--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:33:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -884.27 -890.01
2 -884.22 -887.07
--------------------------------------
TOTAL -884.25 -889.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893195 0.088705 0.367561 1.502073 0.862723 1256.80 1328.45 1.000
r(A<->C){all} 0.170917 0.019601 0.000329 0.447180 0.140154 194.59 236.57 1.000
r(A<->G){all} 0.162792 0.019633 0.000011 0.442165 0.126340 188.57 202.70 1.000
r(A<->T){all} 0.159126 0.018644 0.000056 0.441958 0.122819 226.32 232.60 1.000
r(C<->G){all} 0.159992 0.020049 0.000017 0.438220 0.122750 210.56 305.07 1.014
r(C<->T){all} 0.160912 0.020176 0.000043 0.447143 0.120222 77.86 203.67 1.001
r(G<->T){all} 0.186260 0.022142 0.000055 0.484796 0.147147 127.60 157.60 1.009
pi(A){all} 0.206536 0.000241 0.174930 0.235309 0.206014 1252.26 1332.29 1.000
pi(C){all} 0.280887 0.000304 0.249621 0.317037 0.280492 1303.93 1338.50 1.000
pi(G){all} 0.343722 0.000336 0.308221 0.379382 0.344022 1209.83 1243.75 1.000
pi(T){all} 0.168854 0.000212 0.140854 0.197086 0.168426 1297.62 1308.69 1.000
alpha{1,2} 0.423902 0.235997 0.000206 1.398856 0.253879 1367.36 1373.23 1.000
alpha{3} 0.447536 0.224541 0.000119 1.368161 0.293008 1187.33 1246.66 1.000
pinvar{all} 0.997628 0.000008 0.992391 1.000000 0.998501 1244.17 1372.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -842.105997
Model 2: PositiveSelection -842.106043
Model 0: one-ratio -842.105984
Model 7: beta -842.106114
Model 8: beta&w>1 -842.105929
Model 0 vs 1 2.599999993435631E-5
Model 2 vs 1 9.1999999995096E-5
Model 8 vs 7 3.700000002027082E-4
>C1
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C2
VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C3
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C4
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C5
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
>C6
MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAIKRGEKo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219
C1 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C2 VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C3 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C4 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C5 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
C6 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
*************************************************
C1 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C2 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C3 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C4 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C5 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
C6 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
**************************************************
C1 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C2 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C3 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C4 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C5 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
C6 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
**************************************************
C1 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C2 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C3 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C4 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C5 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
C6 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
**************************************************
C1 GRTGGLVMVRSAIKRGEKo
C2 GRTGGLVMVRSAIKRGEK-
C3 GRTGGLVMVRSAIKRGEKo
C4 GRTGGLVMVRSAIKRGEKo
C5 GRTGGLVMVRSAIKRGEKo
C6 GRTGGLVMVRSAIKRGEKo
******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6580]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6580]--->[6570]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.755 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C2 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C3 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C4 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C5 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
C6 MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSAV
**************************************************
C1 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C2 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C3 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C4 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C5 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
C6 QLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQE
**************************************************
C1 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C2 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C3 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C4 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C5 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
C6 LTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPGS
**************************************************
C1 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C2 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C3 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C4 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C5 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
C6 IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
**************************************************
C1 RTGGLVMVRSAIKRGEK
C2 RTGGLVMVRSAIKRGEK
C3 RTGGLVMVRSAIKRGEK
C4 RTGGLVMVRSAIKRGEK
C5 RTGGLVMVRSAIKRGEK
C6 RTGGLVMVRSAIKRGEK
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C2 GTGATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C3 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C4 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C5 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
C6 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
***********************************************
C1 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C2 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C3 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C4 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C5 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
C6 ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
**************************************************
C1 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C2 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C3 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C4 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C5 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
C6 CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
**************************************************
C1 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C2 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C3 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C4 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C5 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
C6 GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
**************************************************
C1 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C2 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C3 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C4 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C5 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
C6 GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
**************************************************
C1 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C2 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C3 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C4 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C5 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
C6 AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
**************************************************
C1 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C2 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C3 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C4 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C5 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
C6 GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
**************************************************
C1 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C2 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C3 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C4 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C5 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
C6 GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
**************************************************
C1 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C2 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C3 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C4 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C5 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
C6 GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
**************************************************
C1 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C2 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C3 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C4 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C5 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
C6 TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
**************************************************
C1 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C2 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C3 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C4 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C5 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
C6 GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
**************************************************
C1 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C2 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C3 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C4 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C5 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
C6 ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
**************************************************
C1 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C2 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C3 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C4 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C5 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
C6 GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
**************************************************
C1 GAAA---
C2 GAAA---
C3 GAAA---
C4 GAAA---
C5 GAAA---
C6 GAAA---
****
>C1
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C2
GTGATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C3
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C4
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C5
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C6
---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT
ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC
CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT
GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT
GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG
AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA
GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG
GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC
GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT
TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT
GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC
ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC
GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA
GAAA---
>C1
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C2
VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C3
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C4
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C5
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
>C6
oMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
GRTGGLVMVRSAIKRGEK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 657 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789907
Setting output file names to "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1021068998
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0062468981
Seed = 365199252
Swapseed = 1579789907
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1461.128094 -- -24.965149
Chain 2 -- -1461.128094 -- -24.965149
Chain 3 -- -1461.128094 -- -24.965149
Chain 4 -- -1461.128010 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1461.128094 -- -24.965149
Chain 2 -- -1461.128094 -- -24.965149
Chain 3 -- -1461.128094 -- -24.965149
Chain 4 -- -1461.128010 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1461.128] (-1461.128) (-1461.128) (-1461.128) * [-1461.128] (-1461.128) (-1461.128) (-1461.128)
500 -- (-910.185) [-913.848] (-912.266) (-914.560) * (-909.590) (-907.122) (-912.123) [-906.217] -- 0:00:00
1000 -- [-891.978] (-891.092) (-913.956) (-905.449) * (-905.416) (-893.845) (-894.573) [-897.155] -- 0:00:00
1500 -- [-896.552] (-898.125) (-902.500) (-892.131) * (-903.411) (-892.658) (-905.174) [-892.058] -- 0:00:00
2000 -- (-898.409) (-891.327) [-895.140] (-895.933) * (-902.705) (-894.888) [-896.508] (-903.896) -- 0:00:00
2500 -- [-893.536] (-905.515) (-890.331) (-891.155) * (-893.639) (-893.585) [-892.585] (-894.665) -- 0:00:00
3000 -- [-891.395] (-893.928) (-894.581) (-891.175) * (-899.549) (-890.867) [-895.314] (-894.278) -- 0:00:00
3500 -- [-894.001] (-895.900) (-894.194) (-897.464) * [-892.274] (-892.805) (-891.367) (-891.571) -- 0:00:00
4000 -- (-896.888) (-893.312) (-896.963) [-892.347] * (-898.513) (-892.332) [-894.662] (-902.173) -- 0:00:00
4500 -- (-889.499) (-895.666) [-891.309] (-888.117) * (-894.048) (-892.817) [-892.912] (-893.469) -- 0:00:00
5000 -- (-891.153) (-891.764) (-889.289) [-897.611] * [-892.437] (-890.913) (-897.362) (-892.680) -- 0:00:00
Average standard deviation of split frequencies: 0.094281
5500 -- [-888.262] (-888.602) (-894.549) (-892.799) * [-889.505] (-896.111) (-889.170) (-891.361) -- 0:00:00
6000 -- [-891.716] (-894.313) (-897.654) (-895.427) * [-894.210] (-898.573) (-893.396) (-895.931) -- 0:00:00
6500 -- [-890.662] (-898.003) (-890.444) (-890.696) * [-893.668] (-896.553) (-892.178) (-894.131) -- 0:00:00
7000 -- [-897.373] (-889.654) (-905.457) (-895.783) * (-888.812) (-894.866) [-892.165] (-893.175) -- 0:00:00
7500 -- (-891.581) (-890.041) [-888.357] (-894.450) * (-897.861) (-903.690) (-890.439) [-895.873] -- 0:02:12
8000 -- [-891.613] (-896.576) (-891.423) (-893.257) * [-892.383] (-893.124) (-886.983) (-900.318) -- 0:02:04
8500 -- (-890.594) (-887.535) [-892.891] (-894.773) * (-890.810) [-889.333] (-883.207) (-895.675) -- 0:01:56
9000 -- (-897.715) (-894.563) (-898.256) [-888.289] * (-901.618) (-894.606) [-883.877] (-887.155) -- 0:01:50
9500 -- [-886.482] (-904.627) (-891.643) (-887.636) * [-891.449] (-893.041) (-888.280) (-883.207) -- 0:01:44
10000 -- (-894.972) (-885.398) [-890.911] (-891.112) * (-887.620) (-889.765) [-888.512] (-884.033) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- [-892.110] (-888.863) (-895.263) (-893.543) * [-899.098] (-884.668) (-887.246) (-883.351) -- 0:01:34
11000 -- (-897.254) (-886.555) [-887.858] (-893.247) * (-893.487) (-893.221) (-886.415) [-883.297] -- 0:01:29
11500 -- (-895.520) [-887.145] (-889.006) (-899.750) * (-894.791) (-889.596) (-883.703) [-883.835] -- 0:01:25
12000 -- [-888.492] (-884.921) (-896.143) (-892.031) * [-897.317] (-890.660) (-883.864) (-883.074) -- 0:01:22
12500 -- (-902.355) (-883.615) (-893.994) [-891.206] * (-894.748) (-888.143) [-884.401] (-883.346) -- 0:01:19
13000 -- (-898.903) (-885.162) [-890.638] (-895.684) * (-890.645) (-885.402) (-886.073) [-882.814] -- 0:01:15
13500 -- (-897.301) (-883.423) [-896.047] (-893.458) * (-892.425) (-887.159) (-888.990) [-883.202] -- 0:01:13
14000 -- (-894.304) (-883.419) [-889.819] (-889.925) * (-908.536) (-885.388) (-883.805) [-884.371] -- 0:01:10
14500 -- [-891.100] (-887.723) (-899.637) (-889.142) * (-887.873) (-889.788) (-883.887) [-887.507] -- 0:01:07
