 -- (-883.774) [-883.067] (-885.080) (-885.871) * (-884.289) (-884.919) [-884.842] (-885.946) -- 0:00:32
      549500 -- [-882.763] (-886.548) (-884.323) (-887.132) * [-883.924] (-884.402) (-884.399) (-887.868) -- 0:00:32
      550000 -- [-884.715] (-884.786) (-884.393) (-885.399) * (-888.928) [-883.911] (-885.649) (-888.759) -- 0:00:32

      Average standard deviation of split frequencies: 0.006260

      550500 -- (-883.463) [-885.329] (-885.055) (-886.623) * [-887.751] (-884.034) (-887.886) (-887.287) -- 0:00:32
      551000 -- [-885.967] (-883.987) (-888.036) (-885.378) * (-885.931) (-883.140) [-885.818] (-883.455) -- 0:00:32
      551500 -- (-889.383) (-882.854) (-886.427) [-885.155] * (-891.429) [-884.942] (-886.027) (-883.958) -- 0:00:32
      552000 -- [-886.243] (-884.894) (-884.416) (-884.857) * (-885.222) (-884.456) [-883.621] (-886.433) -- 0:00:32
      552500 -- [-885.176] (-887.806) (-883.604) (-884.950) * (-883.283) (-885.533) [-886.766] (-885.315) -- 0:00:32
      553000 -- (-884.989) (-882.836) [-885.223] (-884.134) * [-888.418] (-885.609) (-890.042) (-885.260) -- 0:00:32
      553500 -- (-884.832) (-883.135) (-887.044) [-883.612] * (-889.076) (-888.378) [-883.962] (-885.258) -- 0:00:32
      554000 -- (-884.322) [-884.076] (-882.980) (-886.188) * (-886.909) (-883.062) [-884.153] (-886.523) -- 0:00:32
      554500 -- (-884.415) [-886.690] (-882.736) (-893.639) * (-887.263) (-883.372) (-884.270) [-883.581] -- 0:00:32
      555000 -- (-885.614) (-886.260) [-883.747] (-894.889) * (-885.973) (-882.893) [-884.918] (-887.540) -- 0:00:32

      Average standard deviation of split frequencies: 0.006253

      555500 -- (-887.116) [-884.674] (-885.080) (-886.416) * (-886.513) (-888.638) (-884.611) [-885.771] -- 0:00:32
      556000 -- (-886.522) [-884.597] (-884.572) (-887.551) * (-885.546) (-887.590) [-884.192] (-884.380) -- 0:00:32
      556500 -- [-884.733] (-882.880) (-884.271) (-888.348) * (-883.269) (-885.354) [-884.951] (-885.028) -- 0:00:32
      557000 -- (-884.954) (-883.538) (-883.007) [-884.847] * (-883.599) (-886.438) [-883.005] (-890.874) -- 0:00:32
      557500 -- (-885.010) (-883.382) [-883.705] (-884.956) * (-885.900) (-882.945) (-885.177) [-883.686] -- 0:00:32
      558000 -- (-886.843) [-884.817] (-883.197) (-883.601) * (-885.701) (-882.854) (-883.232) [-884.834] -- 0:00:32
      558500 -- [-884.055] (-885.692) (-883.213) (-887.757) * (-885.999) (-885.619) (-885.468) [-884.780] -- 0:00:32
      559000 -- (-885.938) [-882.866] (-888.990) (-886.693) * (-883.343) (-884.671) (-885.719) [-886.015] -- 0:00:32
      559500 -- (-885.182) [-883.163] (-886.121) (-885.464) * [-884.914] (-883.143) (-889.067) (-887.136) -- 0:00:32
      560000 -- (-885.126) (-889.628) (-886.573) [-884.373] * (-883.435) (-885.201) [-884.611] (-885.221) -- 0:00:32

      Average standard deviation of split frequencies: 0.005829

      560500 -- (-883.121) (-883.708) (-883.194) [-883.505] * [-883.795] (-885.352) (-885.490) (-884.767) -- 0:00:32
      561000 -- [-885.504] (-890.899) (-883.762) (-886.452) * (-884.313) [-883.002] (-883.698) (-887.031) -- 0:00:32
      561500 -- (-884.812) (-885.727) [-886.439] (-885.983) * (-884.278) [-884.247] (-883.050) (-884.474) -- 0:00:32
      562000 -- (-885.190) [-883.983] (-888.217) (-883.969) * (-883.962) [-885.745] (-888.436) (-885.419) -- 0:00:31
      562500 -- (-887.976) (-883.761) [-885.801] (-890.315) * [-885.982] (-886.890) (-884.486) (-885.759) -- 0:00:31
      563000 -- (-886.713) [-887.433] (-889.219) (-885.745) * (-889.632) (-885.523) [-883.664] (-884.254) -- 0:00:31
      563500 -- (-887.908) [-887.076] (-885.275) (-886.345) * (-883.986) (-885.838) (-885.561) [-883.634] -- 0:00:31
      564000 -- (-885.221) (-886.767) [-883.772] (-885.103) * (-886.932) (-886.036) [-884.133] (-884.544) -- 0:00:31
      564500 -- [-884.916] (-885.558) (-887.055) (-883.619) * [-885.145] (-886.253) (-884.587) (-887.251) -- 0:00:31
      565000 -- (-884.586) (-885.318) (-884.589) [-884.893] * (-885.216) (-883.185) (-885.647) [-884.317] -- 0:00:31

      Average standard deviation of split frequencies: 0.006715

      565500 -- (-884.162) [-888.775] (-885.594) (-883.894) * [-883.303] (-882.976) (-884.597) (-884.101) -- 0:00:31
      566000 -- (-889.784) (-883.373) [-883.264] (-888.585) * (-887.290) (-885.981) [-883.103] (-883.482) -- 0:00:31
      566500 -- (-885.822) (-885.027) [-886.119] (-888.877) * (-882.959) (-883.557) (-886.712) [-885.091] -- 0:00:31
      567000 -- (-884.215) (-884.465) (-887.313) [-885.131] * [-883.791] (-883.557) (-885.743) (-885.165) -- 0:00:31
      567500 -- (-885.599) (-884.067) [-883.660] (-884.431) * (-883.227) [-884.893] (-887.093) (-884.359) -- 0:00:31
      568000 -- (-883.241) (-888.232) [-884.705] (-890.313) * (-882.714) (-883.249) (-884.539) [-882.776] -- 0:00:31
      568500 -- [-883.064] (-891.357) (-887.204) (-888.652) * (-884.742) (-888.569) (-885.755) [-885.495] -- 0:00:31
      569000 -- (-885.735) (-886.777) [-887.332] (-887.241) * [-884.391] (-885.748) (-883.257) (-886.911) -- 0:00:31
      569500 -- (-885.641) [-885.601] (-883.481) (-885.908) * (-886.048) (-886.698) [-883.227] (-884.837) -- 0:00:31
      570000 -- (-887.765) [-886.436] (-883.134) (-884.963) * (-886.500) (-885.463) [-883.521] (-884.035) -- 0:00:31