15000 -- (-898.736) [-886.034] (-890.071) (-895.548) * (-887.838) [-885.406] (-888.140) (-884.678) -- 0:01:05
Average standard deviation of split frequencies: 0.062943
15500 -- (-897.723) (-884.596) [-897.130] (-900.897) * (-884.074) (-885.872) (-884.660) [-886.041] -- 0:01:03
16000 -- [-891.801] (-888.278) (-894.863) (-903.475) * (-883.610) (-886.046) [-886.076] (-886.091) -- 0:01:01
16500 -- (-888.686) (-885.013) [-898.452] (-894.357) * [-884.351] (-885.954) (-888.368) (-884.698) -- 0:00:59
17000 -- (-893.279) (-884.571) [-895.818] (-890.200) * [-886.473] (-886.124) (-884.485) (-883.401) -- 0:00:57
17500 -- (-892.912) (-884.933) [-893.557] (-888.562) * (-884.716) (-886.048) (-886.464) [-883.251] -- 0:00:56
18000 -- [-893.730] (-883.882) (-903.605) (-892.502) * (-884.442) (-886.231) (-885.864) [-883.585] -- 0:00:54
18500 -- [-896.379] (-885.044) (-896.346) (-896.981) * (-883.963) (-892.457) (-889.550) [-884.207] -- 0:00:53
19000 -- (-895.153) (-886.446) [-890.213] (-898.275) * (-883.725) (-884.491) [-885.784] (-886.150) -- 0:00:51
19500 -- [-891.592] (-891.670) (-893.999) (-889.277) * (-886.705) [-885.637] (-885.078) (-885.022) -- 0:00:50
20000 -- (-887.029) (-884.923) (-900.061) [-901.908] * (-885.521) (-884.536) (-883.746) [-884.468] -- 0:00:49
Average standard deviation of split frequencies: 0.051622
20500 -- (-892.302) (-885.539) [-891.308] (-897.984) * (-884.234) [-883.902] (-886.675) (-888.554) -- 0:00:47
21000 -- (-893.296) (-884.231) (-891.323) [-885.149] * (-885.244) (-886.485) [-883.796] (-884.744) -- 0:01:33
21500 -- [-895.265] (-884.731) (-894.760) (-885.728) * (-884.124) (-885.300) (-883.794) [-886.807] -- 0:01:31
22000 -- (-893.449) (-884.568) [-893.128] (-884.986) * [-884.496] (-885.984) (-887.246) (-885.829) -- 0:01:28
22500 -- (-897.658) [-884.741] (-899.821) (-885.435) * (-888.375) (-885.530) (-886.282) [-885.169] -- 0:01:26
23000 -- (-894.514) (-886.362) [-892.546] (-885.834) * [-887.810] (-885.246) (-886.900) (-884.598) -- 0:01:24
23500 -- [-889.935] (-887.319) (-893.381) (-885.659) * (-886.168) [-883.634] (-886.284) (-884.601) -- 0:01:23
24000 -- (-891.669) [-887.242] (-895.408) (-885.769) * [-885.885] (-888.754) (-889.029) (-884.652) -- 0:01:21
24500 -- (-890.419) (-889.030) (-891.478) [-884.308] * (-888.965) (-884.332) [-885.240] (-883.114) -- 0:01:19
25000 -- (-894.015) (-884.566) [-889.675] (-890.934) * [-887.283] (-885.631) (-885.825) (-884.161) -- 0:01:18
Average standard deviation of split frequencies: 0.043169
25500 -- [-890.908] (-885.353) (-902.680) (-882.777) * (-883.505) (-886.707) [-885.777] (-884.056) -- 0:01:16
26000 -- [-895.813] (-886.275) (-900.512) (-884.271) * (-883.870) (-887.032) (-886.761) [-884.723] -- 0:01:14
26500 -- (-892.679) [-885.159] (-904.676) (-883.756) * [-884.775] (-884.538) (-890.151) (-885.022) -- 0:01:13
27000 -- [-890.656] (-884.526) (-897.555) (-885.147) * (-887.853) [-884.263] (-885.854) (-884.733) -- 0:01:12
27500 -- (-894.287) (-884.283) [-890.044] (-884.017) * (-885.198) (-886.472) [-885.555] (-886.853) -- 0:01:10
28000 -- [-897.939] (-885.786) (-902.963) (-883.700) * (-885.340) (-886.358) [-883.450] (-885.988) -- 0:01:09
28500 -- (-900.209) (-886.380) (-889.031) [-886.733] * (-885.892) [-886.282] (-885.334) (-884.073) -- 0:01:08
29000 -- (-894.328) (-885.227) [-887.021] (-885.104) * (-883.561) (-885.425) [-884.256] (-885.515) -- 0:01:06
29500 -- (-891.166) [-887.161] (-884.064) (-883.803) * (-883.691) [-883.505] (-882.998) (-886.632) -- 0:01:05
30000 -- [-888.537] (-885.340) (-884.678) (-883.954) * (-883.714) (-884.234) [-883.451] (-885.145) -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- [-897.891] (-886.034) (-884.368) (-884.110) * [-885.717] (-888.348) (-883.896) (-886.476) -- 0:01:03
31000 -- (-889.170) (-886.058) (-884.316) [-884.381] * (-885.159) (-883.806) (-885.217) [-886.781] -- 0:01:02
31500 -- (-891.090) (-886.238) [-884.894] (-886.086) * (-886.121) (-883.699) (-888.950) [-883.723] -- 0:01:01
32000 -- (-896.023) (-885.113) [-886.511] (-885.727) * (-889.007) [-882.985] (-884.006) (-887.955) -- 0:01:00
32500 -- (-894.166) (-885.879) (-887.267) [-885.726] * (-886.729) [-884.571] (-883.620) (-884.268) -- 0:00:59
33000 -- (-889.617) [-884.383] (-887.357) (-884.649) * (-885.316) (-883.104) (-885.721) [-883.859] -- 0:00:58
33500 -- [-891.298] (-885.156) (-889.868) (-885.725) * (-885.364) [-882.988] (-885.059) (-883.645) -- 0:00:57
34000 -- (-891.816) [-886.033] (-884.697) (-884.899) * [-886.518] (-887.200) (-885.256) (-887.798) -- 0:00:56
34500 -- [-893.277] (-885.231) (-884.914) (-883.554) * (-884.043) (-883.837) (-886.470) [-885.866] -- 0:00:55
35000 -- (-899.102) (-884.340) (-884.513) [-884.221] * (-885.597) (-884.842) (-885.516) [-884.037] -- 0:01:22
Average standard deviation of split frequencies: 0.042040
35500 -- (-900.538) [-887.888] (-883.886) (-884.196) * (-889.781) (-887.872) [-885.628] (-883.037) -- 0:01:21
36000 -- (-891.561) [-886.970] (-886.071) (-885.326) * (-887.477) (-884.934) (-885.508) [-884.705] -- 0:01:20
36500 -- [-892.529] (-883.914) (-883.739) (-887.311) * (-885.710) (-884.929) (-883.434) [-883.904] -- 0:01:19
37000 -- (-894.797) [-888.739] (-885.756) (-887.059) * (-884.353) (-884.452) (-885.227) [-883.260] -- 0:01:18
37500 -- (-889.181) (-883.903) [-886.216] (-883.797) * (-884.758) [-886.172] (-882.963) (-882.815) -- 0:01:17
38000 -- (-883.645) (-885.227) (-883.861) [-886.307] * (-888.154) [-886.733] (-884.657) (-882.862) -- 0:01:15
38500 -- [-884.412] (-883.379) (-882.962) (-884.235) * (-885.716) (-885.495) (-885.988) [-882.928] -- 0:01:14
39000 -- [-883.165] (-883.517) (-885.603) (-885.559) * (-883.706) (-883.420) [-885.547] (-883.571) -- 0:01:13
39500 -- (-885.191) (-886.751) (-884.859) [-886.761] * (-886.032) (-884.297) (-886.153) [-885.688] -- 0:01:12
40000 -- (-883.073) (-887.402) (-889.640) [-884.749] * (-887.939) (-885.006) [-887.595] (-884.492) -- 0:01:12
Average standard deviation of split frequencies: 0.028255
40500 -- [-884.560] (-884.191) (-885.098) (-882.984) * (-884.327) (-885.537) (-888.491) [-885.108] -- 0:01:11
41000 -- (-887.126) (-885.551) (-884.019) [-885.006] * (-886.435) (-886.047) [-883.485] (-882.949) -- 0:01:10
41500 -- (-884.314) [-885.526] (-885.668) (-884.885) * (-887.619) (-886.303) (-884.620) [-885.702] -- 0:01:09
42000 -- (-885.924) (-888.014) [-884.103] (-883.588) * (-885.592) [-884.840] (-882.842) (-883.040) -- 0:01:08
42500 -- (-885.659) (-884.777) [-888.200] (-886.187) * [-884.843] (-885.795) (-883.356) (-883.651) -- 0:01:07
43000 -- [-886.564] (-886.360) (-884.803) (-883.525) * (-884.229) [-883.182] (-884.432) (-885.650) -- 0:01:06
43500 -- (-883.864) (-885.261) (-886.226) [-884.065] * (-883.529) [-883.357] (-883.811) (-887.196) -- 0:01:05
44000 -- [-885.328] (-887.364) (-887.323) (-884.430) * (-886.470) (-884.897) [-884.971] (-884.552) -- 0:01:05
44500 -- (-882.813) [-886.188] (-887.000) (-883.985) * (-885.208) [-884.438] (-886.391) (-886.506) -- 0:01:04
45000 -- (-884.091) (-885.688) [-884.404] (-888.840) * [-885.350] (-883.088) (-885.006) (-886.229) -- 0:01:03
Average standard deviation of split frequencies: 0.029665
45500 -- (-883.775) (-885.800) [-887.375] (-889.602) * (-886.262) (-885.727) [-883.820] (-885.407) -- 0:01:02
46000 -- (-884.356) [-885.771] (-888.294) (-889.467) * [-886.329] (-885.874) (-883.792) (-884.332) -- 0:01:02
46500 -- (-885.049) [-883.528] (-887.189) (-883.832) * (-885.086) (-885.496) [-883.116] (-887.250) -- 0:01:01
47000 -- (-884.487) [-883.486] (-884.180) (-884.882) * (-883.907) (-884.949) (-889.714) [-889.488] -- 0:01:00
47500 -- (-885.610) [-884.491] (-885.363) (-884.712) * (-885.277) (-885.928) (-887.383) [-884.454] -- 0:01:00
48000 -- [-884.796] (-888.196) (-884.548) (-887.453) * (-888.427) (-883.318) (-885.663) [-884.463] -- 0:00:59
48500 -- (-884.986) (-889.046) (-883.846) [-884.614] * [-886.211] (-886.358) (-884.702) (-885.319) -- 0:00:58
49000 -- (-886.384) (-886.215) [-884.513] (-886.192) * [-884.354] (-883.188) (-883.537) (-885.851) -- 0:00:58
49500 -- (-885.796) [-883.878] (-888.876) (-885.295) * (-888.110) (-884.549) (-884.295) [-884.980] -- 0:01:16
50000 -- (-886.959) [-885.596] (-887.243) (-883.510) * (-888.178) (-882.667) [-884.589] (-884.617) -- 0:01:16
Average standard deviation of split frequencies: 0.032047
50500 -- (-885.538) [-884.996] (-885.143) (-884.922) * (-884.612) (-883.028) (-890.362) [-887.811] -- 0:01:15
51000 -- (-884.821) (-885.312) [-885.036] (-885.852) * (-883.610) (-886.394) [-889.631] (-888.200) -- 0:01:14
51500 -- (-886.602) (-883.070) (-884.026) [-886.324] * (-886.546) [-883.794] (-891.542) (-883.024) -- 0:01:13
52000 -- [-883.557] (-883.070) (-887.249) (-885.740) * (-885.165) (-884.468) (-884.557) [-884.451] -- 0:01:12
52500 -- [-885.637] (-885.115) (-885.965) (-884.549) * (-885.399) (-887.759) [-886.779] (-886.948) -- 0:01:12
53000 -- (-883.221) (-886.506) (-882.891) [-883.998] * (-884.986) (-885.918) [-887.264] (-886.420) -- 0:01:11
53500 -- (-883.585) (-886.278) [-884.487] (-887.726) * (-885.704) [-884.461] (-885.129) (-885.509) -- 0:01:10
54000 -- [-883.067] (-884.305) (-884.538) (-890.417) * (-884.311) [-882.772] (-886.355) (-885.331) -- 0:01:10
54500 -- (-884.234) [-883.651] (-887.036) (-887.241) * (-889.364) (-882.973) (-886.494) [-885.314] -- 0:01:09
55000 -- (-883.187) (-883.557) (-883.830) [-884.270] * (-890.097) [-883.214] (-883.156) (-883.298) -- 0:01:08
Average standard deviation of split frequencies: 0.035542
55500 -- (-889.254) (-890.119) (-884.360) [-884.935] * (-885.783) (-886.702) (-885.254) [-883.278] -- 0:01:08
56000 -- (-889.659) [-884.117] (-884.858) (-884.887) * [-884.986] (-890.885) (-883.800) (-885.453) -- 0:01:07
56500 -- (-893.204) (-887.011) (-886.154) [-885.331] * [-888.554] (-885.569) (-883.193) (-884.215) -- 0:01:06
57000 -- (-884.758) (-891.518) (-884.331) [-885.086] * (-887.275) [-887.399] (-883.393) (-886.920) -- 0:01:06
57500 -- [-883.447] (-884.375) (-887.195) (-885.485) * (-887.980) (-883.348) [-886.010] (-888.592) -- 0:01:05
58000 -- [-884.430] (-884.496) (-883.282) (-883.410) * (-885.181) (-885.364) (-886.055) [-885.122] -- 0:01:04
58500 -- (-885.749) [-884.696] (-884.752) (-883.633) * (-883.273) [-883.312] (-885.323) (-886.677) -- 0:01:04
59000 -- (-886.019) (-888.168) (-885.287) [-884.631] * (-883.616) (-885.021) (-886.545) [-885.782] -- 0:01:03
59500 -- (-886.067) (-886.487) (-884.909) [-883.259] * (-883.933) (-885.057) [-883.571] (-886.084) -- 0:01:03
60000 -- (-886.669) (-886.631) (-884.168) [-883.566] * (-887.249) (-883.586) (-894.015) [-882.962] -- 0:01:02
Average standard deviation of split frequencies: 0.031859
60500 -- (-884.178) (-888.513) (-884.957) [-883.615] * (-885.758) [-887.006] (-889.711) (-883.877) -- 0:01:02
61000 -- (-886.425) [-885.969] (-885.668) (-883.253) * (-884.327) [-884.875] (-887.829) (-887.129) -- 0:01:01
61500 -- (-886.702) (-888.336) (-883.265) [-886.143] * (-889.221) (-883.649) [-884.074] (-890.226) -- 0:01:01
62000 -- (-886.915) (-884.344) [-883.915] (-884.413) * (-884.452) (-883.165) (-884.360) [-888.804] -- 0:01:00
62500 -- [-886.367] (-884.203) (-884.878) (-884.913) * (-883.842) (-886.307) [-887.584] (-887.258) -- 0:01:00
63000 -- (-887.144) [-885.184] (-885.660) (-885.260) * [-884.460] (-886.481) (-884.917) (-885.625) -- 0:00:59
63500 -- (-887.697) [-885.774] (-883.608) (-886.247) * (-884.107) (-890.864) (-888.180) [-883.833] -- 0:01:13
64000 -- (-888.393) (-885.027) (-883.074) [-887.375] * (-883.341) (-885.355) (-883.633) [-883.196] -- 0:01:13
64500 -- (-883.624) [-885.242] (-883.553) (-883.759) * (-883.876) (-883.105) [-884.919] (-884.030) -- 0:01:12
65000 -- (-887.935) [-885.680] (-883.065) (-886.566) * (-886.597) (-883.176) (-886.826) [-883.932] -- 0:01:11
Average standard deviation of split frequencies: 0.029590
65500 -- (-883.479) [-885.415] (-887.390) (-884.231) * (-886.729) (-884.622) (-885.718) [-888.018] -- 0:01:11
66000 -- (-885.678) [-886.282] (-885.457) (-888.235) * [-884.214] (-887.693) (-884.709) (-883.661) -- 0:01:10
66500 -- (-885.464) [-886.383] (-885.194) (-883.290) * (-885.265) (-885.445) (-884.423) [-883.997] -- 0:01:10
67000 -- (-883.521) [-885.526] (-885.894) (-885.967) * (-884.350) [-882.801] (-883.454) (-884.082) -- 0:01:09
67500 -- [-883.260] (-885.603) (-884.263) (-887.369) * [-883.692] (-883.740) (-886.753) (-885.468) -- 0:01:09
68000 -- (-883.456) [-886.630] (-886.118) (-887.288) * [-882.771] (-884.920) (-886.143) (-885.811) -- 0:01:08
68500 -- (-883.659) (-887.988) (-884.393) [-885.919] * (-886.210) [-884.648] (-888.067) (-886.404) -- 0:01:07
69000 -- (-888.699) [-886.582] (-884.883) (-885.955) * (-885.702) (-882.754) (-886.679) [-884.152] -- 0:01:07
69500 -- (-890.085) (-884.365) (-885.259) [-887.649] * (-885.562) [-885.063] (-883.933) (-885.885) -- 0:01:06
70000 -- (-884.826) (-886.757) (-884.707) [-883.820] * (-889.638) (-883.771) [-883.916] (-885.202) -- 0:01:06
Average standard deviation of split frequencies: 0.029294
70500 -- (-883.630) (-884.863) (-888.144) [-883.830] * (-888.428) (-888.260) (-882.851) [-884.946] -- 0:01:05
71000 -- (-885.207) (-885.095) (-889.527) [-886.268] * [-887.911] (-883.820) (-885.358) (-887.017) -- 0:01:05
71500 -- (-886.975) [-884.860] (-883.200) (-884.596) * (-889.962) (-886.292) [-889.669] (-886.064) -- 0:01:04
72000 -- (-883.997) [-888.513] (-886.968) (-883.676) * (-891.162) [-887.853] (-887.984) (-889.055) -- 0:01:04
72500 -- (-883.164) [-884.737] (-883.526) (-883.009) * (-891.017) (-886.286) [-883.815] (-884.584) -- 0:01:03
73000 -- (-886.391) [-886.721] (-884.189) (-886.466) * (-889.307) (-886.524) (-883.436) [-883.219] -- 0:01:03
73500 -- [-888.053] (-883.724) (-884.628) (-885.469) * (-887.939) (-886.775) (-883.117) [-883.600] -- 0:01:03
74000 -- (-886.235) (-883.421) (-885.968) [-884.554] * (-886.128) (-887.544) [-885.254] (-885.839) -- 0:01:02
74500 -- (-885.637) (-883.664) (-888.182) [-884.691] * (-884.043) (-884.425) [-883.287] (-885.664) -- 0:01:02
75000 -- [-884.152] (-883.260) (-884.762) (-888.323) * (-884.054) [-884.165] (-885.191) (-889.805) -- 0:01:01
Average standard deviation of split frequencies: 0.027469
75500 -- (-888.308) [-883.836] (-887.259) (-887.385) * (-883.394) [-886.056] (-886.365) (-888.875) -- 0:01:01
76000 -- (-883.710) (-889.136) (-884.445) [-884.236] * (-884.356) (-885.485) [-884.034] (-891.716) -- 0:01:00
76500 -- (-885.434) [-885.164] (-888.226) (-885.060) * (-885.920) (-886.085) [-886.094] (-889.231) -- 0:01:00
77000 -- (-883.653) (-884.641) [-886.120] (-884.323) * (-885.587) (-886.845) (-891.256) [-885.551] -- 0:01:11
77500 -- (-884.329) [-883.745] (-885.202) (-883.759) * (-886.715) (-886.412) [-886.120] (-889.915) -- 0:01:11
78000 -- (-888.881) (-886.213) [-884.661] (-884.778) * (-886.094) (-885.651) [-884.458] (-886.610) -- 0:01:10
78500 -- (-885.578) (-885.478) [-883.654] (-885.408) * [-884.711] (-886.856) (-884.626) (-885.646) -- 0:01:10
79000 -- (-883.388) (-882.855) [-883.235] (-885.170) * (-887.145) (-885.122) (-886.756) [-884.154] -- 0:01:09
79500 -- (-889.561) [-884.523] (-883.948) (-885.768) * (-885.394) (-885.601) (-884.248) [-883.854] -- 0:01:09
80000 -- (-885.323) (-885.759) (-884.294) [-883.392] * [-885.339] (-882.965) (-884.532) (-885.665) -- 0:01:09
Average standard deviation of split frequencies: 0.027758
80500 -- (-887.327) (-886.048) (-884.443) [-887.886] * (-893.443) [-884.035] (-884.604) (-885.793) -- 0:01:08
81000 -- [-883.904] (-886.331) (-883.836) (-886.848) * [-882.961] (-883.284) (-883.906) (-885.150) -- 0:01:08
81500 -- [-886.267] (-890.313) (-897.830) (-883.161) * [-883.184] (-884.778) (-884.510) (-894.388) -- 0:01:07
82000 -- [-887.190] (-883.568) (-895.341) (-883.406) * (-886.363) [-884.330] (-886.477) (-888.037) -- 0:01:07
82500 -- [-884.449] (-886.440) (-883.582) (-888.915) * (-884.866) (-886.336) (-884.792) [-885.723] -- 0:01:06
83000 -- [-882.884] (-883.965) (-884.406) (-885.335) * (-885.854) (-884.130) [-884.105] (-883.606) -- 0:01:06
83500 -- (-883.973) (-885.478) (-884.671) [-888.791] * [-887.129] (-885.207) (-886.246) (-885.363) -- 0:01:05
84000 -- (-883.959) (-885.062) [-884.902] (-887.834) * [-885.953] (-884.964) (-884.158) (-883.439) -- 0:01:05
84500 -- (-883.881) [-883.842] (-885.169) (-893.720) * (-887.277) (-886.218) (-886.890) [-885.828] -- 0:01:05
85000 -- [-883.539] (-883.206) (-883.858) (-889.631) * (-890.751) [-883.932] (-886.039) (-885.671) -- 0:01:04
Average standard deviation of split frequencies: 0.025739
85500 -- [-883.776] (-885.361) (-884.196) (-884.345) * (-885.202) (-884.430) (-884.865) [-883.857] -- 0:01:04
86000 -- (-886.716) (-885.447) [-885.030] (-882.894) * (-890.999) (-885.318) [-885.559] (-885.867) -- 0:01:03
86500 -- [-884.419] (-884.440) (-887.757) (-885.262) * [-884.020] (-885.318) (-883.686) (-886.024) -- 0:01:03
87000 -- (-884.029) (-884.710) (-886.264) [-883.534] * (-885.447) [-884.410] (-882.889) (-888.519) -- 0:01:02
87500 -- (-883.436) [-884.768] (-889.421) (-884.225) * (-884.256) [-884.112] (-887.106) (-883.978) -- 0:01:02
88000 -- (-883.484) (-889.394) (-892.072) [-885.347] * (-886.017) (-884.908) (-886.193) [-883.668] -- 0:01:02
88500 -- (-884.612) (-892.105) (-886.215) [-889.861] * (-884.308) (-884.165) [-886.622] (-884.873) -- 0:01:01
89000 -- (-886.578) (-886.530) [-888.143] (-886.824) * (-884.627) (-883.441) [-885.760] (-883.318) -- 0:01:11
89500 -- [-883.748] (-884.540) (-893.999) (-884.173) * (-884.826) (-883.033) (-886.606) [-885.180] -- 0:01:11
90000 -- [-883.651] (-884.872) (-892.690) (-885.488) * (-883.400) [-883.819] (-888.365) (-884.960) -- 0:01:10
Average standard deviation of split frequencies: 0.028968
90500 -- (-884.042) [-885.542] (-884.322) (-886.541) * (-884.057) (-884.522) [-887.242] (-886.372) -- 0:01:10
91000 -- (-884.374) [-884.964] (-883.704) (-885.406) * (-884.944) (-883.217) (-883.330) [-887.327] -- 0:01:09
91500 -- (-883.969) (-886.686) [-883.795] (-887.037) * [-884.491] (-883.780) (-883.650) (-884.942) -- 0:01:09
92000 -- (-885.071) (-888.140) [-883.550] (-886.980) * (-884.276) (-883.785) (-883.024) [-885.542] -- 0:01:09
92500 -- [-885.046] (-884.865) (-883.686) (-886.773) * (-885.383) (-883.845) [-883.249] (-886.142) -- 0:01:08
93000 -- (-884.886) (-883.998) [-883.063] (-883.722) * (-886.455) [-884.398] (-884.540) (-885.670) -- 0:01:08
93500 -- (-884.465) [-883.989] (-883.783) (-884.159) * (-884.708) [-884.658] (-884.609) (-883.912) -- 0:01:07
94000 -- (-884.480) [-884.470] (-882.660) (-884.053) * [-887.558] (-884.875) (-885.118) (-887.507) -- 0:01:07
94500 -- (-885.080) (-884.204) [-882.878] (-885.553) * (-890.511) (-883.750) (-887.568) [-884.386] -- 0:01:07
95000 -- (-886.895) (-884.673) [-882.889] (-886.873) * [-885.775] (-887.307) (-885.122) (-886.253) -- 0:01:06
Average standard deviation of split frequencies: 0.032588
95500 -- (-885.188) (-883.880) (-883.103) [-884.707] * (-888.229) [-884.409] (-884.190) (-885.671) -- 0:01:06
96000 -- (-884.621) (-884.082) (-885.839) [-883.832] * (-885.368) [-886.377] (-885.098) (-885.271) -- 0:01:05
96500 -- (-890.572) (-882.755) [-883.215] (-883.127) * [-883.170] (-883.605) (-883.169) (-883.078) -- 0:01:05
97000 -- (-886.507) (-886.313) [-885.287] (-883.169) * [-883.850] (-885.545) (-885.068) (-884.937) -- 0:01:05
97500 -- [-886.066] (-883.361) (-885.475) (-885.150) * (-884.364) (-884.629) [-883.529] (-886.739) -- 0:01:04
98000 -- [-883.899] (-882.739) (-885.118) (-887.641) * [-884.361] (-882.853) (-883.900) (-886.351) -- 0:01:04
98500 -- (-884.080) (-884.115) (-886.615) [-885.087] * (-886.204) (-883.651) [-885.013] (-887.751) -- 0:01:04
99000 -- [-887.294] (-883.431) (-884.550) (-884.744) * (-884.659) (-882.980) [-886.233] (-883.994) -- 0:01:03
99500 -- (-884.811) (-883.570) [-884.924] (-887.005) * (-885.746) (-882.980) (-887.508) [-885.407] -- 0:01:03
100000 -- [-884.508] (-884.074) (-890.154) (-882.917) * [-885.102] (-883.916) (-887.126) (-885.497) -- 0:01:02
Average standard deviation of split frequencies: 0.032546
100500 -- (-883.626) [-885.577] (-888.351) (-887.237) * (-883.749) [-883.288] (-887.495) (-884.904) -- 0:01:02
101000 -- (-883.657) (-887.612) (-885.528) [-884.220] * (-889.093) [-882.917] (-886.168) (-885.808) -- 0:01:02
101500 -- (-883.494) [-883.169] (-885.630) (-889.269) * (-887.679) [-883.442] (-885.929) (-883.340) -- 0:01:01
102000 -- [-883.715] (-882.964) (-883.736) (-886.281) * (-885.519) [-886.683] (-884.363) (-885.061) -- 0:01:01
102500 -- (-884.495) [-888.244] (-883.265) (-884.122) * (-884.656) [-885.989] (-885.402) (-884.963) -- 0:01:10
103000 -- (-884.543) (-884.572) (-883.392) [-885.850] * [-885.930] (-882.680) (-887.599) (-892.197) -- 0:01:09
103500 -- (-885.699) (-886.755) (-885.664) [-885.328] * (-885.186) (-882.667) (-886.930) [-883.445] -- 0:01:09
104000 -- (-888.263) (-885.417) (-885.169) [-883.211] * (-885.511) (-882.747) (-884.002) [-884.410] -- 0:01:08
104500 -- (-890.154) (-886.448) [-884.964] (-884.382) * (-884.409) (-886.279) [-884.286] (-884.400) -- 0:01:08
105000 -- (-887.207) (-885.561) (-883.861) [-884.289] * (-884.776) (-885.747) [-884.024] (-883.686) -- 0:01:08
Average standard deviation of split frequencies: 0.031978
105500 -- (-884.194) (-884.165) (-883.738) [-884.989] * (-885.289) (-886.286) (-884.827) [-884.464] -- 0:01:07
106000 -- [-884.410] (-883.350) (-885.073) (-884.607) * (-883.902) (-888.210) (-884.695) [-883.702] -- 0:01:07
106500 -- (-889.576) (-883.217) (-888.839) [-884.376] * (-884.407) [-884.639] (-887.684) (-885.395) -- 0:01:07
107000 -- (-889.902) (-883.945) [-885.188] (-885.186) * (-885.880) (-887.099) (-886.349) [-884.492] -- 0:01:06
107500 -- [-886.548] (-884.357) (-885.849) (-884.326) * (-883.935) (-888.404) [-883.591] (-885.951) -- 0:01:06
108000 -- (-885.719) (-884.820) [-884.445] (-885.271) * [-885.393] (-889.375) (-883.527) (-882.814) -- 0:01:06
108500 -- [-885.828] (-885.533) (-885.110) (-887.075) * [-883.471] (-887.885) (-884.297) (-882.838) -- 0:01:05
109000 -- [-885.950] (-886.477) (-884.932) (-889.703) * (-884.800) (-887.772) (-885.212) [-885.266] -- 0:01:05
109500 -- [-883.758] (-884.845) (-882.985) (-883.674) * (-883.849) (-883.869) (-886.275) [-884.101] -- 0:01:05
110000 -- (-885.031) [-883.499] (-884.169) (-885.073) * (-885.582) [-883.518] (-883.924) (-888.069) -- 0:01:04
Average standard deviation of split frequencies: 0.030426
110500 -- (-888.935) (-883.850) (-884.859) [-887.188] * (-884.748) (-883.081) [-886.237] (-887.533) -- 0:01:04
111000 -- (-884.399) [-885.598] (-884.302) (-883.066) * (-886.100) (-883.397) (-884.829) [-885.516] -- 0:01:04
111500 -- (-886.974) (-884.791) [-883.760] (-883.137) * (-886.630) (-883.103) (-885.489) [-885.511] -- 0:01:03
112000 -- (-885.883) (-884.222) (-886.843) [-886.385] * (-885.490) (-884.925) (-885.308) [-887.665] -- 0:01:03
112500 -- (-884.797) (-884.023) [-885.938] (-883.022) * (-885.025) (-888.060) (-884.279) [-884.620] -- 0:01:03
113000 -- (-884.029) (-883.849) [-884.973] (-885.204) * (-886.031) (-886.370) [-884.240] (-885.344) -- 0:01:02
113500 -- (-887.045) (-883.548) [-885.942] (-886.494) * (-884.328) [-885.543] (-883.246) (-885.244) -- 0:01:02
114000 -- [-883.721] (-887.041) (-884.519) (-886.486) * (-886.816) [-884.625] (-883.148) (-885.232) -- 0:01:02
114500 -- (-887.000) [-884.379] (-884.049) (-887.987) * (-883.368) (-886.670) [-883.320] (-883.595) -- 0:01:01
115000 -- (-883.778) [-887.007] (-885.497) (-884.815) * (-887.385) [-883.525] (-884.264) (-883.560) -- 0:01:01
Average standard deviation of split frequencies: 0.029221
115500 -- [-883.354] (-885.526) (-885.245) (-883.810) * (-887.431) [-885.359] (-885.212) (-884.609) -- 0:01:01
116000 -- [-883.589] (-885.449) (-883.934) (-889.679) * (-883.951) [-885.082] (-885.937) (-884.130) -- 0:01:00
116500 -- (-884.308) (-889.436) [-883.687] (-890.335) * (-885.570) [-883.252] (-886.793) (-889.960) -- 0:01:08
117000 -- (-883.075) (-887.336) [-883.594] (-886.344) * (-886.549) (-883.539) [-885.342] (-883.700) -- 0:01:07
117500 -- (-885.226) [-884.456] (-885.359) (-886.784) * (-889.317) (-883.326) (-887.078) [-884.834] -- 0:01:07
118000 -- (-888.244) (-885.421) [-887.828] (-891.650) * [-883.199] (-883.405) (-887.848) (-883.420) -- 0:01:07
118500 -- (-887.229) (-886.377) [-885.721] (-887.871) * (-883.925) [-886.516] (-885.521) (-883.935) -- 0:01:06
119000 -- (-885.585) [-886.323] (-883.937) (-886.288) * (-883.529) (-885.870) [-886.051] (-885.369) -- 0:01:06
119500 -- [-890.773] (-885.469) (-886.561) (-883.516) * (-883.910) (-884.241) [-885.492] (-885.157) -- 0:01:06
120000 -- [-885.451] (-885.723) (-886.987) (-885.446) * (-884.616) (-885.602) [-883.431] (-886.733) -- 0:01:06
Average standard deviation of split frequencies: 0.028835
120500 -- (-886.178) (-885.132) [-885.970] (-884.292) * [-884.734] (-886.290) (-884.038) (-890.600) -- 0:01:05
121000 -- (-886.452) (-885.043) [-886.217] (-886.046) * [-883.514] (-885.345) (-883.184) (-884.778) -- 0:01:05
121500 -- (-886.492) [-884.093] (-884.163) (-886.082) * [-884.810] (-889.742) (-884.180) (-888.466) -- 0:01:05
122000 -- (-889.614) (-884.287) [-886.201] (-885.859) * (-886.092) (-890.501) (-884.823) [-887.775] -- 0:01:04
122500 -- (-887.045) (-886.180) [-886.345] (-889.010) * (-884.611) [-884.142] (-885.289) (-884.604) -- 0:01:04
123000 -- (-887.266) (-883.660) [-882.893] (-888.516) * (-888.574) (-883.205) (-885.432) [-887.031] -- 0:01:04
123500 -- [-883.379] (-884.256) (-884.312) (-886.531) * (-885.076) [-882.946] (-885.159) (-885.821) -- 0:01:03
124000 -- [-885.755] (-886.189) (-884.193) (-885.259) * (-883.204) (-883.341) (-884.850) [-883.023] -- 0:01:03
124500 -- (-883.540) [-884.831] (-885.286) (-884.984) * (-885.792) (-883.267) (-885.560) [-884.182] -- 0:01:03
125000 -- [-887.250] (-885.362) (-889.291) (-885.608) * (-886.787) (-885.165) (-885.401) [-886.242] -- 0:01:03
Average standard deviation of split frequencies: 0.030643
125500 -- [-888.486] (-884.533) (-887.227) (-885.968) * (-884.195) [-885.560] (-885.021) (-885.529) -- 0:01:02
126000 -- (-885.147) [-884.046] (-885.505) (-889.251) * (-884.837) (-886.583) [-886.146] (-886.443) -- 0:01:02
126500 -- [-885.181] (-884.309) (-885.948) (-886.830) * [-886.125] (-883.609) (-883.929) (-885.819) -- 0:01:02
127000 -- (-883.210) [-884.076] (-883.923) (-886.095) * (-889.080) [-883.461] (-883.761) (-887.213) -- 0:01:01
127500 -- (-884.992) [-886.562] (-887.042) (-883.896) * [-883.015] (-883.281) (-883.649) (-887.044) -- 0:01:01
128000 -- [-884.377] (-887.025) (-885.284) (-886.405) * (-883.807) (-887.950) (-885.663) [-884.746] -- 0:01:01
128500 -- (-883.293) (-886.491) [-883.359] (-884.087) * (-885.648) (-886.894) (-884.175) [-883.931] -- 0:01:01
129000 -- [-886.542] (-883.354) (-883.371) (-883.107) * (-885.271) [-885.169] (-884.922) (-883.009) -- 0:01:00
129500 -- [-884.847] (-886.176) (-882.900) (-884.411) * (-890.396) (-885.084) [-883.662] (-885.117) -- 0:01:00
130000 -- (-884.852) (-888.809) [-882.820] (-884.288) * (-885.727) [-886.808] (-886.448) (-886.134) -- 0:01:00
Average standard deviation of split frequencies: 0.030579
130500 -- (-885.981) [-883.107] (-886.254) (-883.956) * (-884.143) (-885.444) [-885.963] (-883.760) -- 0:01:06
131000 -- (-883.401) (-885.741) [-884.903] (-884.064) * [-886.184] (-883.508) (-885.275) (-884.040) -- 0:01:06
131500 -- (-884.192) (-886.996) [-886.326] (-891.875) * (-885.652) [-883.759] (-891.578) (-885.296) -- 0:01:06
132000 -- (-882.862) [-885.462] (-887.383) (-888.416) * (-885.107) (-886.006) [-886.214] (-883.428) -- 0:01:05
132500 -- (-888.640) (-888.123) [-885.091] (-883.694) * (-885.727) (-886.670) (-887.253) [-882.949] -- 0:01:05
133000 -- (-885.915) (-884.312) (-885.092) [-883.191] * [-885.424] (-884.303) (-884.721) (-884.368) -- 0:01:05
133500 -- (-888.179) (-883.767) [-885.239] (-884.654) * (-885.350) [-883.537] (-882.918) (-885.198) -- 0:01:04
134000 -- (-890.115) (-882.986) (-884.692) [-885.281] * (-885.732) (-884.589) [-884.287] (-884.489) -- 0:01:04
134500 -- (-886.382) [-883.858] (-886.645) (-883.081) * (-883.205) [-884.836] (-887.073) (-884.037) -- 0:01:04
135000 -- (-886.262) (-887.460) (-886.996) [-883.320] * [-886.251] (-884.788) (-883.868) (-887.092) -- 0:01:04
Average standard deviation of split frequencies: 0.029215
135500 -- (-884.496) (-885.017) [-885.800] (-885.571) * (-886.559) [-883.087] (-885.955) (-886.032) -- 0:01:03
136000 -- (-884.566) (-883.838) [-885.038] (-885.620) * [-885.020] (-885.283) (-887.103) (-888.209) -- 0:01:03
136500 -- (-884.154) [-885.724] (-886.519) (-887.463) * (-884.900) (-884.483) [-885.227] (-888.470) -- 0:01:03
137000 -- (-886.525) [-885.108] (-884.469) (-884.231) * (-882.918) (-885.321) (-886.268) [-889.102] -- 0:01:02
137500 -- [-883.856] (-885.679) (-883.740) (-886.476) * (-883.953) [-883.103] (-884.575) (-887.076) -- 0:01:02
138000 -- [-883.646] (-884.401) (-886.271) (-885.855) * (-886.635) (-891.494) [-883.721] (-887.475) -- 0:01:02
138500 -- (-883.405) [-888.604] (-883.782) (-888.269) * (-884.538) [-888.711] (-886.423) (-885.448) -- 0:01:02
139000 -- (-884.039) (-887.031) [-884.669] (-896.044) * (-888.756) (-886.612) (-885.441) [-883.730] -- 0:01:01
139500 -- [-886.225] (-885.178) (-885.562) (-888.478) * (-886.990) [-883.587] (-883.700) (-884.977) -- 0:01:01
140000 -- (-885.139) (-886.731) (-883.898) [-885.205] * (-884.522) [-885.396] (-883.530) (-893.975) -- 0:01:01
Average standard deviation of split frequencies: 0.027648
140500 -- [-885.546] (-886.061) (-884.597) (-884.094) * [-883.580] (-884.781) (-884.860) (-886.376) -- 0:01:01
141000 -- (-883.960) [-890.080] (-883.691) (-886.509) * (-885.085) (-888.018) (-884.594) [-883.037] -- 0:01:00
141500 -- (-884.297) [-882.812] (-886.024) (-886.967) * (-886.284) (-886.414) (-883.535) [-884.314] -- 0:01:00
142000 -- (-883.174) (-885.316) [-888.652] (-884.287) * (-883.932) (-886.477) [-886.122] (-885.159) -- 0:01:00
142500 -- (-884.640) (-888.914) (-883.722) [-888.312] * (-885.919) (-883.562) [-884.266] (-885.211) -- 0:01:00
143000 -- (-883.352) [-883.449] (-885.636) (-883.763) * [-886.335] (-886.126) (-883.505) (-886.070) -- 0:00:59
143500 -- [-885.034] (-884.347) (-887.389) (-883.288) * (-883.190) [-883.371] (-884.922) (-890.831) -- 0:00:59
144000 -- (-888.810) [-883.665] (-892.235) (-887.462) * (-882.935) [-883.836] (-884.263) (-887.693) -- 0:00:59
144500 -- (-885.123) (-885.812) [-884.395] (-883.312) * (-883.110) (-883.479) (-883.721) [-886.813] -- 0:01:05
145000 -- (-884.562) (-894.062) (-884.365) [-885.505] * (-884.655) (-886.380) [-883.453] (-883.341) -- 0:01:04
Average standard deviation of split frequencies: 0.028032
145500 -- (-883.839) (-884.136) (-884.226) [-883.895] * (-886.270) [-884.544] (-883.818) (-883.426) -- 0:01:04
146000 -- [-883.470] (-884.959) (-883.984) (-884.768) * (-886.088) [-887.590] (-886.567) (-883.047) -- 0:01:04
146500 -- (-883.433) (-884.747) (-888.221) [-884.822] * (-887.927) (-884.377) (-887.751) [-883.593] -- 0:01:04
147000 -- (-885.115) (-883.153) (-885.190) [-888.755] * (-882.730) (-886.053) [-890.584] (-886.215) -- 0:01:03
147500 -- (-884.566) [-885.854] (-883.469) (-883.579) * [-883.544] (-885.791) (-884.533) (-884.368) -- 0:01:03
148000 -- (-885.122) (-883.641) [-887.058] (-884.847) * (-886.700) (-886.221) (-884.737) [-884.641] -- 0:01:03
148500 -- [-883.894] (-883.903) (-883.573) (-886.089) * (-885.499) (-883.953) (-883.852) [-884.933] -- 0:01:03
149000 -- (-884.494) [-884.221] (-884.546) (-889.379) * (-883.468) [-884.301] (-885.824) (-886.887) -- 0:01:02
149500 -- [-884.443] (-883.962) (-884.033) (-886.708) * (-883.420) (-886.108) (-883.059) [-884.502] -- 0:01:02
150000 -- (-884.483) [-886.348] (-884.629) (-888.634) * [-884.429] (-883.759) (-884.254) (-890.886) -- 0:01:02
Average standard deviation of split frequencies: 0.026967
150500 -- (-884.010) (-886.272) (-887.084) [-886.776] * (-884.428) (-885.555) (-883.982) [-885.751] -- 0:01:02
151000 -- [-884.206] (-883.035) (-884.980) (-887.449) * (-884.455) (-885.258) (-884.034) [-883.472] -- 0:01:01
151500 -- [-883.813] (-884.457) (-885.558) (-884.261) * (-885.317) [-885.535] (-882.860) (-886.486) -- 0:01:01
152000 -- (-885.134) (-883.096) (-885.251) [-883.564] * (-884.454) (-887.641) (-887.439) [-884.334] -- 0:01:01
152500 -- (-888.504) [-882.825] (-884.865) (-885.223) * (-883.405) [-886.612] (-883.676) (-883.745) -- 0:01:01
153000 -- [-892.725] (-885.131) (-885.416) (-884.303) * (-883.581) (-883.378) [-883.618] (-883.497) -- 0:01:00
153500 -- (-885.491) [-885.131] (-888.091) (-884.944) * (-883.793) [-885.821] (-885.964) (-885.627) -- 0:01:00
154000 -- (-884.586) (-886.258) [-890.023] (-886.387) * (-883.991) (-885.730) [-883.327] (-888.825) -- 0:01:00
154500 -- (-886.372) (-883.861) [-884.788] (-887.706) * [-883.482] (-884.780) (-889.776) (-886.755) -- 0:01:00