      Average standard deviation of split frequencies: 0.006058

      570500 -- (-883.271) (-887.933) (-885.351) [-883.121] * (-884.107) [-890.292] (-884.020) (-886.502) -- 0:00:31
      571000 -- (-883.873) [-885.950] (-883.385) (-887.112) * [-884.983] (-884.153) (-883.487) (-883.559) -- 0:00:31
      571500 -- (-885.917) (-886.012) [-883.372] (-883.877) * [-885.700] (-883.648) (-885.800) (-885.130) -- 0:00:31
      572000 -- (-888.825) [-884.094] (-885.317) (-885.938) * (-886.210) [-884.739] (-885.292) (-885.529) -- 0:00:31
      572500 -- (-890.671) (-889.140) (-884.115) [-885.816] * (-887.815) (-885.637) [-885.413] (-885.793) -- 0:00:31
      573000 -- (-885.377) (-888.913) (-884.320) [-883.296] * (-883.993) (-886.026) [-886.525] (-886.215) -- 0:00:31
      573500 -- (-883.095) (-887.809) (-885.786) [-884.797] * (-883.524) [-884.366] (-883.698) (-887.171) -- 0:00:31
      574000 -- (-885.123) (-889.482) [-885.954] (-883.357) * (-883.246) (-886.604) (-884.069) [-885.662] -- 0:00:31
      574500 -- [-883.758] (-886.851) (-883.955) (-883.128) * [-885.722] (-884.462) (-886.553) (-885.973) -- 0:00:31
      575000 -- (-885.716) [-886.383] (-887.196) (-885.770) * (-884.026) (-884.158) (-885.151) [-885.067] -- 0:00:31

      Average standard deviation of split frequencies: 0.005838

      575500 -- (-885.144) [-884.831] (-884.484) (-885.441) * (-889.092) [-883.696] (-885.091) (-886.222) -- 0:00:30
      576000 -- [-884.322] (-885.646) (-885.537) (-886.810) * (-885.936) (-883.772) (-884.932) [-886.305] -- 0:00:30
      576500 -- (-884.870) (-885.309) (-884.058) [-884.404] * [-885.719] (-885.018) (-886.652) (-888.227) -- 0:00:30
      577000 -- (-885.028) [-883.909] (-884.070) (-883.735) * (-888.324) (-885.888) (-885.368) [-885.703] -- 0:00:30
      577500 -- (-886.575) [-885.036] (-890.596) (-889.521) * (-885.333) [-883.800] (-891.341) (-887.125) -- 0:00:30
      578000 -- (-883.776) [-884.651] (-884.301) (-889.157) * [-884.913] (-882.833) (-886.467) (-886.703) -- 0:00:30
      578500 -- (-883.123) [-891.660] (-884.173) (-886.471) * (-883.732) (-883.531) (-884.123) [-887.440] -- 0:00:30
      579000 -- [-886.009] (-885.080) (-887.462) (-885.461) * (-884.387) (-883.325) (-885.002) [-883.892] -- 0:00:30
      579500 -- [-883.962] (-885.085) (-886.404) (-884.403) * (-884.998) [-884.360] (-886.481) (-886.053) -- 0:00:30
      580000 -- (-883.833) [-884.099] (-886.042) (-884.859) * (-883.658) (-885.824) [-886.264] (-887.500) -- 0:00:30

      Average standard deviation of split frequencies: 0.006116

      580500 -- [-887.714] (-887.592) (-883.659) (-886.130) * (-884.091) (-883.366) (-885.034) [-883.540] -- 0:00:30
      581000 -- [-884.092] (-884.773) (-884.265) (-887.252) * [-883.705] (-883.730) (-884.598) (-883.097) -- 0:00:30
      581500 -- (-883.633) [-885.260] (-885.197) (-886.016) * (-883.841) (-885.792) [-884.159] (-886.778) -- 0:00:30
      582000 -- (-883.787) (-886.024) [-884.718] (-885.361) * (-884.262) (-885.930) (-885.538) [-885.942] -- 0:00:30
      582500 -- (-884.294) [-885.170] (-886.904) (-887.137) * (-887.906) (-886.509) (-887.624) [-882.840] -- 0:00:30
      583000 -- (-885.027) [-883.951] (-884.696) (-888.192) * (-885.679) [-885.640] (-887.747) (-883.332) -- 0:00:30
      583500 -- (-882.999) [-884.403] (-884.697) (-885.941) * (-885.258) (-884.980) (-886.075) [-885.203] -- 0:00:30
      584000 -- (-884.169) (-885.991) [-884.863] (-885.633) * [-883.236] (-885.500) (-885.071) (-883.908) -- 0:00:30
      584500 -- (-887.298) [-884.221] (-885.960) (-885.271) * [-883.856] (-886.177) (-883.850) (-883.761) -- 0:00:30
      585000 -- [-883.761] (-884.230) (-883.074) (-885.346) * [-887.500] (-885.623) (-883.974) (-886.265) -- 0:00:30

      Average standard deviation of split frequencies: 0.006737

      585500 -- (-885.387) (-885.168) (-887.539) [-884.675] * (-887.382) (-885.741) [-885.191] (-883.643) -- 0:00:30
      586000 -- (-886.595) [-887.154] (-885.296) (-885.752) * [-884.029] (-887.199) (-887.612) (-883.525) -- 0:00:30
      586500 -- [-883.978] (-883.477) (-889.433) (-884.108) * (-885.640) [-884.913] (-885.667) (-885.054) -- 0:00:30
      587000 -- (-883.638) (-884.185) (-886.822) [-885.074] * (-887.959) (-883.408) [-885.454] (-887.973) -- 0:00:30
      587500 -- [-883.469] (-884.680) (-885.391) (-884.527) * [-883.647] (-885.713) (-888.699) (-884.084) -- 0:00:30
      588000 -- (-883.929) (-882.781) [-885.409] (-883.951) * (-883.647) [-884.151] (-886.262) (-885.556) -- 0:00:30
      588500 -- (-886.222) [-885.467] (-884.788) (-883.368) * (-886.927) [-884.225] (-889.739) (-889.851) -- 0:00:30
      589000 -- (-884.167) [-884.164] (-888.797) (-883.283) * (-884.345) (-888.781) (-892.365) [-884.612] -- 0:00:30
      589500 -- (-888.536) (-885.033) (-885.283) [-883.952] * [-887.207] (-887.172) (-885.212) (-890.767) -- 0:00:29
      590000 -- (-890.225) [-887.425] (-884.488) (-883.814) * (-885.591) [-886.343] (-887.327) (-886.678) -- 0:00:29