155000 -- [-886.321] (-886.664) (-884.788) (-887.961) * (-884.808) (-884.883) (-886.980) [-884.830] -- 0:00:59
Average standard deviation of split frequencies: 0.026333
155500 -- (-884.364) [-882.975] (-885.308) (-888.836) * (-882.682) (-883.704) (-883.634) [-883.700] -- 0:00:59
156000 -- (-883.445) [-884.274] (-886.390) (-885.243) * (-884.465) [-885.153] (-885.090) (-883.470) -- 0:00:59
156500 -- (-883.511) (-889.064) (-887.725) [-883.647] * [-884.601] (-884.782) (-883.651) (-885.526) -- 0:00:59
157000 -- (-884.386) (-883.154) [-884.060] (-886.705) * [-883.342] (-887.613) (-883.388) (-886.429) -- 0:00:59
157500 -- (-883.588) (-883.380) (-886.038) [-884.703] * (-884.754) (-888.304) (-884.626) [-885.748] -- 0:00:58
158000 -- (-884.280) (-884.689) (-884.939) [-886.620] * (-884.329) [-885.949] (-884.957) (-887.668) -- 0:01:03
158500 -- (-887.328) (-886.379) [-883.935] (-883.029) * (-884.530) [-885.910] (-886.573) (-887.434) -- 0:01:03
159000 -- (-887.843) (-887.441) (-886.945) [-883.590] * [-891.555] (-885.371) (-884.195) (-885.145) -- 0:01:03
159500 -- (-885.455) [-884.986] (-886.434) (-884.878) * (-886.878) (-884.519) (-882.623) [-884.152] -- 0:01:03
160000 -- (-884.111) (-884.271) [-882.814] (-883.906) * (-887.642) (-890.527) [-886.853] (-884.544) -- 0:01:02
Average standard deviation of split frequencies: 0.022634
160500 -- (-884.051) (-885.145) (-883.685) [-884.493] * (-883.000) (-892.997) (-883.801) [-886.022] -- 0:01:02
161000 -- (-887.887) [-885.862] (-883.058) (-884.477) * [-884.099] (-886.318) (-885.385) (-884.543) -- 0:01:02
161500 -- (-888.610) [-884.027] (-884.103) (-885.535) * (-885.552) [-883.901] (-883.733) (-885.135) -- 0:01:02
162000 -- [-889.317] (-884.946) (-884.519) (-883.713) * [-887.011] (-884.782) (-884.746) (-882.708) -- 0:01:02
162500 -- (-889.732) [-885.363] (-885.418) (-883.489) * (-886.747) (-882.684) (-885.358) [-883.426] -- 0:01:01
163000 -- (-884.706) (-883.080) [-884.023] (-885.177) * (-885.591) (-883.449) [-888.148] (-883.671) -- 0:01:01
163500 -- (-885.631) (-883.103) [-884.060] (-885.581) * (-885.369) [-883.747] (-886.620) (-883.357) -- 0:01:01
164000 -- (-883.447) (-882.940) (-884.314) [-887.875] * (-883.525) (-885.932) [-885.253] (-883.610) -- 0:01:01
164500 -- (-884.007) (-884.062) (-884.477) [-892.702] * (-883.129) (-886.232) (-884.881) [-884.307] -- 0:01:00
165000 -- (-887.976) (-887.551) [-884.797] (-885.434) * (-885.196) (-886.530) (-883.526) [-885.386] -- 0:01:00
Average standard deviation of split frequencies: 0.022177
165500 -- (-883.983) (-887.301) [-884.162] (-884.898) * (-884.619) [-888.474] (-884.489) (-885.245) -- 0:01:00
166000 -- [-886.851] (-887.477) (-888.855) (-887.550) * (-886.988) (-883.932) (-883.777) [-885.409] -- 0:01:00
166500 -- (-885.496) (-883.803) [-886.244] (-886.265) * (-886.040) (-884.715) (-883.430) [-883.640] -- 0:01:00
167000 -- (-884.903) (-883.877) [-884.827] (-887.419) * (-883.846) (-884.364) [-885.196] (-886.873) -- 0:00:59
167500 -- (-884.407) (-887.739) [-885.485] (-885.611) * (-887.219) (-884.041) (-885.080) [-884.906] -- 0:00:59
168000 -- (-884.805) [-885.957] (-886.597) (-884.844) * (-884.056) (-887.310) [-884.629] (-885.588) -- 0:00:59
168500 -- [-885.198] (-883.136) (-887.534) (-882.883) * (-885.127) [-884.394] (-884.143) (-883.638) -- 0:00:59
169000 -- (-887.269) (-883.605) (-885.581) [-885.650] * (-883.485) (-884.675) (-883.562) [-884.377] -- 0:00:59
169500 -- (-885.434) [-885.227] (-887.150) (-883.320) * (-883.230) [-885.422] (-884.358) (-884.336) -- 0:00:58
170000 -- (-883.692) [-886.512] (-884.197) (-884.594) * [-886.968] (-883.964) (-886.800) (-884.259) -- 0:00:58
Average standard deviation of split frequencies: 0.019887
170500 -- (-884.162) [-883.148] (-885.464) (-884.195) * [-887.514] (-883.235) (-892.040) (-884.325) -- 0:00:58
171000 -- (-884.389) [-885.024] (-885.418) (-886.629) * (-889.406) [-883.346] (-887.799) (-884.711) -- 0:00:58
171500 -- (-885.908) (-884.162) (-886.274) [-883.684] * (-885.577) (-883.296) [-890.711] (-885.244) -- 0:00:57
172000 -- (-890.267) [-883.690] (-884.127) (-884.498) * (-885.926) (-883.423) (-888.983) [-887.856] -- 0:01:02
172500 -- [-886.506] (-885.080) (-884.388) (-884.982) * (-885.378) (-883.722) [-885.144] (-884.611) -- 0:01:02
173000 -- (-884.347) [-884.031] (-888.645) (-883.429) * (-883.839) (-883.912) (-886.687) [-886.342] -- 0:01:02
173500 -- (-884.906) (-883.479) (-885.053) [-887.017] * (-883.391) (-885.081) (-887.115) [-886.572] -- 0:01:01
174000 -- (-885.199) (-886.885) (-883.849) [-886.901] * (-886.345) (-890.119) [-884.558] (-884.619) -- 0:01:01
174500 -- (-883.597) (-885.455) [-885.674] (-883.686) * (-885.104) (-886.242) (-885.794) [-884.594] -- 0:01:01
175000 -- (-885.925) (-886.336) [-886.125] (-884.670) * (-888.458) [-884.805] (-887.769) (-886.178) -- 0:01:01
Average standard deviation of split frequencies: 0.021287
175500 -- (-885.102) [-884.315] (-884.712) (-882.989) * (-886.841) (-884.472) [-885.703] (-886.984) -- 0:01:01
176000 -- (-892.972) [-883.617] (-884.938) (-887.118) * (-885.928) [-885.718] (-886.602) (-886.120) -- 0:01:00
176500 -- (-882.734) (-885.004) (-886.800) [-886.712] * [-885.398] (-883.269) (-887.632) (-885.380) -- 0:01:00
177000 -- (-883.420) [-883.490] (-886.888) (-884.664) * (-886.160) [-883.171] (-886.739) (-884.688) -- 0:01:00
177500 -- (-884.447) [-885.199] (-888.042) (-885.127) * (-884.497) [-886.166] (-891.536) (-883.323) -- 0:01:00
178000 -- (-884.165) (-886.560) (-892.525) [-885.644] * (-884.489) [-883.700] (-885.388) (-885.047) -- 0:01:00
178500 -- (-884.265) (-884.279) (-887.640) [-885.299] * (-883.296) (-883.430) (-884.828) [-883.962] -- 0:00:59
179000 -- (-883.835) (-887.788) [-887.814] (-883.818) * (-885.567) [-886.253] (-887.036) (-883.499) -- 0:00:59
179500 -- (-882.857) (-886.524) [-883.380] (-887.336) * (-883.884) (-885.367) (-888.299) [-885.358] -- 0:00:59
180000 -- [-884.745] (-888.709) (-886.310) (-885.853) * [-883.383] (-883.429) (-888.063) (-885.140) -- 0:00:59
Average standard deviation of split frequencies: 0.021164
180500 -- [-883.183] (-883.864) (-885.363) (-884.952) * (-883.020) (-888.462) (-890.146) [-885.800] -- 0:00:59
181000 -- (-884.972) (-885.765) [-885.364] (-889.232) * (-884.562) (-889.397) (-886.501) [-883.869] -- 0:00:58
181500 -- (-884.041) [-885.155] (-883.223) (-887.574) * (-883.471) (-885.232) [-885.763] (-884.164) -- 0:00:58
182000 -- (-885.221) (-885.836) [-883.225] (-886.802) * [-885.119] (-883.669) (-884.131) (-885.856) -- 0:00:58
182500 -- (-886.095) (-885.197) (-886.221) [-884.341] * (-884.624) [-884.763] (-884.189) (-885.507) -- 0:00:58
183000 -- (-886.352) (-884.956) (-884.610) [-885.049] * (-888.306) (-890.830) [-886.004] (-886.316) -- 0:00:58
183500 -- [-884.219] (-885.643) (-884.616) (-884.170) * (-885.665) (-883.889) [-884.777] (-886.353) -- 0:00:57
184000 -- (-883.732) [-883.420] (-885.758) (-884.942) * (-885.027) (-883.128) [-885.805] (-884.540) -- 0:00:57
184500 -- [-884.990] (-885.598) (-883.580) (-883.361) * [-883.382] (-887.032) (-884.903) (-888.198) -- 0:00:57
185000 -- (-884.081) (-882.768) (-886.926) [-886.023] * (-888.011) (-888.984) (-889.323) [-885.486] -- 0:00:57
Average standard deviation of split frequencies: 0.018882
185500 -- (-887.119) (-883.685) [-885.105] (-885.244) * [-883.622] (-886.064) (-885.408) (-886.089) -- 0:00:57
186000 -- (-886.423) (-885.547) [-884.464] (-884.479) * (-887.538) [-883.482] (-885.654) (-886.237) -- 0:01:01
186500 -- [-885.090] (-883.193) (-887.792) (-884.732) * (-888.422) (-885.580) [-885.478] (-885.745) -- 0:01:01
187000 -- (-886.572) (-882.608) (-884.547) [-884.105] * (-887.516) (-883.172) (-884.631) [-883.083] -- 0:01:00
187500 -- (-883.954) [-884.383] (-883.567) (-888.120) * (-885.895) (-884.485) (-883.658) [-885.193] -- 0:01:00
188000 -- [-883.239] (-883.039) (-885.904) (-890.527) * (-884.368) (-885.201) (-885.021) [-884.741] -- 0:01:00
188500 -- (-884.080) (-887.196) [-886.152] (-889.758) * (-887.105) (-883.737) (-885.912) [-888.070] -- 0:01:00
189000 -- [-885.214] (-884.523) (-885.397) (-890.424) * (-885.366) (-886.875) [-887.287] (-885.589) -- 0:01:00
189500 -- (-884.521) (-884.256) [-885.496] (-886.585) * (-882.987) [-887.011] (-886.055) (-885.691) -- 0:00:59
190000 -- (-883.096) [-888.131] (-885.386) (-887.974) * [-888.603] (-884.311) (-886.514) (-885.581) -- 0:00:59
Average standard deviation of split frequencies: 0.018348
190500 -- (-884.102) [-884.707] (-885.566) (-888.796) * [-886.942] (-883.819) (-885.843) (-888.245) -- 0:00:59
191000 -- (-884.700) (-886.843) (-884.884) [-886.433] * (-887.679) (-884.204) [-885.020] (-885.304) -- 0:00:59
191500 -- (-884.270) [-886.289] (-889.219) (-886.839) * (-884.161) (-883.735) [-883.141] (-885.460) -- 0:00:59
192000 -- (-889.067) [-883.982] (-888.779) (-885.513) * (-885.953) (-883.639) [-883.718] (-885.178) -- 0:00:58
192500 -- (-888.421) [-885.110] (-885.491) (-885.871) * (-884.410) (-884.326) [-886.137] (-885.014) -- 0:00:58
193000 -- (-885.364) (-884.018) [-883.051] (-886.880) * (-885.569) (-884.368) [-882.903] (-888.977) -- 0:00:58
193500 -- (-889.332) [-883.358] (-885.161) (-884.907) * (-884.904) (-884.454) (-883.951) [-886.452] -- 0:00:58
194000 -- (-888.944) [-883.347] (-887.980) (-883.859) * (-890.116) [-884.069] (-887.210) (-883.265) -- 0:00:58
194500 -- [-886.552] (-883.852) (-883.392) (-888.376) * (-885.249) (-887.359) (-886.332) [-884.166] -- 0:00:57
195000 -- (-888.498) [-884.743] (-883.585) (-885.622) * (-884.407) (-885.585) [-886.055] (-886.006) -- 0:00:57
Average standard deviation of split frequencies: 0.018608
195500 -- (-891.583) [-884.785] (-883.704) (-886.665) * [-886.107] (-890.024) (-884.346) (-885.307) -- 0:00:57
196000 -- (-884.636) (-883.950) [-884.681] (-887.308) * (-887.063) (-888.494) (-884.438) [-885.561] -- 0:00:57
196500 -- (-884.479) (-888.436) [-884.668] (-888.017) * (-891.125) (-884.140) (-883.728) [-884.086] -- 0:00:57
197000 -- (-890.282) (-885.174) [-883.859] (-886.484) * (-888.878) [-885.661] (-883.430) (-885.355) -- 0:00:57
197500 -- (-885.799) (-887.324) [-886.237] (-884.854) * (-888.047) (-889.333) [-884.030] (-885.643) -- 0:00:56
198000 -- (-885.491) (-884.797) [-885.695] (-884.017) * (-884.992) [-886.065] (-886.808) (-887.129) -- 0:00:56
198500 -- (-885.001) (-885.349) [-888.835] (-883.129) * (-884.552) (-883.451) (-884.013) [-884.389] -- 0:00:56
199000 -- (-884.572) (-885.618) [-886.349] (-895.618) * (-885.641) (-886.183) (-883.582) [-883.123] -- 0:00:56
199500 -- [-884.460] (-886.350) (-884.878) (-889.496) * (-885.172) (-883.619) [-883.436] (-884.675) -- 0:01:00
200000 -- (-885.554) [-884.639] (-885.830) (-885.307) * (-885.095) (-883.678) (-885.208) [-884.992] -- 0:00:59
Average standard deviation of split frequencies: 0.018299
200500 -- (-884.852) (-884.340) (-884.289) [-885.802] * [-884.521] (-883.425) (-886.335) (-884.463) -- 0:00:59
201000 -- (-885.513) [-890.637] (-884.519) (-886.617) * [-884.954] (-884.265) (-885.815) (-884.794) -- 0:00:59
201500 -- (-885.869) (-890.623) [-884.305] (-889.130) * [-883.394] (-886.645) (-884.465) (-890.460) -- 0:00:59
202000 -- (-888.719) (-888.772) [-885.538] (-886.654) * (-882.952) (-884.918) [-883.070] (-888.203) -- 0:00:59
202500 -- (-883.807) (-885.138) (-882.738) [-884.894] * (-888.387) [-885.995] (-883.328) (-886.832) -- 0:00:59
203000 -- (-883.749) [-885.978] (-883.179) (-883.207) * (-890.429) (-886.871) (-884.756) [-889.136] -- 0:00:58
203500 -- (-883.648) (-885.475) [-885.127] (-883.306) * (-887.434) (-884.004) [-884.271] (-885.322) -- 0:00:58
204000 -- (-882.956) (-886.313) (-884.935) [-883.853] * [-884.308] (-884.027) (-884.172) (-884.320) -- 0:00:58
204500 -- (-883.016) (-884.690) (-885.001) [-883.309] * [-883.099] (-885.614) (-883.924) (-882.786) -- 0:00:58
205000 -- [-886.222] (-886.111) (-884.983) (-884.765) * [-883.674] (-889.216) (-884.284) (-884.025) -- 0:00:58
Average standard deviation of split frequencies: 0.016133
205500 -- (-886.832) [-884.394] (-883.401) (-883.126) * [-883.237] (-884.388) (-884.776) (-885.470) -- 0:00:57
206000 -- (-885.570) [-883.428] (-883.641) (-885.520) * (-883.103) (-883.825) [-884.607] (-885.788) -- 0:00:57
206500 -- [-883.005] (-885.960) (-883.600) (-885.080) * (-882.856) (-884.571) [-884.316] (-886.119) -- 0:00:57
207000 -- (-884.021) (-889.643) [-883.128] (-885.160) * (-888.781) (-886.499) (-888.863) [-887.846] -- 0:00:57
207500 -- (-886.627) (-887.960) (-885.275) [-884.459] * (-882.871) [-885.085] (-887.866) (-886.031) -- 0:00:57
208000 -- (-885.179) [-887.268] (-883.623) (-883.561) * [-884.441] (-885.589) (-883.920) (-885.856) -- 0:00:57
208500 -- (-884.766) (-886.760) (-882.693) [-883.434] * (-883.683) [-886.162] (-883.571) (-884.484) -- 0:00:56
209000 -- [-883.788] (-887.878) (-886.647) (-886.007) * (-884.717) [-883.856] (-885.734) (-889.512) -- 0:00:56
209500 -- (-884.476) (-888.682) [-884.808] (-885.292) * (-885.267) (-883.943) (-885.006) [-885.640] -- 0:00:56
210000 -- [-885.091] (-887.888) (-885.629) (-886.784) * [-886.855] (-883.334) (-884.252) (-885.423) -- 0:00:56
Average standard deviation of split frequencies: 0.015166
210500 -- (-886.776) (-892.435) (-883.042) [-885.436] * (-884.494) (-884.788) (-884.676) [-884.589] -- 0:00:56
211000 -- (-884.372) [-883.681] (-883.563) (-883.101) * (-885.243) (-885.417) [-883.928] (-884.624) -- 0:00:56
211500 -- (-886.279) (-888.999) (-885.029) [-883.859] * [-884.795] (-883.641) (-884.484) (-891.693) -- 0:00:55
212000 -- (-884.091) (-884.475) (-884.134) [-883.539] * (-883.282) (-884.322) [-884.968] (-888.927) -- 0:00:55
212500 -- (-883.441) [-885.359] (-884.094) (-883.630) * (-887.946) [-884.515] (-883.859) (-885.269) -- 0:00:55
213000 -- (-887.671) (-884.682) (-883.901) [-885.815] * (-888.895) [-884.614] (-883.930) (-885.651) -- 0:00:55
213500 -- [-886.591] (-883.397) (-890.294) (-885.815) * (-886.656) (-886.344) [-883.688] (-883.324) -- 0:00:58
214000 -- (-888.828) (-885.995) (-886.115) [-885.523] * (-885.689) (-887.330) [-882.772] (-883.990) -- 0:00:58
214500 -- [-884.896] (-885.670) (-885.914) (-884.051) * (-885.997) [-890.626] (-883.088) (-884.013) -- 0:00:58
215000 -- (-883.721) (-887.780) [-884.413] (-886.429) * (-885.774) (-888.858) (-883.026) [-884.182] -- 0:00:58
Average standard deviation of split frequencies: 0.015736
215500 -- (-884.853) [-885.581] (-884.971) (-883.406) * (-886.418) [-887.177] (-883.023) (-884.727) -- 0:00:58
216000 -- (-885.542) (-883.922) [-883.851] (-884.091) * (-883.223) [-885.963] (-883.301) (-883.180) -- 0:00:58
216500 -- (-888.818) [-884.300] (-886.455) (-884.528) * (-887.272) (-887.060) (-884.845) [-882.629] -- 0:00:57
217000 -- [-885.888] (-892.049) (-885.730) (-885.886) * (-885.748) (-886.890) (-884.664) [-884.061] -- 0:00:57
217500 -- (-891.262) (-887.082) [-886.422] (-886.084) * (-885.351) [-886.517] (-885.816) (-884.246) -- 0:00:57
218000 -- (-886.061) (-882.805) (-885.063) [-885.817] * (-885.278) (-891.529) (-885.877) [-882.898] -- 0:00:57
218500 -- (-883.855) (-883.327) (-884.015) [-883.016] * (-887.496) [-886.556] (-883.458) (-887.440) -- 0:00:57
219000 -- (-884.434) (-884.261) (-883.987) [-884.029] * (-884.617) [-885.147] (-883.044) (-884.437) -- 0:00:57
219500 -- [-885.237] (-883.454) (-886.497) (-887.406) * (-883.840) [-884.815] (-883.039) (-883.539) -- 0:00:56
220000 -- [-888.283] (-883.972) (-884.895) (-885.253) * (-884.111) (-884.557) (-884.143) [-882.951] -- 0:00:56
Average standard deviation of split frequencies: 0.015966
220500 -- (-886.136) [-884.250] (-885.445) (-884.296) * [-884.314] (-883.341) (-884.336) (-883.008) -- 0:00:56
221000 -- (-886.744) (-882.685) (-885.210) [-883.231] * (-884.045) (-884.503) (-884.217) [-883.169] -- 0:00:56
221500 -- (-885.431) [-884.050] (-886.630) (-884.237) * (-884.881) (-884.267) (-888.643) [-883.590] -- 0:00:56
222000 -- (-885.333) [-884.775] (-884.010) (-885.571) * [-885.259] (-888.534) (-885.203) (-885.106) -- 0:00:56
222500 -- (-887.165) (-884.757) [-885.685] (-886.369) * (-883.891) (-884.859) [-886.016] (-883.702) -- 0:00:55
223000 -- [-888.532] (-885.307) (-883.352) (-884.531) * [-884.322] (-884.948) (-885.298) (-883.961) -- 0:00:55
223500 -- (-885.201) (-885.212) [-886.493] (-887.522) * (-884.440) (-884.878) (-883.229) [-884.374] -- 0:00:55
224000 -- (-886.389) [-885.331] (-884.049) (-889.399) * (-883.839) (-889.735) (-886.468) [-883.404] -- 0:00:55
224500 -- [-886.132] (-885.083) (-887.896) (-889.497) * (-887.340) (-885.757) (-886.534) [-884.021] -- 0:00:55
225000 -- (-883.446) (-886.496) (-883.855) [-886.255] * [-885.001] (-886.518) (-886.273) (-884.298) -- 0:00:55
Average standard deviation of split frequencies: 0.015644
225500 -- (-886.598) (-887.565) [-885.074] (-885.805) * (-884.814) (-883.832) (-886.714) [-885.483] -- 0:00:54
226000 -- (-882.870) (-884.919) (-886.426) [-885.887] * (-883.343) (-886.405) (-885.102) [-883.884] -- 0:00:54
226500 -- (-885.447) (-889.749) [-885.776] (-884.633) * (-883.625) (-887.035) (-887.361) [-888.122] -- 0:00:54
227000 -- (-885.358) (-890.008) [-885.347] (-887.229) * (-883.325) [-884.594] (-884.613) (-883.713) -- 0:00:54
227500 -- (-883.161) (-887.835) [-886.930] (-885.562) * [-883.143] (-883.979) (-884.679) (-886.508) -- 0:00:57
228000 -- [-884.851] (-887.558) (-884.482) (-887.188) * (-886.579) (-887.999) [-883.608] (-888.400) -- 0:00:57
228500 -- (-885.368) [-883.968] (-884.415) (-888.505) * (-884.018) [-884.126] (-884.618) (-891.719) -- 0:00:57
229000 -- (-884.382) [-884.290] (-889.693) (-886.178) * (-886.262) (-885.030) (-886.089) [-889.086] -- 0:00:57
229500 -- (-884.376) (-883.563) [-885.522] (-885.580) * (-888.591) (-884.794) [-884.046] (-886.678) -- 0:00:57
230000 -- [-885.792] (-886.314) (-885.991) (-886.263) * [-883.361] (-885.970) (-888.718) (-887.231) -- 0:00:56
Average standard deviation of split frequencies: 0.015736
230500 -- [-885.264] (-887.483) (-885.967) (-882.882) * (-885.108) [-885.371] (-887.107) (-885.000) -- 0:00:56
231000 -- [-884.880] (-884.291) (-884.018) (-885.334) * (-884.205) (-883.973) [-886.944] (-885.681) -- 0:00:56
231500 -- (-887.661) (-886.452) [-885.923] (-886.800) * (-884.829) (-885.512) [-885.552] (-884.138) -- 0:00:56
232000 -- (-884.930) (-884.232) [-885.493] (-889.586) * (-885.301) [-884.189] (-885.041) (-883.997) -- 0:00:56
232500 -- (-886.678) (-884.405) [-885.460] (-884.995) * [-884.216] (-886.834) (-884.671) (-885.776) -- 0:00:56
233000 -- (-884.288) [-883.744] (-887.780) (-883.509) * (-888.823) (-883.458) (-886.551) [-886.917] -- 0:00:55
233500 -- (-885.091) [-888.295] (-886.923) (-884.127) * (-885.696) (-882.804) (-884.664) [-883.483] -- 0:00:55
234000 -- (-886.387) [-885.015] (-883.789) (-886.434) * (-886.305) (-884.089) (-888.533) [-884.277] -- 0:00:55
234500 -- (-885.284) [-886.741] (-883.826) (-886.178) * [-886.500] (-884.189) (-883.653) (-884.259) -- 0:00:55
235000 -- (-883.922) (-886.881) [-883.287] (-883.918) * (-885.805) [-885.774] (-883.503) (-884.712) -- 0:00:55
Average standard deviation of split frequencies: 0.015880
235500 -- (-883.757) [-887.932] (-884.057) (-883.099) * (-884.810) (-884.030) (-884.133) [-884.087] -- 0:00:55
236000 -- (-883.913) (-883.926) (-883.280) [-884.073] * (-886.590) (-885.999) [-883.904] (-884.258) -- 0:00:55
236500 -- [-885.081] (-886.729) (-883.051) (-884.197) * [-886.242] (-885.511) (-890.149) (-888.546) -- 0:00:54
237000 -- [-884.001] (-885.255) (-886.654) (-883.529) * [-882.906] (-884.276) (-883.891) (-895.796) -- 0:00:54
237500 -- (-883.582) (-886.586) [-886.316] (-885.508) * [-884.737] (-885.142) (-892.899) (-894.819) -- 0:00:54
238000 -- [-885.109] (-883.276) (-884.231) (-885.286) * (-885.379) [-885.055] (-885.322) (-887.598) -- 0:00:54
238500 -- [-884.012] (-889.918) (-885.517) (-883.549) * (-886.323) (-884.426) (-886.465) [-883.420] -- 0:00:54
239000 -- (-883.959) (-887.884) [-884.338] (-885.110) * (-885.436) (-885.473) [-886.433] (-884.210) -- 0:00:54
239500 -- (-884.844) [-887.062] (-884.946) (-885.799) * (-883.520) [-883.453] (-884.111) (-885.402) -- 0:00:53
240000 -- [-884.770] (-889.430) (-885.545) (-887.461) * [-883.086] (-886.138) (-883.274) (-886.155) -- 0:00:53
Average standard deviation of split frequencies: 0.014948
240500 -- (-885.248) (-886.772) (-885.160) [-884.253] * (-885.217) (-884.947) [-885.005] (-888.252) -- 0:00:53
241000 -- (-884.728) [-884.828] (-884.406) (-886.482) * (-886.711) (-883.018) (-886.513) [-885.817] -- 0:00:56
241500 -- (-886.180) (-886.644) [-887.916] (-885.578) * (-885.563) (-883.497) [-883.088] (-882.704) -- 0:00:56
242000 -- [-886.482] (-887.322) (-884.297) (-888.460) * (-891.913) (-884.135) [-883.056] (-883.596) -- 0:00:56
242500 -- (-885.580) (-883.002) [-884.928] (-888.662) * (-884.720) [-883.611] (-883.544) (-886.390) -- 0:00:56
243000 -- (-884.705) (-883.910) [-883.672] (-884.964) * [-884.216] (-884.749) (-883.580) (-887.651) -- 0:00:56
243500 -- (-885.470) [-884.623] (-883.364) (-883.118) * (-883.669) [-882.782] (-885.051) (-883.864) -- 0:00:55
244000 -- [-884.396] (-884.182) (-887.102) (-883.268) * [-883.789] (-885.041) (-885.541) (-886.580) -- 0:00:55
244500 -- (-886.273) [-882.619] (-887.886) (-883.593) * [-888.180] (-884.276) (-883.716) (-884.448) -- 0:00:55
245000 -- (-885.288) (-882.937) (-882.671) [-884.012] * (-885.013) (-884.757) (-884.076) [-883.542] -- 0:00:55
Average standard deviation of split frequencies: 0.014221
245500 -- [-883.227] (-883.423) (-885.786) (-885.485) * (-886.107) (-889.266) [-883.818] (-886.803) -- 0:00:55
246000 -- [-883.666] (-883.525) (-886.162) (-884.341) * (-886.298) [-886.485] (-885.969) (-890.528) -- 0:00:55
246500 -- (-886.173) [-884.693] (-884.459) (-883.667) * (-885.504) (-883.506) (-886.426) [-884.130] -- 0:00:55
247000 -- (-891.173) [-883.473] (-885.561) (-888.692) * [-885.464] (-886.455) (-887.270) (-884.752) -- 0:00:54
247500 -- (-887.342) (-885.390) [-883.939] (-887.975) * [-884.469] (-883.955) (-884.071) (-884.421) -- 0:00:54
248000 -- (-884.790) (-889.127) (-884.839) [-885.083] * [-883.997] (-884.928) (-884.729) (-883.682) -- 0:00:54
248500 -- [-885.257] (-884.012) (-884.467) (-884.377) * [-884.325] (-884.184) (-883.750) (-884.667) -- 0:00:54
249000 -- (-886.970) (-884.247) [-883.837] (-884.053) * [-884.503] (-884.566) (-892.007) (-883.001) -- 0:00:54
249500 -- (-888.622) (-883.680) (-884.947) [-887.164] * [-885.608] (-883.564) (-884.428) (-885.252) -- 0:00:54
250000 -- (-886.993) (-885.498) [-883.362] (-889.896) * [-886.614] (-884.496) (-885.110) (-884.222) -- 0:00:54
Average standard deviation of split frequencies: 0.012224
250500 -- (-886.462) (-884.158) (-883.364) [-884.362] * (-888.153) (-888.596) [-884.223] (-884.839) -- 0:00:53
251000 -- [-884.353] (-886.944) (-884.929) (-884.888) * (-885.689) (-887.551) [-884.462] (-884.775) -- 0:00:53
251500 -- [-883.315] (-889.623) (-886.858) (-885.481) * [-884.528] (-886.602) (-883.394) (-884.676) -- 0:00:53
252000 -- (-884.494) (-884.817) (-883.896) [-886.446] * (-885.576) (-882.844) (-883.522) [-885.719] -- 0:00:53
252500 -- (-884.396) (-883.547) (-884.214) [-883.420] * [-885.681] (-884.138) (-884.563) (-887.217) -- 0:00:53
253000 -- [-884.375] (-883.850) (-886.634) (-885.602) * (-883.481) (-885.486) (-883.506) [-883.265] -- 0:00:53
253500 -- (-885.984) (-885.031) (-885.561) [-884.720] * (-885.840) (-885.286) (-883.517) [-886.328] -- 0:00:53
254000 -- (-884.837) [-886.240] (-889.838) (-883.771) * (-885.349) [-884.723] (-882.722) (-888.077) -- 0:00:52
254500 -- (-882.813) (-884.213) (-886.489) [-884.116] * (-886.755) [-885.352] (-883.738) (-887.013) -- 0:00:52
255000 -- [-882.818] (-886.436) (-882.695) (-883.625) * (-887.184) [-885.255] (-884.666) (-885.524) -- 0:00:55
Average standard deviation of split frequencies: 0.010742
255500 -- (-884.471) (-884.174) [-884.669] (-883.172) * (-883.814) (-884.096) [-885.771] (-884.800) -- 0:00:55
256000 -- (-885.703) (-883.676) (-884.461) [-883.077] * (-884.242) (-883.406) [-885.156] (-883.068) -- 0:00:55
256500 -- [-884.283] (-886.574) (-886.473) (-883.514) * (-884.995) [-884.771] (-886.808) (-884.042) -- 0:00:55
257000 -- (-888.814) (-884.972) [-885.901] (-885.289) * (-888.082) (-884.938) (-885.974) [-883.476] -- 0:00:54
257500 -- [-883.305] (-885.592) (-884.695) (-886.350) * [-888.189] (-884.174) (-888.148) (-883.649) -- 0:00:54
258000 -- (-884.069) (-883.999) (-887.696) [-884.712] * (-885.474) (-883.085) (-885.705) [-885.228] -- 0:00:54
258500 -- [-884.114] (-885.361) (-883.432) (-886.205) * [-882.843] (-883.849) (-883.491) (-883.543) -- 0:00:54
259000 -- (-883.895) (-884.849) [-884.697] (-886.699) * (-885.978) [-886.362] (-883.962) (-884.195) -- 0:00:54
259500 -- (-884.519) (-884.427) (-885.337) [-884.937] * [-883.689] (-886.272) (-885.135) (-886.113) -- 0:00:54
260000 -- (-885.629) (-883.525) [-883.195] (-886.070) * (-885.724) (-889.275) (-885.158) [-887.792] -- 0:00:54
Average standard deviation of split frequencies: 0.010650
260500 -- (-883.434) (-884.996) [-884.725] (-886.551) * [-886.194] (-887.955) (-886.136) (-884.932) -- 0:00:53
261000 -- (-884.028) (-886.563) [-883.876] (-885.173) * (-889.199) (-886.416) (-886.725) [-883.302] -- 0:00:53
261500 -- (-884.122) [-887.379] (-883.749) (-889.521) * (-889.099) [-884.954] (-892.823) (-883.544) -- 0:00:53
262000 -- (-887.912) (-885.954) (-884.267) [-885.463] * (-888.517) (-888.119) [-884.558] (-883.544) -- 0:00:53
262500 -- (-886.719) (-884.955) (-884.072) [-885.989] * (-889.040) (-884.672) [-883.206] (-883.544) -- 0:00:53
263000 -- (-886.336) (-885.689) (-884.446) [-883.785] * [-884.624] (-883.425) (-884.308) (-883.550) -- 0:00:53
263500 -- (-884.109) (-884.369) [-885.056] (-883.136) * [-884.779] (-887.342) (-883.988) (-883.605) -- 0:00:53
264000 -- (-884.879) (-888.964) [-886.994] (-885.057) * (-888.439) (-885.423) [-886.004] (-883.578) -- 0:00:52
264500 -- (-884.638) (-883.681) (-883.463) [-885.224] * (-882.805) [-883.903] (-884.419) (-885.885) -- 0:00:52
265000 -- (-885.035) [-884.118] (-883.915) (-884.295) * (-885.712) [-885.732] (-884.084) (-884.350) -- 0:00:52
Average standard deviation of split frequencies: 0.010338
265500 -- [-885.176] (-886.077) (-884.025) (-887.741) * (-885.148) (-884.241) (-886.301) [-883.445] -- 0:00:52
266000 -- [-885.477] (-886.955) (-885.610) (-885.042) * [-884.748] (-883.199) (-883.547) (-885.720) -- 0:00:52
266500 -- (-885.409) (-885.885) (-883.562) [-884.430] * [-883.446] (-883.234) (-882.841) (-884.960) -- 0:00:52
267000 -- [-886.656] (-885.643) (-885.109) (-887.390) * (-884.940) [-883.432] (-885.162) (-884.967) -- 0:00:52
267500 -- (-884.588) [-884.629] (-883.419) (-885.150) * (-884.218) [-884.848] (-887.609) (-885.050) -- 0:00:52
268000 -- (-883.392) [-886.041] (-885.095) (-884.484) * (-883.302) (-885.445) (-886.281) [-889.389] -- 0:00:51
268500 -- (-885.383) (-888.377) [-885.811] (-884.324) * (-885.400) (-886.152) (-886.475) [-883.708] -- 0:00:51
269000 -- [-886.123] (-887.556) (-884.475) (-883.615) * (-885.407) (-885.873) [-887.144] (-884.111) -- 0:00:54
269500 -- (-883.608) (-888.975) [-883.619] (-883.629) * (-889.490) (-886.785) [-885.235] (-883.515) -- 0:00:54
270000 -- [-885.775] (-883.878) (-883.559) (-883.024) * [-885.943] (-889.712) (-884.757) (-886.163) -- 0:00:54
Average standard deviation of split frequencies: 0.011577
270500 -- (-887.565) [-885.389] (-883.798) (-884.497) * (-883.686) (-886.362) [-883.719] (-886.215) -- 0:00:53
271000 -- (-887.379) (-885.611) (-886.478) [-884.066] * (-883.205) (-888.184) [-886.621] (-887.373) -- 0:00:53
271500 -- (-889.244) [-882.973] (-886.386) (-885.484) * (-886.820) (-884.636) [-883.856] (-884.963) -- 0:00:53
272000 -- (-885.605) [-883.840] (-888.224) (-885.261) * (-890.033) (-885.578) [-885.348] (-884.783) -- 0:00:53
272500 -- (-883.834) [-884.469] (-886.517) (-884.345) * [-884.182] (-886.755) (-884.196) (-884.497) -- 0:00:53
273000 -- (-883.126) [-885.600] (-885.208) (-887.915) * [-884.913] (-888.660) (-884.549) (-885.024) -- 0:00:53
273500 -- [-882.940] (-890.924) (-885.323) (-892.428) * (-885.868) (-883.182) [-885.018] (-883.184) -- 0:00:53
274000 -- (-884.919) [-887.116] (-884.733) (-882.896) * (-885.387) (-888.525) [-887.802] (-886.382) -- 0:00:52
274500 -- (-885.306) (-885.595) (-883.377) [-885.715] * [-885.321] (-888.526) (-886.375) (-888.669) -- 0:00:52
275000 -- [-884.267] (-885.094) (-884.179) (-885.642) * (-884.551) (-886.034) (-883.278) [-883.808] -- 0:00:52
Average standard deviation of split frequencies: 0.010533
275500 -- (-887.626) [-883.464] (-884.140) (-884.745) * [-884.387] (-885.049) (-884.228) (-885.765) -- 0:00:52
276000 -- (-884.444) [-888.368] (-884.056) (-886.037) * (-884.599) (-885.435) (-883.850) [-883.773] -- 0:00:52
276500 -- [-884.235] (-885.224) (-882.868) (-889.886) * (-887.241) (-884.434) [-883.715] (-883.751) -- 0:00:52
277000 -- (-883.963) (-884.600) (-884.332) [-885.084] * [-884.979] (-885.910) (-887.304) (-883.607) -- 0:00:52
277500 -- (-883.988) (-885.156) (-883.059) [-887.723] * [-887.594] (-885.565) (-885.555) (-886.756) -- 0:00:52
278000 -- (-884.859) [-882.980] (-883.788) (-885.827) * (-889.634) [-884.828] (-886.933) (-885.147) -- 0:00:51
278500 -- [-883.521] (-884.502) (-883.736) (-891.536) * (-882.853) (-886.252) [-884.061] (-883.224) -- 0:00:51
279000 -- (-888.384) (-884.277) [-885.857] (-889.988) * (-884.775) (-884.081) (-884.687) [-884.019] -- 0:00:51
279500 -- (-887.012) (-884.673) [-886.519] (-884.901) * (-885.898) [-883.585] (-887.258) (-885.298) -- 0:00:51
280000 -- [-885.169] (-883.833) (-885.798) (-886.517) * [-884.351] (-883.415) (-886.374) (-886.675) -- 0:00:51
Average standard deviation of split frequencies: 0.010637
280500 -- [-884.517] (-883.885) (-883.857) (-884.248) * [-885.013] (-884.532) (-890.648) (-885.836) -- 0:00:51
281000 -- (-885.624) (-884.991) (-884.892) [-885.013] * (-886.071) (-883.824) [-884.571] (-886.950) -- 0:00:51
281500 -- (-884.571) [-884.449] (-883.722) (-883.498) * [-883.581] (-884.687) (-884.636) (-883.915) -- 0:00:51
282000 -- (-883.123) (-883.374) [-883.784] (-883.530) * (-883.645) (-884.563) [-885.350] (-884.530) -- 0:00:50
282500 -- (-883.498) (-883.689) (-885.830) [-884.126] * (-885.140) (-884.222) (-886.696) [-884.063] -- 0:00:50
283000 -- (-882.980) (-885.720) (-885.286) [-884.038] * (-883.281) (-883.400) (-884.194) [-886.532] -- 0:00:53
283500 -- (-887.444) (-885.144) [-883.791] (-890.526) * (-884.273) (-884.020) (-887.649) [-883.359] -- 0:00:53
284000 -- (-885.201) (-882.963) [-884.205] (-889.786) * (-883.952) [-885.481] (-885.118) (-883.049) -- 0:00:52
284500 -- (-884.676) (-883.557) [-888.408] (-887.095) * (-884.725) [-883.849] (-886.189) (-885.979) -- 0:00:52
285000 -- (-883.965) (-884.584) (-886.207) [-883.681] * (-890.230) [-883.323] (-885.897) (-884.731) -- 0:00:52
Average standard deviation of split frequencies: 0.011104
285500 -- (-885.038) (-887.696) (-886.178) [-886.964] * [-884.424] (-886.899) (-887.886) (-885.351) -- 0:00:52
286000 -- (-885.666) (-883.561) (-884.833) [-885.564] * (-884.351) (-884.973) (-884.285) [-886.137] -- 0:00:52
286500 -- (-888.599) [-885.050] (-885.673) (-888.135) * [-883.875] (-886.798) (-883.777) (-886.051) -- 0:00:52
287000 -- (-884.665) (-885.782) (-886.494) [-884.222] * [-884.759] (-887.301) (-884.394) (-884.158) -- 0:00:52
287500 -- [-884.960] (-888.466) (-883.520) (-884.739) * (-882.806) (-887.308) (-884.038) [-884.080] -- 0:00:52
288000 -- (-883.731) [-885.989] (-887.832) (-885.316) * (-885.730) [-886.683] (-883.703) (-886.689) -- 0:00:51
288500 -- (-883.691) [-886.407] (-887.102) (-884.321) * (-883.990) (-886.695) [-884.162] (-886.159) -- 0:00:51
289000 -- [-883.714] (-886.480) (-886.011) (-887.111) * (-887.684) (-884.879) (-888.753) [-883.525] -- 0:00:51
289500 -- (-886.276) [-883.844] (-886.671) (-888.466) * (-884.203) (-883.838) (-887.710) [-887.884] -- 0:00:51
290000 -- (-884.941) [-884.413] (-882.841) (-890.864) * (-883.654) (-888.440) (-888.234) [-883.302] -- 0:00:51
Average standard deviation of split frequencies: 0.011925
290500 -- (-883.802) [-884.377] (-883.021) (-887.508) * (-884.805) [-883.089] (-884.590) (-884.075) -- 0:00:51
291000 -- (-883.554) (-883.733) [-883.334] (-883.804) * (-884.804) (-885.779) (-885.752) [-885.233] -- 0:00:51
291500 -- (-885.529) (-884.150) [-883.618] (-883.948) * (-884.588) [-884.944] (-889.229) (-885.562) -- 0:00:51
292000 -- (-884.836) [-883.341] (-885.000) (-885.969) * (-883.945) (-884.014) [-884.944] (-890.586) -- 0:00:50
292500 -- [-886.215] (-885.037) (-884.652) (-883.953) * [-885.976] (-890.309) (-890.269) (-883.716) -- 0:00:50
293000 -- [-885.124] (-886.122) (-887.289) (-888.339) * (-885.018) (-885.839) [-889.992] (-882.996) -- 0:00:50