      Average standard deviation of split frequencies: 0.005693

      590500 -- (-883.635) (-887.314) [-883.812] (-884.407) * (-884.596) (-887.835) [-885.682] (-883.627) -- 0:00:29
      591000 -- (-887.787) (-885.489) (-882.910) [-884.712] * [-889.247] (-884.786) (-883.100) (-886.008) -- 0:00:29
      591500 -- (-884.055) (-884.672) (-882.949) [-883.623] * (-886.391) (-883.135) [-885.763] (-885.619) -- 0:00:29
      592000 -- [-883.687] (-884.905) (-885.184) (-884.571) * (-886.954) (-889.375) (-884.821) [-887.002] -- 0:00:29
      592500 -- (-886.047) (-883.796) (-883.618) [-883.997] * (-884.489) [-882.817] (-885.649) (-884.867) -- 0:00:29
      593000 -- (-883.983) [-885.227] (-883.050) (-889.600) * (-888.560) (-886.225) (-886.737) [-889.284] -- 0:00:29
      593500 -- (-890.125) (-884.907) (-890.532) [-886.702] * (-885.978) (-887.891) [-885.818] (-886.749) -- 0:00:29
      594000 -- [-888.310] (-885.337) (-888.426) (-885.004) * [-883.104] (-886.025) (-887.591) (-883.731) -- 0:00:29
      594500 -- (-884.219) (-883.812) (-884.791) [-884.434] * (-883.192) (-887.983) (-889.416) [-883.676] -- 0:00:29
      595000 -- (-885.367) [-882.902] (-888.065) (-894.071) * (-884.683) (-891.977) (-886.563) [-883.482] -- 0:00:29

      Average standard deviation of split frequencies: 0.006970

      595500 -- (-885.267) (-884.498) (-886.270) [-890.669] * (-889.178) [-883.041] (-886.561) (-883.116) -- 0:00:29
      596000 -- (-884.418) (-885.039) (-883.607) [-887.424] * (-887.800) (-885.509) (-887.461) [-883.226] -- 0:00:29
      596500 -- (-887.819) (-884.202) [-883.549] (-888.023) * (-885.158) [-886.759] (-889.263) (-883.694) -- 0:00:29
      597000 -- (-885.144) (-883.609) [-884.422] (-888.356) * (-883.035) [-883.360] (-884.148) (-889.704) -- 0:00:29
      597500 -- (-883.937) (-884.131) (-883.086) [-887.038] * [-884.474] (-883.638) (-885.814) (-885.871) -- 0:00:29
      598000 -- [-883.893] (-888.381) (-883.377) (-885.130) * (-887.321) (-884.637) [-886.025] (-885.990) -- 0:00:29
      598500 -- [-883.946] (-883.458) (-882.969) (-882.893) * (-885.158) (-887.370) [-886.695] (-885.278) -- 0:00:29
      599000 -- (-884.388) (-886.767) [-885.182] (-883.867) * (-884.276) (-887.275) [-884.609] (-886.881) -- 0:00:29
      599500 -- (-886.492) [-886.596] (-884.661) (-883.709) * (-887.842) (-888.144) (-886.701) [-885.351] -- 0:00:29
      600000 -- (-883.791) (-884.662) [-884.094] (-888.582) * (-886.678) [-884.340] (-885.896) (-888.322) -- 0:00:29

      Average standard deviation of split frequencies: 0.006854

      600500 -- [-889.813] (-884.814) (-884.074) (-891.414) * [-885.703] (-885.676) (-883.524) (-886.107) -- 0:00:29
      601000 -- (-884.038) (-884.899) [-885.083] (-885.624) * (-885.665) (-886.407) (-883.480) [-883.180] -- 0:00:29
      601500 -- (-886.044) (-884.150) [-883.542] (-884.661) * (-883.386) (-885.656) (-885.752) [-883.181] -- 0:00:29
      602000 -- (-885.713) (-883.343) [-884.018] (-886.829) * (-883.548) (-889.277) (-886.037) [-883.054] -- 0:00:29
      602500 -- (-883.752) (-888.103) (-884.355) [-885.311] * [-883.313] (-885.527) (-883.908) (-886.541) -- 0:00:29
      603000 -- (-883.691) (-885.219) (-884.705) [-883.670] * (-884.126) (-884.155) (-884.155) [-890.268] -- 0:00:28
      603500 -- (-883.809) (-884.004) (-884.342) [-882.936] * [-884.249] (-884.927) (-884.385) (-893.711) -- 0:00:28
      604000 -- [-888.286] (-884.049) (-884.318) (-884.934) * (-884.123) (-883.003) [-884.132] (-887.071) -- 0:00:28
      604500 -- (-883.778) (-886.864) [-883.385] (-883.470) * (-884.623) (-886.699) [-884.845] (-886.013) -- 0:00:28
      605000 -- [-887.719] (-884.507) (-885.261) (-883.256) * (-884.085) (-887.016) [-883.470] (-883.456) -- 0:00:28

      Average standard deviation of split frequencies: 0.006897

      605500 -- (-883.790) (-884.898) (-888.589) [-884.334] * (-885.421) [-886.394] (-886.650) (-885.616) -- 0:00:28
      606000 -- (-884.727) [-882.896] (-886.349) (-884.454) * (-885.357) [-885.940] (-886.367) (-887.918) -- 0:00:28
      606500 -- (-884.699) [-882.908] (-884.856) (-884.467) * (-888.045) (-886.522) [-883.406] (-886.383) -- 0:00:28
      607000 -- (-886.626) (-884.419) [-883.195] (-889.448) * (-884.228) (-888.331) [-883.752] (-883.889) -- 0:00:28
      607500 -- [-884.220] (-884.829) (-883.579) (-888.127) * (-890.251) [-888.608] (-884.050) (-887.854) -- 0:00:28
      608000 -- (-884.648) (-886.922) [-884.036] (-885.903) * (-883.602) [-888.158] (-888.851) (-891.311) -- 0:00:28
      608500 -- (-889.731) (-883.973) (-883.694) [-884.304] * [-883.590] (-887.485) (-883.821) (-886.657) -- 0:00:28
      609000 -- [-886.785] (-884.073) (-885.447) (-883.843) * [-884.171] (-887.438) (-884.200) (-885.786) -- 0:00:28
      609500 -- [-883.144] (-886.202) (-885.003) (-885.895) * (-885.995) (-883.670) [-884.604] (-885.586) -- 0:00:28
      610000 -- (-884.736) [-885.514] (-883.934) (-886.038) * (-884.935) (-884.769) (-884.454) [-885.630] -- 0:00:28