293500 -- [-883.776] (-886.706) (-885.031) (-883.676) * (-883.482) (-885.916) (-883.124) [-884.103] -- 0:00:50
294000 -- (-885.484) (-884.645) [-883.137] (-882.985) * (-882.798) (-887.591) [-884.676] (-884.064) -- 0:00:50
294500 -- (-885.203) (-883.631) [-883.277] (-882.869) * (-883.190) (-883.047) [-885.219] (-891.016) -- 0:00:50
295000 -- (-885.527) [-884.067] (-883.208) (-887.568) * (-885.112) [-883.098] (-883.908) (-885.499) -- 0:00:50
Average standard deviation of split frequencies: 0.011898
295500 -- (-884.177) (-883.637) (-886.389) [-883.796] * (-885.321) [-885.497] (-887.223) (-886.972) -- 0:00:50
296000 -- [-883.891] (-882.789) (-882.742) (-883.631) * [-885.492] (-887.395) (-885.551) (-886.325) -- 0:00:52
296500 -- (-886.522) (-884.477) (-884.419) [-887.549] * (-886.581) [-886.559] (-884.533) (-887.696) -- 0:00:52
297000 -- [-887.221] (-883.295) (-887.160) (-883.916) * [-885.855] (-885.369) (-883.329) (-891.608) -- 0:00:52
297500 -- (-887.115) (-886.963) [-886.419] (-883.534) * (-889.844) (-883.645) (-885.086) [-886.948] -- 0:00:51
298000 -- (-885.136) [-885.033] (-882.806) (-886.208) * (-884.160) [-885.889] (-884.096) (-886.685) -- 0:00:51
298500 -- (-884.492) (-883.239) [-884.562] (-884.075) * [-884.007] (-886.107) (-886.334) (-884.648) -- 0:00:51
299000 -- (-886.762) [-884.766] (-890.096) (-887.664) * (-885.381) (-887.478) [-882.957] (-883.713) -- 0:00:51
299500 -- (-887.120) (-886.372) [-887.187] (-887.365) * (-884.516) [-887.709] (-886.583) (-886.321) -- 0:00:51
300000 -- (-887.687) [-883.988] (-885.203) (-884.272) * (-883.645) (-884.764) [-882.707] (-888.545) -- 0:00:51
Average standard deviation of split frequencies: 0.010698
300500 -- (-888.442) (-883.834) [-888.303] (-883.363) * (-884.411) (-884.474) (-883.156) [-885.985] -- 0:00:51
301000 -- (-886.139) (-886.715) (-891.706) [-884.625] * (-885.489) [-883.268] (-885.085) (-885.061) -- 0:00:51
301500 -- [-884.897] (-887.457) (-885.121) (-887.404) * (-887.084) (-885.974) [-885.807] (-885.290) -- 0:00:50
302000 -- (-883.523) (-885.593) (-883.384) [-887.975] * [-886.137] (-885.583) (-885.480) (-884.126) -- 0:00:50
302500 -- (-883.797) (-887.860) [-886.647] (-882.832) * [-884.709] (-884.492) (-887.349) (-886.829) -- 0:00:50
303000 -- (-886.175) (-886.044) [-885.977] (-884.287) * (-885.735) (-886.395) (-887.341) [-882.897] -- 0:00:50
303500 -- [-890.836] (-884.412) (-886.978) (-884.308) * (-886.433) [-886.689] (-884.786) (-884.091) -- 0:00:50
304000 -- (-885.353) (-882.873) (-884.344) [-883.425] * (-885.439) (-885.942) (-883.342) [-883.759] -- 0:00:50
304500 -- (-886.377) (-883.254) [-884.317] (-885.630) * (-885.495) (-885.937) (-886.459) [-884.357] -- 0:00:50
305000 -- (-890.235) (-885.098) [-883.303] (-884.383) * (-884.023) [-886.476] (-883.898) (-885.469) -- 0:00:50
Average standard deviation of split frequencies: 0.010099
305500 -- (-884.391) (-884.813) [-885.937] (-884.474) * (-883.170) [-884.045] (-884.693) (-886.651) -- 0:00:50
306000 -- [-884.445] (-884.270) (-887.411) (-884.222) * (-884.147) [-885.893] (-884.305) (-884.130) -- 0:00:49
306500 -- [-885.084] (-887.502) (-887.760) (-886.616) * (-884.838) (-885.392) (-882.834) [-884.752] -- 0:00:49
307000 -- (-885.168) [-887.577] (-888.390) (-891.281) * (-886.552) (-885.383) [-882.715] (-883.182) -- 0:00:49
307500 -- (-884.513) [-883.768] (-884.659) (-885.820) * (-883.761) [-885.424] (-883.041) (-884.785) -- 0:00:49
308000 -- [-888.649] (-885.356) (-884.395) (-884.327) * (-884.197) (-886.050) [-883.726] (-884.782) -- 0:00:49
308500 -- (-883.272) (-884.524) [-885.292] (-883.563) * (-882.623) (-884.901) [-885.255] (-885.281) -- 0:00:49
309000 -- (-883.670) (-887.578) [-882.880] (-885.794) * [-883.061] (-883.147) (-885.055) (-889.665) -- 0:00:49
309500 -- [-884.629] (-886.611) (-884.228) (-884.503) * [-883.601] (-883.396) (-884.740) (-885.067) -- 0:00:49
310000 -- (-884.095) (-885.634) (-891.764) [-888.298] * (-884.002) [-883.173] (-887.552) (-884.660) -- 0:00:51
Average standard deviation of split frequencies: 0.010717
310500 -- (-886.168) (-884.834) (-885.632) [-884.241] * (-883.091) (-885.436) [-885.619] (-885.031) -- 0:00:51
311000 -- [-885.780] (-884.493) (-883.918) (-883.944) * (-886.848) (-883.375) (-882.951) [-887.864] -- 0:00:50
311500 -- (-884.788) [-884.656] (-885.892) (-885.416) * [-886.727] (-885.034) (-882.833) (-884.793) -- 0:00:50
312000 -- [-884.407] (-883.675) (-887.178) (-884.614) * (-885.025) (-886.026) [-884.323] (-884.147) -- 0:00:50
312500 -- (-884.602) (-885.061) [-883.569] (-884.976) * [-884.943] (-887.416) (-883.355) (-886.356) -- 0:00:50
313000 -- (-884.420) (-887.568) [-884.305] (-886.442) * (-884.300) (-889.189) [-886.272] (-884.324) -- 0:00:50
313500 -- [-886.488] (-888.427) (-886.023) (-885.298) * [-883.221] (-887.819) (-890.243) (-884.602) -- 0:00:50
314000 -- (-885.269) [-890.228] (-883.491) (-885.096) * [-885.720] (-888.287) (-883.232) (-885.260) -- 0:00:50
314500 -- (-885.826) (-884.353) [-883.524] (-884.128) * (-883.596) (-885.290) (-883.654) [-884.773] -- 0:00:50
315000 -- (-885.321) [-883.842] (-883.840) (-884.529) * [-885.171] (-884.480) (-884.603) (-886.651) -- 0:00:50
Average standard deviation of split frequencies: 0.010070
315500 -- [-887.295] (-883.376) (-885.054) (-887.277) * (-885.244) [-885.389] (-891.976) (-883.772) -- 0:00:49
316000 -- (-885.880) (-887.518) [-882.985] (-885.226) * (-885.443) [-884.413] (-886.008) (-888.212) -- 0:00:49
316500 -- (-886.980) (-884.051) [-883.396] (-887.006) * (-885.853) (-884.054) (-882.978) [-884.557] -- 0:00:49
317000 -- [-884.769] (-883.500) (-884.174) (-884.765) * (-883.452) (-883.760) (-883.459) [-884.698] -- 0:00:49
317500 -- (-887.656) (-886.299) (-883.906) [-883.432] * (-884.837) (-882.887) [-883.671] (-888.181) -- 0:00:49
318000 -- (-886.345) (-884.219) [-884.570] (-883.253) * (-886.358) (-883.637) [-884.641] (-885.791) -- 0:00:49
318500 -- (-883.652) [-890.872] (-884.167) (-883.647) * [-884.913] (-887.247) (-884.028) (-885.327) -- 0:00:49
319000 -- (-885.557) [-883.969] (-885.940) (-884.429) * (-882.832) (-884.404) [-883.635] (-884.134) -- 0:00:49
319500 -- (-887.122) (-883.698) (-885.297) [-884.133] * (-882.835) (-890.139) (-884.163) [-882.998] -- 0:00:48
320000 -- (-888.025) (-882.954) [-882.674] (-884.537) * (-884.700) [-887.053] (-884.627) (-883.622) -- 0:00:48
Average standard deviation of split frequencies: 0.009372
320500 -- (-888.044) (-885.481) [-883.227] (-883.335) * [-884.264] (-884.821) (-883.129) (-886.737) -- 0:00:48
321000 -- [-886.784] (-886.114) (-883.748) (-884.039) * (-884.097) [-883.322] (-885.979) (-890.109) -- 0:00:48
321500 -- (-883.692) [-884.075] (-885.408) (-884.429) * (-885.816) [-885.257] (-885.510) (-886.022) -- 0:00:48
322000 -- (-883.071) [-884.944] (-885.575) (-883.618) * (-887.110) [-884.990] (-886.323) (-884.199) -- 0:00:48
322500 -- (-888.427) (-884.243) (-884.111) [-883.736] * (-885.057) (-885.268) [-885.768] (-888.778) -- 0:00:48
323000 -- (-886.496) (-884.896) (-883.939) [-884.012] * [-884.632] (-883.744) (-884.302) (-885.785) -- 0:00:48
323500 -- (-888.342) (-884.255) [-885.163] (-884.125) * (-886.810) (-883.753) (-885.629) [-885.142] -- 0:00:48
324000 -- (-884.590) (-887.542) [-884.103] (-884.027) * (-884.607) (-884.085) (-884.686) [-883.978] -- 0:00:50
324500 -- (-885.678) (-884.240) [-884.080] (-884.733) * (-883.170) [-887.283] (-889.137) (-885.718) -- 0:00:49
325000 -- (-885.182) [-886.336] (-885.530) (-884.844) * (-885.005) (-884.141) [-886.875] (-883.504) -- 0:00:49
Average standard deviation of split frequencies: 0.009580
325500 -- (-887.335) (-886.080) [-883.674] (-883.827) * (-885.416) [-883.512] (-883.523) (-887.079) -- 0:00:49
326000 -- (-887.477) (-885.854) (-885.205) [-885.765] * (-885.942) [-884.675] (-883.309) (-883.487) -- 0:00:49
326500 -- (-884.718) (-884.902) [-884.524] (-883.807) * (-885.035) (-884.305) [-884.446] (-884.264) -- 0:00:49
327000 -- (-887.771) [-884.643] (-885.257) (-885.480) * (-884.142) (-883.333) (-884.950) [-886.229] -- 0:00:49
327500 -- [-885.022] (-884.110) (-890.973) (-885.083) * (-882.939) (-883.033) [-884.549] (-888.967) -- 0:00:49
328000 -- [-888.861] (-883.095) (-885.065) (-885.013) * [-884.122] (-884.828) (-886.977) (-889.588) -- 0:00:49
328500 -- (-884.547) (-883.560) [-885.004] (-885.245) * (-887.100) (-883.420) [-882.923] (-882.962) -- 0:00:49
329000 -- (-883.645) [-889.176] (-883.605) (-883.947) * (-884.027) (-885.621) [-883.978] (-884.407) -- 0:00:48
329500 -- (-883.870) (-890.093) (-884.824) [-885.140] * [-883.365] (-886.595) (-884.178) (-886.894) -- 0:00:48
330000 -- (-886.437) [-884.679] (-884.770) (-884.705) * (-884.078) (-885.211) (-883.959) [-885.415] -- 0:00:48
Average standard deviation of split frequencies: 0.009267
330500 -- (-883.737) (-884.336) (-884.710) [-882.991] * (-886.178) (-886.919) [-884.525] (-886.852) -- 0:00:48
331000 -- (-884.932) (-884.691) (-884.439) [-884.256] * (-883.878) (-884.713) (-883.451) [-888.323] -- 0:00:48
331500 -- (-886.489) (-883.908) [-883.405] (-887.753) * [-884.594] (-884.568) (-887.314) (-885.931) -- 0:00:48
332000 -- (-883.223) (-886.376) (-883.508) [-882.949] * (-883.510) [-886.530] (-885.597) (-885.139) -- 0:00:48
332500 -- (-883.780) (-889.084) (-885.592) [-883.031] * (-885.209) [-884.342] (-889.724) (-885.677) -- 0:00:48
333000 -- [-882.753] (-885.958) (-883.542) (-885.791) * (-889.885) (-885.770) [-887.484] (-886.381) -- 0:00:48
333500 -- [-882.754] (-885.170) (-885.022) (-885.663) * (-885.326) (-883.618) (-884.246) [-885.224] -- 0:00:47
334000 -- (-883.253) [-883.534] (-884.730) (-886.194) * (-886.099) (-886.886) [-882.877] (-883.289) -- 0:00:47
334500 -- (-885.812) (-884.152) [-884.665] (-888.363) * (-884.083) (-884.240) [-883.111] (-884.432) -- 0:00:47
335000 -- (-885.223) (-884.087) (-884.919) [-883.746] * (-884.857) [-883.396] (-885.229) (-886.130) -- 0:00:47
Average standard deviation of split frequencies: 0.009821
335500 -- [-885.624] (-884.310) (-885.314) (-883.841) * [-883.367] (-886.600) (-884.031) (-883.754) -- 0:00:47
336000 -- (-884.797) [-886.311] (-883.095) (-886.386) * (-884.860) (-886.728) [-884.349] (-884.747) -- 0:00:47
336500 -- (-888.751) (-892.219) [-883.546] (-892.025) * (-887.781) [-884.695] (-889.724) (-885.634) -- 0:00:47
337000 -- (-888.815) (-883.938) [-884.575] (-888.883) * (-886.110) (-885.923) [-885.721] (-883.743) -- 0:00:47
337500 -- (-885.157) (-886.191) (-886.143) [-886.443] * (-884.629) (-887.212) (-886.163) [-885.963] -- 0:00:47
338000 -- (-883.929) [-885.388] (-886.718) (-886.529) * (-889.239) (-885.513) [-882.858] (-883.570) -- 0:00:48
338500 -- [-883.256] (-884.771) (-888.498) (-885.107) * [-889.700] (-884.521) (-885.110) (-889.023) -- 0:00:48
339000 -- (-884.551) (-884.780) (-889.409) [-884.974] * (-884.758) (-884.411) [-884.992] (-886.330) -- 0:00:48
339500 -- (-885.523) (-888.895) [-885.070] (-885.694) * (-886.032) [-886.743] (-884.703) (-884.014) -- 0:00:48
340000 -- (-887.766) [-889.416] (-885.762) (-884.126) * (-884.385) (-885.466) [-883.582] (-883.448) -- 0:00:48
Average standard deviation of split frequencies: 0.010638
340500 -- (-883.654) (-886.744) [-883.250] (-883.808) * [-888.963] (-885.197) (-883.442) (-888.358) -- 0:00:48
341000 -- (-885.950) [-884.925] (-884.058) (-890.318) * (-887.879) (-885.497) (-887.626) [-885.993] -- 0:00:48
341500 -- (-884.207) (-884.294) [-889.281] (-883.892) * [-888.217] (-883.883) (-884.253) (-886.589) -- 0:00:48
342000 -- (-887.134) (-883.503) (-887.341) [-882.779] * (-885.622) [-883.603] (-890.340) (-884.006) -- 0:00:48
342500 -- (-884.482) [-884.766] (-884.055) (-886.115) * (-884.530) [-883.984] (-885.456) (-886.051) -- 0:00:47
343000 -- [-884.660] (-884.510) (-885.040) (-884.202) * [-884.524] (-885.247) (-883.973) (-883.958) -- 0:00:47
343500 -- (-885.374) (-883.873) (-883.240) [-882.952] * (-883.575) (-882.925) [-884.612] (-884.153) -- 0:00:47
344000 -- (-886.129) (-883.798) (-884.671) [-883.094] * (-884.392) [-883.824] (-885.273) (-884.869) -- 0:00:47
344500 -- (-885.295) (-883.961) [-884.615] (-885.621) * (-883.383) (-884.178) (-883.321) [-886.736] -- 0:00:47
345000 -- (-886.421) (-885.387) [-886.643] (-885.678) * (-886.145) [-884.374] (-883.544) (-885.140) -- 0:00:47
Average standard deviation of split frequencies: 0.009452
345500 -- [-884.375] (-884.440) (-886.474) (-885.611) * (-887.166) (-886.057) [-884.684] (-884.572) -- 0:00:47
346000 -- [-884.960] (-889.583) (-884.353) (-885.882) * [-888.196] (-885.979) (-883.429) (-882.924) -- 0:00:47
346500 -- [-885.268] (-884.878) (-884.640) (-887.020) * (-883.775) (-885.945) [-883.076] (-883.536) -- 0:00:47
347000 -- (-883.046) (-884.077) [-883.301] (-883.898) * (-886.537) [-884.764] (-885.265) (-883.234) -- 0:00:47
347500 -- (-885.001) (-883.368) [-883.746] (-889.646) * (-883.780) [-886.523] (-885.382) (-883.631) -- 0:00:46
348000 -- (-890.482) (-884.091) (-883.600) [-882.669] * (-884.303) (-886.711) [-884.236] (-883.759) -- 0:00:46
348500 -- (-887.503) (-884.513) (-885.025) [-884.492] * (-894.197) [-883.253] (-884.539) (-884.291) -- 0:00:46
349000 -- (-886.014) [-885.563] (-884.628) (-886.061) * (-885.669) (-884.991) [-884.795] (-883.379) -- 0:00:46
349500 -- (-885.243) [-884.991] (-883.548) (-884.981) * [-884.764] (-884.400) (-885.583) (-883.657) -- 0:00:46
350000 -- (-886.674) (-884.987) [-884.054] (-887.641) * (-884.208) (-889.466) (-886.311) [-884.828] -- 0:00:46
Average standard deviation of split frequencies: 0.009830
350500 -- (-884.662) [-885.690] (-883.673) (-888.713) * (-885.269) (-888.971) (-885.526) [-884.785] -- 0:00:46
351000 -- (-884.061) (-887.051) (-889.894) [-884.618] * (-890.506) (-886.563) [-883.767] (-890.383) -- 0:00:46
351500 -- [-885.594] (-883.686) (-888.212) (-888.048) * (-888.541) (-885.841) [-884.793] (-889.850) -- 0:00:46
352000 -- (-887.929) (-883.734) [-883.184] (-884.492) * (-886.080) (-885.983) [-883.936] (-884.266) -- 0:00:47
352500 -- (-885.310) [-883.853] (-884.129) (-885.017) * (-884.316) (-882.925) [-885.446] (-883.409) -- 0:00:47
353000 -- (-884.350) [-887.673] (-883.732) (-887.411) * (-886.722) [-884.276] (-884.406) (-883.780) -- 0:00:47
353500 -- [-887.320] (-887.281) (-883.748) (-883.693) * (-885.174) (-888.578) [-883.444] (-894.607) -- 0:00:47
354000 -- (-883.814) (-883.195) [-883.797] (-883.863) * (-890.275) (-885.694) (-885.338) [-883.472] -- 0:00:47
354500 -- [-885.209] (-885.302) (-887.076) (-889.703) * (-883.804) (-884.429) (-884.587) [-883.205] -- 0:00:47
355000 -- [-884.354] (-885.085) (-889.397) (-883.389) * (-886.568) (-886.063) [-884.415] (-885.501) -- 0:00:47
Average standard deviation of split frequencies: 0.009931
355500 -- (-883.320) (-885.209) [-886.160] (-883.279) * (-887.636) (-884.486) [-885.835] (-885.297) -- 0:00:47
356000 -- (-886.923) (-887.364) (-884.226) [-884.455] * (-889.593) [-885.097] (-884.301) (-884.990) -- 0:00:47
356500 -- (-885.545) (-885.343) (-885.587) [-883.361] * [-884.555] (-883.361) (-885.294) (-885.228) -- 0:00:46
357000 -- (-885.670) [-889.537] (-885.323) (-885.361) * [-885.429] (-884.785) (-884.618) (-885.164) -- 0:00:46
357500 -- (-886.862) (-885.296) [-885.811] (-886.883) * (-884.575) (-886.563) [-887.407] (-885.996) -- 0:00:46
358000 -- [-884.772] (-884.942) (-885.606) (-885.656) * [-883.419] (-887.085) (-885.391) (-886.301) -- 0:00:46
358500 -- (-885.842) [-888.858] (-884.795) (-885.056) * [-886.761] (-889.228) (-883.228) (-885.573) -- 0:00:46
359000 -- (-886.999) (-884.667) (-884.389) [-885.070] * (-884.472) (-888.970) [-883.086] (-883.748) -- 0:00:46
359500 -- (-883.267) [-883.669] (-885.447) (-884.427) * (-887.519) [-884.982] (-884.485) (-886.391) -- 0:00:46
360000 -- (-885.723) (-884.461) (-887.143) [-885.478] * (-887.882) [-885.744] (-884.117) (-889.277) -- 0:00:46
Average standard deviation of split frequencies: 0.008659
360500 -- (-891.181) (-883.861) (-887.631) [-884.369] * (-885.159) (-883.648) (-884.921) [-883.849] -- 0:00:46
361000 -- (-889.262) (-884.661) [-884.773] (-885.500) * (-884.712) (-884.706) [-884.813] (-883.883) -- 0:00:46
361500 -- (-885.532) (-883.805) (-886.283) [-886.653] * (-885.422) (-884.646) [-883.687] (-886.645) -- 0:00:45
362000 -- (-888.507) (-883.828) [-883.569] (-894.704) * [-890.310] (-883.725) (-883.488) (-884.135) -- 0:00:45
362500 -- [-884.839] (-883.479) (-884.721) (-893.170) * [-883.020] (-883.246) (-886.421) (-884.164) -- 0:00:45