      Average standard deviation of split frequencies: 0.006999

      610500 -- (-882.887) (-885.856) (-887.659) [-884.048] * (-886.911) [-885.645] (-882.768) (-885.005) -- 0:00:28
      611000 -- (-885.217) [-888.111] (-890.053) (-883.600) * (-886.198) [-886.131] (-882.924) (-885.274) -- 0:00:28
      611500 -- [-882.945] (-885.116) (-884.042) (-891.523) * (-884.704) (-885.300) (-882.924) [-885.609] -- 0:00:28
      612000 -- [-885.302] (-885.147) (-885.740) (-885.985) * (-883.044) [-883.773] (-882.924) (-886.842) -- 0:00:28
      612500 -- (-887.603) [-884.722] (-885.897) (-887.658) * (-885.151) (-885.769) [-886.229] (-883.503) -- 0:00:28
      613000 -- (-885.894) [-885.113] (-886.252) (-886.101) * (-884.536) (-885.828) [-885.987] (-884.490) -- 0:00:28
      613500 -- (-885.848) (-883.805) (-886.085) [-884.453] * (-884.190) [-884.860] (-883.714) (-883.571) -- 0:00:28
      614000 -- (-883.863) (-884.513) (-886.056) [-884.238] * (-885.976) (-885.627) [-888.048] (-883.576) -- 0:00:28
      614500 -- (-884.625) [-884.248] (-883.302) (-884.983) * (-884.416) (-884.101) (-884.955) [-884.178] -- 0:00:28
      615000 -- (-885.051) (-883.893) (-884.444) [-883.469] * (-883.978) [-883.722] (-885.245) (-883.444) -- 0:00:28

      Average standard deviation of split frequencies: 0.007347

      615500 -- (-886.022) (-883.627) (-887.966) [-883.468] * [-884.880] (-883.866) (-886.284) (-885.699) -- 0:00:28
      616000 -- (-885.736) (-883.134) (-883.837) [-886.127] * [-883.387] (-884.781) (-886.431) (-884.676) -- 0:00:28
      616500 -- [-889.033] (-883.777) (-884.301) (-885.708) * [-883.280] (-885.816) (-884.216) (-883.699) -- 0:00:27
      617000 -- [-883.374] (-884.046) (-884.044) (-883.965) * [-885.768] (-888.500) (-886.505) (-883.690) -- 0:00:27
      617500 -- (-885.625) (-886.947) [-883.299] (-885.345) * [-886.992] (-887.380) (-883.969) (-883.376) -- 0:00:27
      618000 -- (-888.060) [-885.294] (-887.356) (-884.856) * (-884.416) (-886.709) (-883.950) [-883.608] -- 0:00:27
      618500 -- (-887.732) (-888.366) [-883.487] (-885.208) * (-887.336) (-887.294) [-883.777] (-884.980) -- 0:00:27
      619000 -- [-884.442] (-888.403) (-887.241) (-885.326) * (-886.120) [-885.585] (-883.481) (-885.939) -- 0:00:27
      619500 -- [-884.592] (-885.883) (-885.685) (-883.314) * (-885.004) [-884.576] (-883.918) (-884.942) -- 0:00:27
      620000 -- (-885.856) [-883.207] (-891.709) (-884.928) * (-882.875) [-885.757] (-887.450) (-886.784) -- 0:00:27

      Average standard deviation of split frequencies: 0.007595

      620500 -- [-884.514] (-883.839) (-888.046) (-888.016) * (-884.368) [-886.182] (-883.674) (-884.722) -- 0:00:27
      621000 -- (-883.949) (-884.971) (-885.320) [-897.250] * (-887.717) [-886.247] (-884.195) (-886.612) -- 0:00:27
      621500 -- (-885.845) (-885.705) [-885.216] (-889.541) * (-888.067) (-883.707) (-883.470) [-884.626] -- 0:00:28
      622000 -- (-884.068) [-886.871] (-884.771) (-888.077) * (-883.936) (-888.304) [-883.895] (-884.520) -- 0:00:27
      622500 -- [-883.077] (-886.803) (-883.586) (-884.845) * [-883.086] (-885.779) (-883.710) (-882.792) -- 0:00:27
      623000 -- (-884.642) [-888.521] (-883.820) (-883.498) * [-883.365] (-885.087) (-883.849) (-884.519) -- 0:00:27
      623500 -- [-884.732] (-887.969) (-886.248) (-883.294) * (-886.164) (-884.906) [-884.460] (-886.489) -- 0:00:27
      624000 -- [-885.045] (-895.572) (-884.854) (-887.040) * (-883.679) [-884.013] (-885.625) (-883.209) -- 0:00:27
      624500 -- [-883.506] (-884.366) (-884.733) (-884.377) * (-885.151) [-883.297] (-883.417) (-886.573) -- 0:00:27
      625000 -- (-885.860) [-884.734] (-885.539) (-887.692) * [-886.248] (-884.729) (-888.702) (-887.459) -- 0:00:27

      Average standard deviation of split frequencies: 0.007201

      625500 -- [-889.508] (-886.894) (-884.086) (-889.057) * (-886.126) (-885.733) [-883.432] (-884.593) -- 0:00:27
      626000 -- [-887.939] (-886.808) (-883.907) (-888.808) * [-883.365] (-885.700) (-884.499) (-884.657) -- 0:00:27
      626500 -- (-884.851) (-885.782) (-884.700) [-885.391] * [-884.824] (-887.773) (-885.826) (-885.757) -- 0:00:27
      627000 -- (-884.802) (-885.551) [-886.321] (-883.670) * (-884.089) (-887.921) (-885.185) [-889.335] -- 0:00:27
      627500 -- (-884.490) (-885.373) (-885.058) [-885.472] * (-885.664) (-886.185) (-883.870) [-882.803] -- 0:00:27
      628000 -- (-884.473) [-885.713] (-884.653) (-884.466) * (-883.369) (-884.822) (-883.319) [-883.255] -- 0:00:27
      628500 -- (-886.077) (-884.583) (-884.932) [-883.671] * (-886.536) [-884.500] (-883.725) (-887.589) -- 0:00:27
      629000 -- [-883.632] (-885.272) (-884.285) (-882.890) * (-884.781) (-883.400) [-884.181] (-885.148) -- 0:00:27
      629500 -- (-883.165) (-885.750) (-885.140) [-886.420] * (-884.124) (-882.987) (-888.344) [-883.408] -- 0:00:27
      630000 -- (-882.845) (-887.338) [-884.399] (-884.037) * [-885.539] (-888.426) (-886.357) (-884.028) -- 0:00:27

      Average standard deviation of split frequencies: 0.006677

      630500 -- (-886.851) (-885.044) (-886.029) [-885.089] * (-889.741) [-883.535] (-886.488) (-884.954) -- 0:00:26
      631000 -- (-888.520) (-888.444) [-884.709] (-888.092) * [-887.312] (-885.684) (-887.392) (-886.583) -- 0:00:26
      631500 -- (-887.926) (-889.118) [-884.591] (-884.533) * (-886.361) [-884.541] (-889.760) (-886.055) -- 0:00:26
      632000 -- (-883.659) (-889.139) [-885.979] (-887.345) * (-883.975) (-883.882) [-884.359] (-888.619) -- 0:00:26
      632500 -- (-884.891) (-884.721) (-884.439) [-883.490] * (-884.725) (-884.501) (-883.974) [-884.462] -- 0:00:26
      633000 -- (-888.098) (-885.569) [-885.926] (-886.666) * (-888.840) [-882.994] (-883.681) (-885.146) -- 0:00:26
      633500 -- [-884.697] (-887.805) (-886.470) (-884.090) * [-886.835] (-886.187) (-886.041) (-883.520) -- 0:00:26
      634000 -- (-885.292) [-885.878] (-884.853) (-892.215) * (-884.958) (-883.232) (-885.269) [-882.736] -- 0:00:26
      634500 -- (-885.563) [-885.954] (-888.359) (-888.533) * [-884.568] (-883.540) (-892.517) (-884.675) -- 0:00:26
      635000 -- (-885.550) [-884.555] (-885.171) (-886.257) * (-889.380) (-884.533) (-887.786) [-884.440] -- 0:00:27

      Average standard deviation of split frequencies: 0.006374

      635500 -- [-886.737] (-884.080) (-886.009) (-886.888) * (-888.937) (-887.943) [-886.779] (-884.505) -- 0:00:26
      636000 -- (-883.868) (-884.330) [-884.088] (-888.084) * (-887.756) (-886.081) (-883.456) [-883.250] -- 0:00:26
      636500 -- [-883.635] (-885.457) (-884.809) (-884.888) * (-888.166) [-885.658] (-883.011) (-884.885) -- 0:00:26
      637000 -- [-885.326] (-889.891) (-885.739) (-885.105) * (-883.757) [-886.903] (-891.457) (-887.542) -- 0:00:26
      637500 -- (-885.299) (-884.448) [-885.514] (-884.277) * (-887.925) (-886.821) [-882.742] (-884.260) -- 0:00:26
      638000 -- [-885.589] (-884.232) (-888.586) (-883.380) * (-885.408) [-885.889] (-891.729) (-885.984) -- 0:00:26
      638500 -- [-889.316] (-887.827) (-886.611) (-884.677) * (-883.923) [-886.113] (-885.728) (-886.597) -- 0:00:26
      639000 -- (-887.905) (-886.458) [-886.967] (-883.588) * (-885.527) (-883.483) (-883.925) [-883.890] -- 0:00:26
      639500 -- (-887.287) (-884.369) (-884.526) [-885.017] * [-884.628] (-885.169) (-885.265) (-883.468) -- 0:00:26
      640000 -- (-885.724) (-887.987) (-888.007) [-885.089] * (-890.552) (-887.245) [-884.623] (-886.219) -- 0:00:26

      Average standard deviation of split frequencies: 0.006230

      640500 -- (-887.827) (-886.465) [-891.561] (-886.045) * (-884.798) [-884.358] (-883.133) (-888.086) -- 0:00:26
      641000 -- (-888.880) (-887.608) [-885.597] (-884.620) * (-883.017) (-884.448) [-886.058] (-885.008) -- 0:00:26
      641500 -- [-883.203] (-883.773) (-884.206) (-884.100) * (-890.254) (-884.999) (-885.335) [-884.443] -- 0:00:26
      642000 -- (-883.457) (-884.938) (-885.551) [-883.278] * [-884.955] (-885.779) (-885.714) (-886.696) -- 0:00:26
      642500 -- (-884.942) (-884.938) (-882.781) [-887.300] * (-884.053) [-885.216] (-883.919) (-884.490) -- 0:00:26
      643000 -- (-884.076) (-885.190) (-883.483) [-888.157] * (-885.147) (-884.774) (-886.017) [-884.269] -- 0:00:26
      643500 -- (-886.674) [-888.982] (-883.510) (-885.953) * (-885.107) (-886.870) (-884.806) [-884.261] -- 0:00:26
      644000 -- (-887.259) (-885.800) [-884.683] (-883.311) * [-885.344] (-884.356) (-884.036) (-883.604) -- 0:00:25
      644500 -- (-884.971) [-883.241] (-886.843) (-893.733) * [-885.217] (-884.574) (-887.776) (-883.962) -- 0:00:25
      645000 -- [-884.056] (-882.771) (-883.665) (-897.418) * [-883.826] (-883.588) (-885.092) (-885.144) -- 0:00:25

      Average standard deviation of split frequencies: 0.006324

      645500 -- (-884.529) (-882.857) (-882.990) [-885.958] * [-885.986] (-884.493) (-885.516) (-882.956) -- 0:00:25
      646000 -- [-882.648] (-887.307) (-883.305) (-887.145) * (-885.957) (-885.756) (-889.842) [-883.704] -- 0:00:25
      646500 -- (-882.927) (-886.776) (-885.860) [-883.077] * [-883.774] (-892.422) (-886.533) (-888.161) -- 0:00:25
      647000 -- (-884.717) (-883.941) (-885.837) [-883.455] * [-882.771] (-888.926) (-885.636) (-883.969) -- 0:00:25
      647500 -- (-884.207) [-883.704] (-886.014) (-883.513) * (-882.837) (-885.051) (-884.178) [-886.019] -- 0:00:25
      648000 -- (-883.728) [-885.786] (-883.548) (-883.483) * (-885.730) [-884.406] (-884.423) (-884.942) -- 0:00:25
      648500 -- (-884.467) (-889.063) (-885.015) [-883.483] * (-886.743) (-883.705) (-883.414) [-885.122] -- 0:00:26
      649000 -- [-886.706] (-887.170) (-883.844) (-886.306) * (-885.991) (-887.221) [-883.342] (-885.141) -- 0:00:25
      649500 -- (-888.182) (-884.514) (-888.002) [-884.750] * [-885.409] (-885.809) (-883.887) (-883.295) -- 0:00:25
      650000 -- (-889.919) [-884.549] (-885.838) (-886.947) * (-888.929) (-885.126) (-884.485) [-885.276] -- 0:00:25