363000 -- (-884.769) (-885.206) (-884.493) [-885.580] * (-883.433) [-885.506] (-885.143) (-884.158) -- 0:00:45
363500 -- [-884.873] (-885.395) (-883.261) (-883.446) * [-883.034] (-883.273) (-887.964) (-886.268) -- 0:00:45
364000 -- (-884.997) (-885.446) (-885.563) [-884.567] * (-885.682) (-885.148) (-886.466) [-883.942] -- 0:00:45
364500 -- (-885.763) [-883.863] (-889.081) (-888.894) * (-883.534) (-885.795) [-883.961] (-884.198) -- 0:00:45
365000 -- [-884.942] (-886.329) (-886.340) (-885.763) * (-883.444) (-884.084) [-882.963] (-885.194) -- 0:00:45
Average standard deviation of split frequencies: 0.008050
365500 -- [-883.352] (-884.650) (-887.300) (-886.471) * (-884.075) [-888.270] (-883.093) (-888.134) -- 0:00:46
366000 -- (-883.982) (-884.971) [-884.647] (-885.707) * [-886.893] (-883.595) (-885.527) (-886.953) -- 0:00:46
366500 -- [-882.934] (-884.988) (-888.632) (-888.760) * [-886.718] (-884.254) (-884.142) (-884.536) -- 0:00:46
367000 -- (-889.218) (-886.168) (-887.425) [-892.890] * (-887.033) (-885.281) (-887.664) [-884.465] -- 0:00:46
367500 -- (-887.358) (-885.941) [-886.005] (-888.668) * (-886.669) (-885.835) [-887.836] (-892.432) -- 0:00:46
368000 -- (-886.333) (-884.152) [-886.223] (-884.622) * (-886.005) (-884.264) (-891.718) [-885.784] -- 0:00:46
368500 -- [-884.190] (-886.020) (-889.177) (-885.302) * (-884.661) [-888.482] (-889.035) (-886.131) -- 0:00:46
369000 -- (-883.816) (-887.197) [-884.634] (-883.235) * (-883.663) (-884.895) [-883.217] (-887.264) -- 0:00:46
369500 -- [-884.061] (-886.444) (-886.254) (-884.402) * [-882.864] (-884.043) (-883.939) (-884.145) -- 0:00:46
370000 -- (-884.964) (-893.086) (-884.561) [-887.235] * [-883.608] (-884.278) (-883.952) (-886.590) -- 0:00:45
Average standard deviation of split frequencies: 0.008664
370500 -- [-885.363] (-886.788) (-883.286) (-885.906) * (-884.414) (-884.118) [-884.509] (-885.711) -- 0:00:45
371000 -- (-890.488) [-882.891] (-883.163) (-887.635) * (-889.580) [-884.006] (-889.081) (-885.736) -- 0:00:45
371500 -- [-888.719] (-883.132) (-887.016) (-884.642) * (-888.563) [-885.707] (-888.183) (-886.328) -- 0:00:45
372000 -- (-886.815) (-884.648) (-889.483) [-886.257] * (-887.673) (-888.101) (-883.398) [-889.046] -- 0:00:45
372500 -- (-886.520) (-883.979) [-883.665] (-886.483) * [-885.045] (-885.406) (-883.633) (-884.104) -- 0:00:45
373000 -- (-888.246) [-885.060] (-883.125) (-887.308) * (-885.170) (-884.790) [-884.163] (-885.692) -- 0:00:45
373500 -- (-885.647) [-886.048] (-886.491) (-884.436) * (-889.769) [-883.782] (-886.314) (-885.131) -- 0:00:45
374000 -- (-895.609) (-886.516) (-884.012) [-883.682] * (-885.217) [-883.537] (-884.779) (-889.968) -- 0:00:45
374500 -- (-893.028) (-884.326) (-885.439) [-883.325] * [-885.604] (-890.722) (-888.699) (-888.155) -- 0:00:45
375000 -- (-883.512) (-887.477) (-884.567) [-885.105] * (-883.374) (-890.419) (-886.803) [-886.384] -- 0:00:45
Average standard deviation of split frequencies: 0.008384
375500 -- [-883.213] (-884.764) (-884.834) (-888.383) * (-886.213) (-885.963) (-884.375) [-882.968] -- 0:00:44
376000 -- [-883.101] (-886.191) (-884.032) (-890.430) * (-884.679) (-884.280) [-884.107] (-885.320) -- 0:00:44
376500 -- [-883.979] (-888.970) (-882.675) (-884.363) * (-886.689) (-887.129) [-884.002] (-883.999) -- 0:00:44
377000 -- (-884.387) (-886.721) (-884.006) [-886.775] * (-883.266) (-889.424) [-885.300] (-883.711) -- 0:00:44
377500 -- (-884.833) [-885.493] (-885.906) (-884.902) * (-888.902) (-883.524) (-883.738) [-886.503] -- 0:00:44
378000 -- (-886.623) (-884.318) [-883.796] (-886.329) * [-884.700] (-889.903) (-883.287) (-882.975) -- 0:00:44
378500 -- (-889.315) (-885.638) [-883.918] (-886.618) * (-885.169) [-889.034] (-885.262) (-883.151) -- 0:00:44
379000 -- [-883.966] (-885.058) (-883.732) (-887.001) * (-886.002) (-887.011) (-886.315) [-883.628] -- 0:00:45
379500 -- (-885.334) [-883.342] (-884.744) (-886.414) * (-884.648) (-885.428) [-884.368] (-883.692) -- 0:00:45
380000 -- (-884.424) (-883.767) (-884.557) [-884.029] * [-885.710] (-884.858) (-888.140) (-884.217) -- 0:00:45
Average standard deviation of split frequencies: 0.008436
380500 -- [-885.927] (-887.965) (-883.792) (-883.899) * [-884.677] (-883.706) (-884.379) (-885.823) -- 0:00:45
381000 -- (-883.649) (-888.987) [-886.397] (-883.919) * (-883.319) [-883.983] (-885.687) (-886.934) -- 0:00:45
381500 -- (-884.619) (-885.496) [-886.704] (-884.072) * (-884.034) (-883.348) (-885.673) [-887.723] -- 0:00:45
382000 -- (-883.889) (-883.531) [-882.964] (-884.255) * (-885.372) (-885.865) [-883.794] (-886.585) -- 0:00:45
382500 -- (-887.256) (-884.775) [-884.706] (-888.476) * (-890.138) (-889.896) [-883.836] (-882.905) -- 0:00:45
383000 -- (-886.002) (-885.162) [-884.042] (-884.753) * [-886.956] (-884.387) (-884.334) (-886.187) -- 0:00:45
383500 -- [-885.091] (-887.712) (-883.774) (-885.586) * [-884.940] (-885.752) (-886.700) (-889.274) -- 0:00:45
384000 -- (-885.730) (-885.781) [-883.881] (-884.916) * (-884.640) [-885.680] (-885.298) (-888.446) -- 0:00:44
384500 -- [-888.413] (-888.137) (-883.915) (-885.474) * (-887.649) (-887.034) (-887.315) [-884.652] -- 0:00:44
385000 -- (-887.308) (-888.733) [-886.220] (-885.257) * (-886.379) (-887.246) (-885.343) [-884.379] -- 0:00:44
Average standard deviation of split frequencies: 0.008014
385500 -- (-885.579) [-886.376] (-888.506) (-887.044) * (-886.502) (-885.148) [-884.134] (-885.884) -- 0:00:44
386000 -- (-885.035) (-884.783) [-886.350] (-888.897) * [-886.752] (-884.066) (-886.745) (-884.148) -- 0:00:44
386500 -- (-887.086) (-884.783) (-886.822) [-887.759] * (-883.635) (-885.771) [-885.553] (-883.651) -- 0:00:44
387000 -- (-882.982) (-887.450) (-885.453) [-884.686] * [-886.938] (-888.914) (-884.366) (-883.874) -- 0:00:44
387500 -- [-884.429] (-884.180) (-884.316) (-889.088) * [-885.809] (-884.446) (-884.522) (-884.343) -- 0:00:44
388000 -- (-887.102) [-885.067] (-883.685) (-884.146) * (-886.238) (-883.147) (-885.862) [-883.717] -- 0:00:44
388500 -- (-884.103) [-884.735] (-885.664) (-884.086) * (-883.780) [-883.569] (-886.832) (-885.384) -- 0:00:44
389000 -- [-883.527] (-893.725) (-887.102) (-883.195) * (-888.313) (-884.765) (-884.430) [-885.826] -- 0:00:43
389500 -- [-883.630] (-890.201) (-887.244) (-885.295) * (-886.683) (-885.913) (-884.556) [-884.266] -- 0:00:43
390000 -- (-886.259) [-885.016] (-884.141) (-886.764) * (-884.975) [-885.371] (-885.019) (-882.959) -- 0:00:43
Average standard deviation of split frequencies: 0.008145
390500 -- [-882.793] (-884.439) (-884.369) (-886.717) * [-883.342] (-885.764) (-885.862) (-883.618) -- 0:00:43
391000 -- (-884.171) (-883.960) (-885.476) [-885.603] * [-883.480] (-886.809) (-886.586) (-884.512) -- 0:00:43
391500 -- (-886.903) [-885.149] (-884.460) (-888.462) * [-883.188] (-891.871) (-887.794) (-885.959) -- 0:00:43
392000 -- (-885.767) (-886.775) [-883.987] (-888.056) * (-884.453) (-885.226) [-883.652] (-883.609) -- 0:00:44
392500 -- (-886.347) (-885.481) (-885.325) [-883.399] * (-884.538) (-890.372) (-884.955) [-883.965] -- 0:00:44
393000 -- (-888.038) (-886.474) [-884.382] (-885.826) * (-887.067) (-886.520) [-888.797] (-883.554) -- 0:00:44
393500 -- [-884.507] (-883.566) (-884.760) (-888.070) * [-885.515] (-883.977) (-887.253) (-883.762) -- 0:00:44
394000 -- (-886.881) [-883.061] (-884.191) (-884.256) * (-884.355) [-883.301] (-887.733) (-884.061) -- 0:00:44
394500 -- [-886.290] (-884.065) (-887.802) (-882.898) * (-887.134) (-883.939) (-886.396) [-885.817] -- 0:00:44
395000 -- (-884.297) (-884.801) (-885.705) [-883.111] * (-885.387) (-884.861) (-884.704) [-885.964] -- 0:00:44
Average standard deviation of split frequencies: 0.008035
395500 -- (-884.306) (-886.380) [-886.788] (-883.503) * (-884.666) [-884.517] (-886.537) (-886.802) -- 0:00:44
396000 -- (-885.021) (-886.767) [-883.695] (-886.446) * (-883.791) (-884.239) (-885.494) [-889.274] -- 0:00:44
396500 -- [-885.174] (-885.453) (-885.691) (-887.751) * (-882.800) [-883.454] (-885.455) (-885.434) -- 0:00:44
397000 -- (-884.407) (-886.716) (-885.726) [-885.159] * (-884.408) (-884.235) (-885.983) [-885.935] -- 0:00:44
397500 -- (-885.840) [-884.225] (-887.701) (-886.109) * (-885.129) [-884.452] (-883.813) (-883.355) -- 0:00:43
398000 -- (-886.592) [-882.793] (-883.672) (-883.868) * (-888.166) (-883.477) [-883.820] (-885.173) -- 0:00:43
398500 -- (-887.199) [-883.250] (-883.727) (-885.277) * [-884.528] (-885.146) (-884.915) (-885.708) -- 0:00:43
399000 -- (-887.860) [-883.016] (-885.161) (-884.337) * (-883.853) [-886.115] (-886.279) (-884.432) -- 0:00:43
399500 -- (-884.940) (-883.767) (-884.421) [-883.057] * (-886.041) (-886.380) [-883.769] (-885.301) -- 0:00:43
400000 -- (-884.820) (-886.850) (-884.787) [-886.180] * (-885.698) (-885.397) (-886.124) [-882.971] -- 0:00:43
Average standard deviation of split frequencies: 0.008530
400500 -- (-885.152) (-886.654) (-886.343) [-886.847] * (-885.275) (-884.561) [-883.423] (-886.608) -- 0:00:43
401000 -- (-883.420) [-884.306] (-886.265) (-891.529) * [-886.962] (-887.586) (-885.941) (-884.882) -- 0:00:43
401500 -- [-885.002] (-887.965) (-885.631) (-888.203) * (-884.852) [-887.753] (-884.952) (-886.292) -- 0:00:43
402000 -- (-883.904) [-887.190] (-885.641) (-889.037) * (-886.437) (-885.696) [-882.802] (-885.964) -- 0:00:43
402500 -- [-884.498] (-886.326) (-883.957) (-886.169) * (-886.446) [-886.147] (-884.292) (-885.595) -- 0:00:43
403000 -- [-884.314] (-885.706) (-883.460) (-891.805) * (-883.929) (-889.794) (-883.813) [-886.156] -- 0:00:42
403500 -- (-886.321) (-885.218) [-884.028] (-887.620) * [-884.542] (-885.083) (-888.067) (-883.735) -- 0:00:42
404000 -- (-886.643) [-885.914] (-886.109) (-885.179) * [-885.528] (-887.347) (-890.209) (-884.680) -- 0:00:42
404500 -- [-886.177] (-883.182) (-885.012) (-884.951) * [-883.523] (-884.645) (-884.435) (-887.563) -- 0:00:42
405000 -- (-885.141) (-885.704) (-885.993) [-883.596] * (-885.537) [-889.437] (-886.097) (-885.395) -- 0:00:42
Average standard deviation of split frequencies: 0.008055
405500 -- (-885.771) (-887.198) (-892.171) [-883.217] * (-884.110) [-885.470] (-887.368) (-887.639) -- 0:00:42
406000 -- [-883.798] (-886.358) (-890.361) (-884.151) * [-887.421] (-884.946) (-887.447) (-883.950) -- 0:00:43
406500 -- (-886.330) (-885.345) (-886.534) [-883.516] * (-888.132) (-884.033) (-889.103) [-884.906] -- 0:00:43
407000 -- (-886.649) (-886.096) [-883.064] (-885.429) * [-886.417] (-885.665) (-885.949) (-884.116) -- 0:00:43
407500 -- (-884.450) (-889.059) (-883.027) [-884.976] * [-884.707] (-888.856) (-884.522) (-884.262) -- 0:00:43
408000 -- (-889.976) (-887.865) (-884.157) [-884.726] * [-883.361] (-883.606) (-887.543) (-883.841) -- 0:00:43
408500 -- (-889.516) [-885.564] (-884.190) (-884.516) * [-883.285] (-884.681) (-885.664) (-883.138) -- 0:00:43
409000 -- (-889.930) [-885.852] (-884.846) (-884.642) * [-887.775] (-886.990) (-884.072) (-888.106) -- 0:00:43
409500 -- (-887.100) (-884.820) (-885.894) [-884.058] * [-885.257] (-884.027) (-884.028) (-886.796) -- 0:00:43
410000 -- [-886.828] (-884.166) (-885.038) (-884.958) * (-883.246) (-885.480) (-886.835) [-883.268] -- 0:00:43
Average standard deviation of split frequencies: 0.007246
410500 -- [-888.908] (-886.251) (-884.991) (-884.993) * (-886.990) (-885.765) (-885.763) [-883.251] -- 0:00:43
411000 -- [-886.060] (-888.045) (-883.288) (-887.069) * (-884.677) (-887.034) (-883.422) [-883.221] -- 0:00:42
411500 -- [-886.458] (-884.369) (-883.359) (-884.538) * [-884.640] (-885.273) (-884.306) (-884.334) -- 0:00:42
412000 -- (-883.885) [-888.494] (-883.359) (-884.110) * (-883.828) (-886.845) (-885.008) [-885.029] -- 0:00:42
412500 -- [-885.334] (-884.209) (-887.687) (-884.589) * (-883.426) (-891.837) [-886.350] (-889.308) -- 0:00:42
413000 -- (-885.300) (-886.807) [-889.390] (-887.179) * (-885.231) (-888.442) (-884.399) [-885.100] -- 0:00:42
413500 -- (-885.642) (-885.939) [-888.997] (-887.195) * (-883.905) [-884.767] (-883.486) (-886.368) -- 0:00:42
414000 -- (-883.525) [-884.772] (-886.777) (-885.012) * (-884.864) (-883.916) [-882.982] (-884.016) -- 0:00:42
414500 -- (-883.258) [-883.113] (-885.247) (-884.099) * (-884.981) (-883.635) [-884.999] (-886.550) -- 0:00:42
415000 -- (-885.677) (-884.835) [-882.652] (-886.518) * (-891.912) (-884.094) [-884.332] (-885.896) -- 0:00:42
Average standard deviation of split frequencies: 0.007437
415500 -- (-888.138) (-883.452) (-887.285) [-885.452] * [-883.964] (-886.987) (-888.500) (-885.634) -- 0:00:42
416000 -- [-884.055] (-885.339) (-884.212) (-884.150) * (-883.476) [-884.870] (-887.097) (-885.065) -- 0:00:42
416500 -- (-885.159) (-885.745) (-885.946) [-885.272] * [-888.505] (-885.530) (-885.888) (-888.010) -- 0:00:42
417000 -- (-886.784) (-885.098) [-887.222] (-885.450) * (-883.676) [-886.265] (-885.255) (-883.917) -- 0:00:41
417500 -- (-885.939) (-886.934) (-886.278) [-884.694] * (-884.167) (-887.150) [-889.024] (-885.678) -- 0:00:41
418000 -- (-885.283) (-883.539) (-884.319) [-884.082] * (-883.999) [-883.873] (-887.765) (-883.385) -- 0:00:41
418500 -- (-887.343) [-884.904] (-883.680) (-884.420) * (-885.220) (-886.439) [-885.085] (-885.334) -- 0:00:41
419000 -- (-883.007) (-883.774) (-887.943) [-884.199] * [-884.095] (-886.978) (-889.734) (-885.294) -- 0:00:41
419500 -- [-886.472] (-889.771) (-887.114) (-886.874) * (-882.888) [-883.932] (-887.359) (-886.043) -- 0:00:42
420000 -- (-883.700) [-888.173] (-886.665) (-888.426) * (-883.739) (-883.222) [-885.013] (-883.193) -- 0:00:42
Average standard deviation of split frequencies: 0.008124
420500 -- (-886.992) (-886.721) [-885.377] (-886.013) * (-884.592) (-884.658) [-886.408] (-883.479) -- 0:00:42
421000 -- (-883.747) (-888.396) [-889.376] (-885.368) * (-885.576) (-885.594) [-884.168] (-885.339) -- 0:00:42
421500 -- (-885.339) [-887.803] (-885.660) (-887.649) * (-886.432) [-883.757] (-888.321) (-884.247) -- 0:00:42
422000 -- (-884.220) (-885.308) (-890.246) [-885.365] * (-887.067) [-885.448] (-883.911) (-886.137) -- 0:00:42
422500 -- [-886.529] (-885.693) (-888.882) (-883.452) * (-889.966) (-884.852) (-886.918) [-883.591] -- 0:00:42
423000 -- (-884.409) (-882.755) [-883.790] (-884.651) * (-887.697) (-883.146) [-886.849] (-884.952) -- 0:00:42
423500 -- [-887.149] (-884.765) (-884.005) (-886.045) * (-883.445) (-883.770) (-888.411) [-883.924] -- 0:00:42
424000 -- (-883.212) (-889.755) [-883.807] (-883.935) * [-882.865] (-889.231) (-884.589) (-884.881) -- 0:00:42
424500 -- (-890.637) (-886.573) [-885.583] (-884.447) * [-886.121] (-888.184) (-884.093) (-886.498) -- 0:00:42
425000 -- (-889.985) [-883.878] (-885.558) (-886.355) * [-884.740] (-885.583) (-882.909) (-883.431) -- 0:00:41
Average standard deviation of split frequencies: 0.006778
425500 -- (-885.781) (-884.540) (-885.044) [-883.318] * (-883.148) (-884.388) [-885.396] (-884.538) -- 0:00:41
426000 -- (-887.494) (-888.605) (-888.939) [-883.832] * (-883.873) (-886.057) (-884.447) [-884.684] -- 0:00:41
426500 -- [-883.894] (-886.887) (-886.245) (-885.166) * (-883.612) (-884.531) (-884.479) [-884.836] -- 0:00:41
427000 -- (-884.318) (-887.125) [-885.606] (-885.006) * (-885.460) [-886.197] (-884.793) (-882.992) -- 0:00:41
427500 -- (-884.820) (-886.157) [-883.897] (-885.706) * (-885.293) (-885.839) (-883.171) [-884.521] -- 0:00:41
428000 -- [-884.381] (-888.726) (-883.893) (-883.950) * (-884.935) [-885.007] (-883.708) (-884.273) -- 0:00:41
428500 -- (-883.972) [-886.712] (-883.686) (-884.274) * (-886.326) (-884.301) (-885.304) [-883.972] -- 0:00:41
429000 -- (-884.068) (-887.847) [-882.993] (-885.754) * (-884.458) (-885.182) (-888.428) [-883.129] -- 0:00:41
429500 -- [-885.489] (-885.723) (-883.356) (-883.513) * [-883.327] (-885.301) (-884.000) (-885.735) -- 0:00:41
430000 -- (-888.771) [-886.906] (-889.162) (-884.648) * (-887.778) [-886.152] (-884.761) (-883.964) -- 0:00:41
Average standard deviation of split frequencies: 0.007252
430500 -- (-883.034) [-885.102] (-884.090) (-887.203) * (-889.576) [-884.720] (-890.280) (-884.117) -- 0:00:41
431000 -- (-883.959) (-884.917) [-885.607] (-885.809) * (-883.545) [-884.577] (-885.509) (-883.622) -- 0:00:40
431500 -- [-885.842] (-883.959) (-883.943) (-884.901) * [-885.711] (-883.455) (-883.612) (-883.364) -- 0:00:40
432000 -- [-886.089] (-885.633) (-884.500) (-883.787) * (-887.129) [-884.441] (-883.363) (-883.192) -- 0:00:40