      Average standard deviation of split frequencies: 0.006134

      650500 -- [-883.115] (-884.676) (-883.981) (-883.365) * (-883.284) (-883.154) [-887.544] (-886.071) -- 0:00:25
      651000 -- (-885.938) (-884.362) [-887.137] (-884.496) * (-884.909) (-883.211) (-885.907) [-885.918] -- 0:00:25
      651500 -- (-885.902) (-886.727) (-884.516) [-883.819] * (-884.184) (-887.653) (-888.491) [-884.976] -- 0:00:25
      652000 -- (-887.158) (-884.601) [-883.631] (-883.787) * (-883.877) (-887.033) (-883.875) [-885.131] -- 0:00:25
      652500 -- (-884.963) [-884.391] (-886.691) (-885.675) * (-884.006) [-884.106] (-889.227) (-885.825) -- 0:00:25
      653000 -- (-886.648) (-883.804) [-884.169] (-887.794) * (-884.832) (-883.011) [-889.081] (-883.491) -- 0:00:25
      653500 -- (-888.261) (-886.819) (-883.451) [-884.055] * [-885.791] (-884.680) (-890.845) (-885.515) -- 0:00:25
      654000 -- (-885.752) (-883.598) [-883.364] (-885.118) * (-883.537) [-886.810] (-890.836) (-884.183) -- 0:00:25
      654500 -- (-884.640) (-886.105) [-883.413] (-884.799) * (-884.100) (-883.342) [-885.025] (-889.382) -- 0:00:25
      655000 -- (-883.540) [-886.404] (-886.950) (-887.835) * [-883.999] (-887.758) (-889.009) (-883.418) -- 0:00:25

      Average standard deviation of split frequencies: 0.005366

      655500 -- (-884.323) [-884.196] (-883.979) (-888.617) * (-885.522) [-883.748] (-888.043) (-884.373) -- 0:00:25
      656000 -- [-883.661] (-887.831) (-889.175) (-888.087) * (-883.314) (-882.981) (-884.210) [-886.625] -- 0:00:25
      656500 -- (-882.737) (-885.783) (-884.146) [-884.941] * [-885.909] (-883.976) (-888.630) (-887.745) -- 0:00:25
      657000 -- [-882.630] (-885.473) (-884.233) (-887.956) * [-883.993] (-887.893) (-884.446) (-890.804) -- 0:00:25
      657500 -- [-885.165] (-887.835) (-885.179) (-888.477) * [-886.971] (-887.383) (-885.065) (-886.345) -- 0:00:25
      658000 -- (-884.890) (-886.218) [-885.056] (-884.309) * [-886.226] (-885.176) (-885.898) (-885.461) -- 0:00:24
      658500 -- (-884.953) (-891.424) (-885.544) [-884.106] * (-883.590) (-886.668) (-884.364) [-888.554] -- 0:00:24
      659000 -- (-883.557) (-897.495) (-890.620) [-885.148] * [-883.932] (-884.993) (-884.491) (-887.583) -- 0:00:24
      659500 -- (-883.280) (-893.322) [-883.820] (-887.212) * (-887.297) [-884.709] (-883.543) (-890.379) -- 0:00:24
      660000 -- (-883.213) (-889.129) (-883.620) [-886.166] * (-888.701) (-884.390) (-886.077) [-892.433] -- 0:00:24

      Average standard deviation of split frequencies: 0.005328

      660500 -- [-887.710] (-889.451) (-883.527) (-885.056) * (-885.155) (-884.299) (-889.057) [-883.769] -- 0:00:24
      661000 -- [-888.777] (-886.811) (-884.375) (-885.616) * (-884.449) [-885.980] (-888.853) (-887.475) -- 0:00:24
      661500 -- (-884.155) (-884.896) [-884.826] (-884.078) * [-885.779] (-887.394) (-884.961) (-886.052) -- 0:00:24
      662000 -- (-883.952) (-885.961) [-887.221] (-885.017) * (-884.117) [-883.943] (-886.323) (-883.915) -- 0:00:24
      662500 -- (-885.847) (-883.326) (-884.698) [-884.107] * (-885.981) (-884.481) [-884.571] (-887.638) -- 0:00:24
      663000 -- (-885.886) (-885.088) (-887.827) [-883.526] * [-885.573] (-883.045) (-889.494) (-885.901) -- 0:00:24
      663500 -- (-885.595) (-884.146) (-886.009) [-883.697] * (-884.733) (-884.443) (-886.786) [-884.158] -- 0:00:24
      664000 -- [-887.252] (-882.789) (-889.425) (-884.523) * (-885.977) (-885.689) (-887.050) [-884.783] -- 0:00:24
      664500 -- [-886.513] (-883.729) (-885.912) (-883.715) * [-884.556] (-883.561) (-883.464) (-884.961) -- 0:00:24
      665000 -- (-885.673) [-886.028] (-886.911) (-883.503) * (-884.069) [-883.597] (-884.315) (-884.784) -- 0:00:24

      Average standard deviation of split frequencies: 0.005663

      665500 -- (-885.756) (-884.918) (-887.998) [-885.021] * (-885.792) (-884.272) (-885.521) [-884.211] -- 0:00:24
      666000 -- (-887.494) (-884.145) [-883.999] (-883.845) * [-883.400] (-885.392) (-885.107) (-887.988) -- 0:00:24
      666500 -- (-885.085) [-887.284] (-888.098) (-886.924) * (-883.714) (-884.429) (-885.634) [-884.018] -- 0:00:24
      667000 -- (-888.896) (-889.782) (-888.748) [-883.406] * (-883.489) (-884.265) (-884.067) [-885.287] -- 0:00:24
      667500 -- (-885.410) (-889.524) [-885.260] (-887.710) * (-885.087) (-885.114) [-886.243] (-888.561) -- 0:00:24
      668000 -- (-883.220) (-886.216) [-884.465] (-884.008) * [-884.285] (-885.198) (-886.784) (-883.203) -- 0:00:24
      668500 -- [-883.279] (-884.134) (-886.995) (-883.772) * [-886.485] (-884.394) (-885.610) (-883.415) -- 0:00:24
      669000 -- (-886.858) (-884.490) (-884.276) [-883.492] * [-883.540] (-884.484) (-885.815) (-887.505) -- 0:00:24
      669500 -- (-883.719) [-885.321] (-884.281) (-883.420) * [-883.530] (-884.133) (-883.539) (-890.025) -- 0:00:24
      670000 -- (-883.465) (-887.033) [-887.889] (-884.944) * (-885.279) [-883.213] (-884.496) (-886.085) -- 0:00:24

      Average standard deviation of split frequencies: 0.005998

      670500 -- [-889.246] (-887.382) (-884.746) (-883.497) * (-883.903) [-883.462] (-884.087) (-886.524) -- 0:00:24
      671000 -- (-887.810) (-884.646) (-885.813) [-883.158] * [-883.806] (-882.836) (-883.942) (-884.525) -- 0:00:24
      671500 -- (-886.494) (-884.471) [-884.011] (-883.734) * [-884.655] (-882.845) (-883.784) (-883.769) -- 0:00:23
      672000 -- (-885.231) [-884.643] (-884.733) (-884.899) * (-883.904) [-883.997] (-885.727) (-885.711) -- 0:00:23
      672500 -- (-883.697) (-886.135) (-884.416) [-884.821] * (-884.005) [-886.164] (-883.586) (-890.390) -- 0:00:23
      673000 -- [-883.963] (-884.179) (-887.140) (-885.233) * (-891.088) (-885.009) (-883.733) [-884.218] -- 0:00:23
      673500 -- [-884.003] (-886.321) (-888.906) (-884.638) * (-886.938) (-884.770) (-886.445) [-885.186] -- 0:00:23
      674000 -- (-885.704) (-888.350) [-885.781] (-890.626) * (-887.124) (-884.300) (-886.764) [-886.907] -- 0:00:23
      674500 -- [-886.302] (-885.356) (-887.344) (-885.141) * (-885.312) [-885.530] (-884.241) (-884.203) -- 0:00:23
      675000 -- (-886.711) (-884.060) (-887.851) [-887.593] * (-886.467) (-884.781) (-886.647) [-883.748] -- 0:00:23

      Average standard deviation of split frequencies: 0.006602

      675500 -- [-887.680] (-886.041) (-886.039) (-887.066) * (-885.541) [-886.070] (-886.347) (-883.202) -- 0:00:23
      676000 -- (-885.151) (-884.948) [-887.257] (-887.591) * (-890.849) (-883.854) (-884.379) [-884.033] -- 0:00:23
      676500 -- [-883.016] (-886.325) (-886.546) (-886.599) * (-883.710) [-883.685] (-884.611) (-886.474) -- 0:00:23
      677000 -- (-889.307) (-885.632) (-885.117) [-886.880] * (-886.064) [-885.989] (-885.096) (-886.076) -- 0:00:23
      677500 -- [-883.760] (-886.053) (-886.016) (-883.643) * (-885.486) [-883.453] (-883.671) (-887.546) -- 0:00:23
      678000 -- [-883.485] (-884.474) (-887.783) (-885.727) * (-886.980) (-884.258) [-883.598] (-887.377) -- 0:00:23
      678500 -- [-883.073] (-884.847) (-885.755) (-885.896) * [-885.212] (-883.988) (-884.555) (-884.265) -- 0:00:23
      679000 -- (-883.290) (-886.783) (-886.970) [-885.585] * (-885.125) [-885.228] (-885.416) (-883.188) -- 0:00:23
      679500 -- [-885.745] (-887.949) (-884.658) (-883.641) * [-886.812] (-884.258) (-884.763) (-888.914) -- 0:00:23
      680000 -- (-883.868) (-884.372) (-884.221) [-886.134] * [-886.349] (-888.451) (-886.261) (-887.493) -- 0:00:23

      Average standard deviation of split frequencies: 0.006418

      680500 -- (-883.897) (-884.888) (-883.629) [-885.140] * (-884.531) [-883.853] (-886.272) (-885.670) -- 0:00:23
      681000 -- (-887.539) (-884.959) (-889.566) [-884.547] * [-885.369] (-886.797) (-890.401) (-885.306) -- 0:00:23
      681500 -- [-884.298] (-883.006) (-887.117) (-883.599) * (-886.579) (-883.581) [-884.731] (-889.005) -- 0:00:23
      682000 -- (-885.488) (-882.872) (-888.522) [-883.927] * (-883.904) [-882.864] (-886.669) (-884.916) -- 0:00:23
      682500 -- (-884.629) (-882.922) [-883.933] (-884.663) * [-884.232] (-883.806) (-888.217) (-885.758) -- 0:00:23
      683000 -- (-886.221) (-884.886) (-887.703) [-886.416] * (-884.306) (-885.471) [-885.737] (-885.711) -- 0:00:23
      683500 -- (-885.913) (-884.289) (-885.965) [-887.937] * (-886.461) (-884.773) (-885.063) [-884.943] -- 0:00:23
      684000 -- [-885.387] (-888.448) (-885.342) (-886.447) * (-886.467) (-890.251) [-885.126] (-885.555) -- 0:00:23
      684500 -- (-885.518) [-885.789] (-887.190) (-883.994) * [-885.255] (-885.292) (-885.355) (-885.020) -- 0:00:23
      685000 -- (-883.894) (-886.427) (-885.565) [-883.256] * (-884.620) [-883.659] (-889.105) (-884.524) -- 0:00:22

      Average standard deviation of split frequencies: 0.006826

      685500 -- (-883.321) (-887.240) (-883.976) [-884.506] * [-884.036] (-886.463) (-884.674) (-884.212) -- 0:00:22
      686000 -- [-883.442] (-890.775) (-885.527) (-884.135) * [-884.205] (-887.939) (-883.821) (-886.147) -- 0:00:22
      686500 -- (-884.494) (-885.564) [-884.882] (-885.924) * (-882.714) [-886.400] (-883.970) (-886.196) -- 0:00:22
      687000 -- [-883.276] (-884.411) (-884.482) (-885.035) * [-882.875] (-886.806) (-885.349) (-889.505) -- 0:00:22
      687500 -- [-882.652] (-885.780) (-884.089) (-884.542) * (-884.283) [-885.116] (-885.158) (-886.482) -- 0:00:22
      688000 -- (-882.847) (-882.638) [-884.168] (-885.565) * (-885.164) (-885.293) [-887.248] (-884.315) -- 0:00:22
      688500 -- (-882.905) (-883.030) [-886.642] (-885.750) * [-883.223] (-885.148) (-886.031) (-885.415) -- 0:00:22
      689000 -- [-882.904] (-884.889) (-884.333) (-884.305) * (-884.675) [-885.357] (-884.400) (-884.184) -- 0:00:22
      689500 -- (-888.461) (-884.406) [-886.581] (-883.816) * (-888.108) (-884.029) (-887.360) [-887.033] -- 0:00:22
      690000 -- (-884.808) [-883.170] (-891.204) (-885.930) * (-884.767) (-886.717) (-885.290) [-888.011] -- 0:00:22

      Average standard deviation of split frequencies: 0.006962

      690500 -- [-884.869] (-883.405) (-889.584) (-884.352) * (-886.996) (-885.899) (-885.814) [-886.476] -- 0:00:22
      691000 -- (-885.701) (-888.769) (-890.963) [-887.723] * (-891.379) (-885.662) (-884.300) [-883.538] -- 0:00:22
      691500 -- (-884.799) (-886.913) (-884.108) [-883.149] * [-884.828] (-883.196) (-883.446) (-883.949) -- 0:00:22
      692000 -- (-885.192) [-883.250] (-883.920) (-886.990) * (-883.386) (-882.917) [-883.912] (-884.175) -- 0:00:22
      692500 -- [-884.087] (-884.770) (-883.691) (-884.425) * [-883.741] (-884.750) (-884.093) (-884.736) -- 0:00:22
      693000 -- (-885.290) (-884.325) (-885.722) [-882.670] * [-884.942] (-887.626) (-888.056) (-887.661) -- 0:00:22
      693500 -- (-885.181) (-887.374) (-884.632) [-882.672] * [-884.055] (-885.937) (-884.010) (-885.785) -- 0:00:22
      694000 -- (-883.904) (-883.652) [-884.115] (-883.864) * [-885.476] (-884.027) (-885.448) (-889.859) -- 0:00:22
      694500 -- [-883.524] (-889.984) (-883.644) (-884.877) * (-884.045) [-883.634] (-885.457) (-886.557) -- 0:00:22
      695000 -- (-889.328) (-885.616) [-884.000] (-885.428) * (-885.984) (-886.220) [-885.170] (-883.759) -- 0:00:22

      Average standard deviation of split frequencies: 0.006863

      695500 -- (-884.228) (-886.503) [-887.180] (-887.455) * (-883.113) (-883.405) [-889.292] (-886.722) -- 0:00:22
      696000 -- (-885.796) [-883.595] (-884.277) (-884.654) * (-883.500) [-885.007] (-886.175) (-884.537) -- 0:00:22
      696500 -- (-884.346) (-886.525) (-889.227) [-885.902] * [-883.904] (-884.120) (-886.928) (-883.654) -- 0:00:22
      697000 -- (-884.239) (-884.466) [-885.445] (-890.017) * (-887.693) [-883.875] (-885.723) (-884.727) -- 0:00:22
      697500 -- (-884.301) (-884.214) (-883.632) [-884.764] * (-886.133) (-885.200) [-885.218] (-887.049) -- 0:00:22
      698000 -- (-883.659) (-884.853) (-885.910) [-888.980] * (-887.430) (-887.166) [-886.479] (-886.357) -- 0:00:22
      698500 -- [-883.996] (-885.091) (-884.007) (-883.685) * (-884.719) [-887.910] (-887.013) (-887.593) -- 0:00:22
      699000 -- (-884.173) (-887.277) [-883.891] (-885.977) * (-883.578) [-885.487] (-887.655) (-885.409) -- 0:00:21
      699500 -- (-883.892) [-884.123] (-884.621) (-885.361) * (-884.619) (-884.726) (-885.198) [-884.751] -- 0:00:21
      700000 -- (-884.442) [-886.155] (-883.604) (-884.253) * (-885.406) (-888.431) [-884.278] (-885.143) -- 0:00:21

      Average standard deviation of split frequencies: 0.006773

      700500 -- (-884.375) [-883.935] (-884.635) (-884.339) * (-887.723) (-886.243) (-882.765) [-884.382] -- 0:00:21
      701000 -- [-884.243] (-886.643) (-885.552) (-883.985) * (-887.862) (-886.251) [-884.030] (-887.589) -- 0:00:21
      701500 -- [-885.620] (-888.964) (-883.548) (-888.975) * [-884.511] (-884.509) (-883.962) (-883.215) -- 0:00:21
      702000 -- (-883.962) [-884.681] (-884.990) (-884.574) * [-883.912] (-887.093) (-884.990) (-883.854) -- 0:00:21
      702500 -- (-884.090) [-885.140] (-885.722) (-882.803) * (-884.187) (-884.040) (-885.378) [-883.601] -- 0:00:21
      703000 -- (-887.901) [-884.840] (-883.325) (-883.470) * (-884.364) [-891.176] (-885.241) (-886.235) -- 0:00:21
      703500 -- (-885.052) (-887.983) [-883.112] (-882.715) * (-883.910) (-887.685) (-883.002) [-884.380] -- 0:00:21
      704000 -- [-883.574] (-885.348) (-884.599) (-883.189) * (-883.895) (-885.846) [-883.980] (-883.475) -- 0:00:21
      704500 -- (-885.204) (-883.167) (-884.810) [-884.695] * [-885.406] (-885.697) (-885.068) (-883.669) -- 0:00:21
      705000 -- (-883.713) [-884.373] (-883.669) (-885.003) * [-886.082] (-886.893) (-887.413) (-884.058) -- 0:00:21

      Average standard deviation of split frequencies: 0.006855

      705500 -- (-884.437) [-883.574] (-889.943) (-888.520) * (-886.799) (-891.982) [-883.411] (-884.134) -- 0:00:21
      706000 -- [-884.129] (-884.673) (-886.402) (-889.243) * (-885.241) (-892.232) (-883.255) [-886.481] -- 0:00:21
      706500 -- [-886.305] (-886.178) (-885.567) (-889.965) * (-886.032) (-883.863) (-883.087) [-884.557] -- 0:00:21
      707000 -- (-890.169) [-884.581] (-889.786) (-892.163) * (-885.144) (-885.197) [-884.461] (-883.581) -- 0:00:21
      707500 -- (-883.907) (-884.234) [-888.558] (-886.463) * (-889.955) (-889.702) (-885.370) [-883.234] -- 0:00:21
      708000 -- (-883.526) [-884.008] (-888.513) (-887.735) * (-883.578) (-887.722) [-885.055] (-884.168) -- 0:00:21
      708500 -- (-884.881) (-884.751) (-884.587) [-886.040] * [-883.275] (-886.209) (-885.924) (-883.396) -- 0:00:21
      709000 -- (-884.727) (-887.415) [-884.916] (-885.437) * (-883.423) [-885.468] (-889.867) (-883.226) -- 0:00:21
      709500 -- (-885.680) (-886.540) (-885.043) [-884.498] * [-883.503] (-885.678) (-887.864) (-888.167) -- 0:00:21
      710000 -- (-883.040) [-886.487] (-887.309) (-886.323) * (-884.193) (-885.116) (-889.011) [-885.856] -- 0:00:21

      Average standard deviation of split frequencies: 0.007462

      710500 -- (-884.527) (-885.127) (-886.660) [-883.999] * (-886.472) (-885.761) (-888.144) [-887.955] -- 0:00:21
      711000 -- [-884.145]