432500 -- (-885.823) (-883.753) [-886.641] (-884.058) * (-886.885) (-884.427) (-887.430) [-887.216] -- 0:00:40
433000 -- (-883.689) (-884.131) [-884.174] (-885.780) * (-886.404) [-885.062] (-888.504) (-886.286) -- 0:00:40
433500 -- [-886.183] (-885.256) (-884.922) (-884.588) * (-885.082) [-885.371] (-885.195) (-885.679) -- 0:00:41
434000 -- [-884.390] (-884.992) (-884.000) (-891.160) * (-890.811) (-887.384) [-883.984] (-886.313) -- 0:00:41
434500 -- (-883.616) (-887.245) [-884.190] (-886.286) * [-885.775] (-886.871) (-883.902) (-886.559) -- 0:00:41
435000 -- [-884.186] (-883.618) (-884.686) (-887.787) * (-884.675) (-885.349) (-887.544) [-883.914] -- 0:00:41
Average standard deviation of split frequencies: 0.007298
435500 -- (-885.447) (-883.621) [-884.526] (-883.925) * (-885.403) (-883.672) [-885.629] (-888.415) -- 0:00:41
436000 -- (-887.710) [-887.046] (-884.369) (-887.871) * (-887.558) (-890.543) [-888.167] (-883.247) -- 0:00:41
436500 -- (-885.860) [-883.466] (-883.776) (-887.343) * (-883.510) (-886.849) [-888.219] (-884.955) -- 0:00:41
437000 -- (-888.859) (-886.156) (-883.747) [-887.552] * [-883.107] (-885.321) (-884.682) (-884.981) -- 0:00:41
437500 -- (-884.970) (-886.912) (-883.834) [-886.970] * (-883.476) [-886.767] (-885.510) (-885.809) -- 0:00:41
438000 -- (-886.497) (-883.286) [-884.417] (-884.869) * [-884.076] (-887.198) (-885.147) (-893.734) -- 0:00:41
438500 -- (-886.926) (-884.289) (-887.031) [-883.822] * (-883.676) (-893.697) [-886.653] (-885.388) -- 0:00:40
439000 -- [-885.470] (-886.892) (-885.206) (-887.134) * [-884.081] (-886.064) (-884.179) (-888.080) -- 0:00:40
439500 -- (-885.861) (-883.925) [-885.773] (-890.896) * [-884.844] (-883.900) (-885.178) (-884.284) -- 0:00:40
440000 -- (-886.632) (-885.376) (-886.460) [-886.059] * [-884.564] (-884.810) (-887.012) (-887.491) -- 0:00:40
Average standard deviation of split frequencies: 0.007154
440500 -- (-885.775) (-886.739) (-887.360) [-886.125] * (-883.689) [-885.806] (-888.666) (-885.600) -- 0:00:40
441000 -- [-886.882] (-888.362) (-886.418) (-885.810) * [-883.818] (-885.081) (-883.095) (-883.299) -- 0:00:40
441500 -- (-886.471) (-885.914) (-884.496) [-883.855] * (-887.281) [-887.137] (-884.852) (-886.950) -- 0:00:40
442000 -- (-886.893) (-884.808) [-883.329] (-886.595) * [-883.938] (-884.297) (-885.112) (-883.398) -- 0:00:40
442500 -- [-886.061] (-884.777) (-883.733) (-885.295) * (-883.422) (-884.661) [-885.385] (-882.892) -- 0:00:40
443000 -- (-883.584) (-887.174) (-883.586) [-883.737] * (-884.195) (-887.277) (-886.168) [-882.840] -- 0:00:40
443500 -- (-884.574) (-883.320) (-885.608) [-885.043] * [-882.928] (-887.117) (-883.348) (-882.930) -- 0:00:40
444000 -- (-886.539) (-885.608) (-885.649) [-884.676] * [-882.759] (-884.970) (-885.878) (-884.291) -- 0:00:40
444500 -- (-884.409) (-884.152) [-885.001] (-885.116) * [-884.978] (-885.674) (-883.585) (-885.479) -- 0:00:39
445000 -- (-884.141) (-883.145) [-885.700] (-885.056) * (-885.466) (-885.675) (-888.389) [-882.672] -- 0:00:39
Average standard deviation of split frequencies: 0.007993
445500 -- (-888.572) (-884.667) (-891.078) [-887.790] * (-885.059) [-883.983] (-885.595) (-884.062) -- 0:00:39
446000 -- (-885.491) (-890.362) [-883.860] (-885.695) * (-886.491) (-884.713) [-883.391] (-886.534) -- 0:00:39
446500 -- (-883.180) (-885.684) [-886.820] (-884.292) * (-890.529) (-885.110) (-884.500) [-884.269] -- 0:00:39
447000 -- [-883.987] (-885.089) (-888.730) (-884.663) * (-884.530) (-883.017) [-887.438] (-882.951) -- 0:00:39
447500 -- [-884.354] (-884.540) (-883.006) (-883.867) * (-884.829) (-883.525) [-884.373] (-885.646) -- 0:00:40
448000 -- (-883.659) [-889.147] (-884.460) (-884.286) * (-886.555) [-884.705] (-884.551) (-887.610) -- 0:00:40
448500 -- (-885.899) (-887.322) (-883.910) [-883.851] * [-883.055] (-884.070) (-884.452) (-885.435) -- 0:00:40
449000 -- (-884.329) [-883.715] (-883.958) (-884.494) * [-884.395] (-885.056) (-884.944) (-886.165) -- 0:00:40
449500 -- (-884.067) (-883.633) [-884.035] (-884.007) * (-883.340) [-883.480] (-886.778) (-884.018) -- 0:00:40
450000 -- (-885.628) [-883.710] (-883.460) (-883.935) * (-885.664) (-885.507) (-887.113) [-884.261] -- 0:00:40
Average standard deviation of split frequencies: 0.007910
450500 -- (-886.490) (-886.544) [-883.250] (-883.895) * [-885.797] (-883.729) (-890.729) (-886.361) -- 0:00:40
451000 -- (-884.114) [-887.810] (-883.856) (-883.808) * (-885.764) (-883.673) (-886.761) [-887.955] -- 0:00:40
451500 -- (-884.102) [-885.255] (-883.600) (-884.495) * [-887.069] (-883.505) (-890.671) (-885.773) -- 0:00:40
452000 -- (-886.658) (-885.853) [-883.944] (-884.058) * (-885.428) (-883.469) (-885.943) [-885.107] -- 0:00:40
452500 -- [-887.361] (-882.706) (-887.373) (-884.081) * (-885.254) [-887.002] (-884.267) (-884.660) -- 0:00:39
453000 -- (-887.869) (-883.206) [-883.803] (-887.446) * (-891.070) (-885.943) [-882.862] (-886.287) -- 0:00:39
453500 -- (-887.075) [-884.465] (-884.449) (-883.167) * (-886.928) [-887.625] (-883.706) (-885.415) -- 0:00:39
454000 -- [-887.200] (-884.292) (-884.809) (-883.484) * [-885.171] (-885.088) (-883.667) (-886.774) -- 0:00:39
454500 -- (-891.690) (-886.074) [-891.785] (-884.445) * (-884.217) (-883.921) [-883.636] (-888.613) -- 0:00:39
455000 -- (-887.701) (-888.649) (-885.981) [-885.211] * (-885.239) [-883.496] (-883.934) (-884.675) -- 0:00:39
Average standard deviation of split frequencies: 0.008206
455500 -- (-885.644) (-885.012) (-883.818) [-890.989] * [-888.249] (-887.108) (-883.230) (-883.562) -- 0:00:39
456000 -- (-883.961) (-886.913) [-885.314] (-885.630) * (-889.479) (-886.446) [-883.611] (-884.066) -- 0:00:39
456500 -- (-887.081) (-883.870) (-884.844) [-886.047] * (-885.743) [-887.186] (-885.344) (-885.245) -- 0:00:39
457000 -- (-884.541) (-883.397) [-883.289] (-884.182) * (-886.565) (-888.432) [-884.088] (-888.728) -- 0:00:39
457500 -- [-884.302] (-883.552) (-884.868) (-884.145) * [-885.403] (-885.715) (-886.856) (-887.985) -- 0:00:39
458000 -- (-884.557) [-887.950] (-887.580) (-884.666) * (-883.701) [-883.888] (-886.132) (-886.623) -- 0:00:39
458500 -- (-887.072) (-883.574) [-883.960] (-884.893) * (-887.775) (-885.174) [-885.447] (-883.856) -- 0:00:38
459000 -- (-886.884) (-883.167) [-886.117] (-884.159) * (-884.039) [-883.483] (-887.138) (-883.245) -- 0:00:38
459500 -- (-885.909) [-885.268] (-884.655) (-884.697) * (-884.891) (-885.143) (-883.103) [-883.232] -- 0:00:38
460000 -- [-890.203] (-883.605) (-887.188) (-885.552) * (-884.693) (-886.490) [-889.156] (-885.124) -- 0:00:38
Average standard deviation of split frequencies: 0.008186
460500 -- (-883.769) [-883.835] (-884.935) (-889.970) * (-884.266) [-885.053] (-884.445) (-883.329) -- 0:00:38
461000 -- [-884.230] (-885.822) (-890.430) (-886.045) * (-884.478) (-888.522) [-884.482] (-883.646) -- 0:00:38
461500 -- [-885.666] (-883.840) (-884.773) (-884.743) * (-887.044) (-884.726) [-883.603] (-888.520) -- 0:00:39
462000 -- (-884.282) (-885.332) (-886.847) [-884.872] * (-883.721) [-883.932] (-886.040) (-884.272) -- 0:00:39
462500 -- (-883.387) (-885.217) (-883.752) [-884.390] * (-883.902) (-884.879) (-884.631) [-884.230] -- 0:00:39
463000 -- (-883.270) [-885.396] (-884.464) (-883.472) * (-883.839) [-885.925] (-884.195) (-883.236) -- 0:00:39
463500 -- [-884.112] (-885.722) (-888.921) (-883.884) * (-884.628) (-883.484) [-885.662] (-882.866) -- 0:00:39
464000 -- (-883.231) (-883.334) (-885.416) [-883.478] * (-886.061) (-885.610) (-889.254) [-883.965] -- 0:00:39
464500 -- [-883.476] (-883.423) (-884.662) (-883.210) * (-883.812) (-886.137) (-884.923) [-884.245] -- 0:00:39
465000 -- [-883.851] (-884.027) (-883.989) (-884.050) * (-886.185) (-892.849) (-883.700) [-883.737] -- 0:00:39
Average standard deviation of split frequencies: 0.008219
465500 -- (-884.493) [-885.842] (-883.688) (-884.823) * (-884.110) (-883.790) (-883.705) [-884.786] -- 0:00:39
466000 -- (-884.940) (-886.028) [-883.803] (-885.158) * (-886.454) (-882.791) [-883.706] (-884.797) -- 0:00:38
466500 -- (-884.860) (-883.045) [-885.262] (-883.273) * (-888.037) (-884.165) (-885.359) [-885.438] -- 0:00:38
467000 -- (-884.926) (-883.621) [-884.255] (-884.414) * [-885.802] (-883.783) (-887.260) (-890.904) -- 0:00:38
467500 -- (-886.165) [-883.542] (-885.824) (-884.058) * (-884.319) [-886.500] (-883.674) (-884.995) -- 0:00:38
468000 -- (-885.608) (-885.318) (-884.660) [-885.146] * (-885.343) [-884.053] (-885.788) (-884.341) -- 0:00:38
468500 -- (-883.292) (-883.900) [-884.048] (-886.709) * (-887.087) (-886.842) (-887.392) [-883.494] -- 0:00:38
469000 -- [-883.763] (-884.396) (-883.723) (-884.239) * (-884.854) (-891.364) [-885.670] (-886.449) -- 0:00:38
469500 -- (-883.647) [-885.324] (-882.966) (-885.286) * (-884.511) [-885.765] (-884.679) (-887.705) -- 0:00:38
470000 -- (-886.730) [-886.106] (-884.132) (-885.303) * (-886.530) (-886.243) [-884.699] (-883.302) -- 0:00:38
Average standard deviation of split frequencies: 0.007387
470500 -- (-891.923) (-883.212) [-882.664] (-883.587) * (-885.417) (-883.501) [-887.979] (-883.241) -- 0:00:38
471000 -- (-886.212) (-883.872) [-883.010] (-885.189) * (-884.322) (-885.498) [-889.293] (-885.905) -- 0:00:38
471500 -- (-885.484) [-883.747] (-883.292) (-886.529) * (-884.014) (-886.544) (-889.961) [-886.296] -- 0:00:38
472000 -- [-884.867] (-891.063) (-886.591) (-885.595) * (-883.126) [-886.853] (-888.526) (-885.597) -- 0:00:38
472500 -- (-887.579) (-884.532) (-885.036) [-884.675] * (-882.933) [-883.078] (-885.664) (-883.930) -- 0:00:37
473000 -- (-883.613) (-885.381) [-887.873] (-884.520) * (-882.810) [-882.833] (-884.103) (-885.164) -- 0:00:37
473500 -- (-885.071) [-883.136] (-888.184) (-884.257) * (-884.525) (-885.334) [-886.012] (-883.153) -- 0:00:37
474000 -- (-885.358) [-883.373] (-887.905) (-884.772) * (-886.666) (-884.082) [-887.142] (-884.233) -- 0:00:37
474500 -- (-885.707) (-886.412) (-884.485) [-884.337] * [-884.475] (-886.476) (-883.459) (-883.101) -- 0:00:37
475000 -- (-885.392) (-887.714) (-888.731) [-888.211] * (-883.269) [-885.535] (-883.813) (-884.815) -- 0:00:37
Average standard deviation of split frequencies: 0.007489
475500 -- (-885.385) (-891.038) [-884.920] (-885.372) * (-885.974) (-884.396) [-890.105] (-884.701) -- 0:00:38
476000 -- (-884.935) (-886.440) (-887.041) [-886.353] * (-886.002) [-884.018] (-885.232) (-883.664) -- 0:00:38
476500 -- (-883.614) (-886.649) [-886.739] (-887.085) * (-883.817) [-886.375] (-885.403) (-883.350) -- 0:00:38
477000 -- [-883.645] (-886.122) (-883.448) (-886.097) * [-883.141] (-887.682) (-885.462) (-883.130) -- 0:00:38
477500 -- [-884.755] (-884.336) (-886.639) (-883.801) * (-884.849) (-890.021) [-883.673] (-884.034) -- 0:00:38
478000 -- (-883.314) [-883.628] (-884.579) (-883.448) * (-884.387) (-885.652) (-883.911) [-884.095] -- 0:00:38
478500 -- (-888.475) (-883.555) (-886.359) [-883.630] * (-885.057) (-887.337) [-882.969] (-883.508) -- 0:00:38
479000 -- [-883.843] (-883.579) (-885.891) (-884.531) * (-885.409) (-884.401) (-892.391) [-885.283] -- 0:00:38
479500 -- (-886.607) (-884.133) [-883.970] (-885.449) * (-887.149) [-884.373] (-889.767) (-885.413) -- 0:00:37
480000 -- [-884.751] (-886.596) (-885.905) (-884.983) * (-884.167) (-885.297) [-890.542] (-883.206) -- 0:00:37
Average standard deviation of split frequencies: 0.007049
480500 -- [-886.029] (-885.316) (-883.688) (-885.498) * [-884.306] (-885.092) (-884.324) (-883.372) -- 0:00:37
481000 -- [-884.300] (-884.764) (-885.938) (-884.965) * (-883.818) (-885.299) (-883.692) [-886.001] -- 0:00:37
481500 -- (-887.045) [-885.979] (-883.651) (-883.927) * (-882.937) (-883.743) (-887.089) [-884.213] -- 0:00:37
482000 -- [-884.127] (-884.784) (-884.968) (-884.548) * [-884.340] (-883.628) (-885.262) (-890.758) -- 0:00:37
482500 -- [-883.722] (-884.857) (-885.369) (-884.946) * [-884.629] (-884.353) (-888.848) (-889.612) -- 0:00:37
483000 -- (-883.715) (-883.097) [-888.858] (-885.816) * [-884.485] (-883.693) (-888.713) (-888.020) -- 0:00:37
483500 -- (-887.678) (-883.879) (-884.504) [-886.831] * (-884.264) (-885.178) [-888.352] (-887.306) -- 0:00:37
484000 -- (-884.602) (-888.843) [-887.039] (-885.862) * [-885.707] (-884.833) (-886.902) (-884.106) -- 0:00:37
484500 -- [-883.101] (-888.497) (-886.856) (-888.098) * [-884.263] (-883.628) (-884.870) (-885.560) -- 0:00:37
485000 -- (-883.404) (-886.593) [-888.300] (-886.374) * [-885.374] (-885.705) (-883.342) (-884.171) -- 0:00:37
Average standard deviation of split frequencies: 0.006608
485500 -- [-883.890] (-890.085) (-886.779) (-885.366) * (-888.956) [-885.011] (-886.082) (-886.149) -- 0:00:37
486000 -- (-884.137) [-885.530] (-887.390) (-886.161) * (-883.632) (-884.694) (-883.358) [-885.023] -- 0:00:37
486500 -- [-884.193] (-886.952) (-886.225) (-883.649) * [-882.791] (-882.835) (-885.169) (-884.157) -- 0:00:36
487000 -- (-885.480) [-884.247] (-883.375) (-883.805) * (-883.040) (-884.905) [-886.424] (-886.854) -- 0:00:36
487500 -- [-885.938] (-887.903) (-882.935) (-883.607) * (-885.944) [-883.285] (-890.857) (-884.107) -- 0:00:36
488000 -- [-884.182] (-885.769) (-885.543) (-885.543) * [-883.705] (-884.175) (-884.449) (-885.399) -- 0:00:36
488500 -- [-884.962] (-886.332) (-889.604) (-887.396) * (-882.942) (-889.660) (-883.821) [-885.454] -- 0:00:37
489000 -- (-884.569) [-886.276] (-888.113) (-886.802) * [-885.189] (-886.015) (-885.215) (-883.645) -- 0:00:37
489500 -- (-883.181) (-887.092) (-887.160) [-889.837] * (-883.497) (-884.941) (-886.799) [-884.321] -- 0:00:37
490000 -- (-886.159) [-883.979] (-885.592) (-883.670) * [-884.514] (-884.243) (-883.622) (-882.629) -- 0:00:37
Average standard deviation of split frequencies: 0.006605
490500 -- (-883.294) [-885.340] (-883.444) (-887.591) * (-885.139) (-882.730) [-884.704] (-882.628) -- 0:00:37
491000 -- (-884.433) [-884.565] (-883.448) (-884.743) * (-886.905) (-887.624) [-883.614] (-883.524) -- 0:00:37
491500 -- (-885.697) [-884.628] (-883.480) (-887.688) * (-888.064) (-885.379) (-886.672) [-884.496] -- 0:00:37
492000 -- (-887.484) [-883.047] (-883.403) (-883.772) * [-883.085] (-884.101) (-885.003) (-886.400) -- 0:00:37
492500 -- (-884.777) [-884.304] (-884.248) (-884.991) * [-884.407] (-884.101) (-886.190) (-889.225) -- 0:00:37
493000 -- [-882.856] (-886.822) (-885.501) (-887.382) * [-883.175] (-884.440) (-883.970) (-883.234) -- 0:00:37
493500 -- (-884.254) (-885.621) [-885.236] (-886.921) * [-884.384] (-883.790) (-884.844) (-885.068) -- 0:00:36
494000 -- (-884.103) (-884.070) [-883.350] (-886.518) * (-883.365) (-887.334) (-889.572) [-884.275] -- 0:00:36
494500 -- (-885.310) [-887.286] (-884.969) (-884.838) * (-887.340) [-884.144] (-885.923) (-887.668) -- 0:00:36
495000 -- (-886.551) (-883.814) [-885.699] (-885.883) * [-884.193] (-884.426) (-884.963) (-887.552) -- 0:00:36
Average standard deviation of split frequencies: 0.006118
495500 -- [-885.289] (-882.951) (-883.707) (-884.687) * (-884.376) (-884.904) (-883.520) [-884.724] -- 0:00:36
496000 -- (-885.969) (-885.754) (-884.578) [-887.543] * (-883.686) [-885.303] (-884.501) (-887.848) -- 0:00:36
496500 -- (-885.528) (-885.230) (-883.338) [-884.487] * [-883.572] (-886.008) (-883.994) (-886.214) -- 0:00:36
497000 -- (-883.343) (-883.677) [-884.107] (-885.648) * (-885.181) (-883.450) [-885.364] (-887.225) -- 0:00:36
497500 -- (-883.365) (-884.611) [-884.392] (-883.649) * (-883.264) [-884.678] (-884.399) (-888.166) -- 0:00:36
498000 -- (-883.264) [-888.294] (-882.655) (-883.371) * (-888.304) (-885.623) [-884.690] (-885.843) -- 0:00:36
498500 -- (-886.187) [-889.218] (-883.982) (-883.992) * (-886.301) (-887.564) [-884.429] (-887.039) -- 0:00:36
499000 -- (-887.994) [-884.160] (-884.961) (-884.362) * [-886.073] (-886.245) (-884.110) (-884.495) -- 0:00:36
499500 -- (-886.796) (-883.469) [-882.817] (-885.347) * (-884.044) (-885.857) (-885.083) [-884.854] -- 0:00:36
500000 -- (-885.061) (-885.234) [-884.747] (-884.790) * [-884.361] (-885.590) (-884.805) (-883.414) -- 0:00:36
Average standard deviation of split frequencies: 0.006179
500500 -- [-884.793] (-885.719) (-884.873) (-883.271) * (-887.317) (-883.905) (-883.256) [-883.250] -- 0:00:35
501000 -- (-886.439) (-884.109) [-886.509] (-885.809) * (-886.699) (-884.772) (-883.278) [-883.895] -- 0:00:35
501500 -- [-883.985] (-884.789) (-884.726) (-885.648) * (-883.668) [-884.780] (-884.188) (-885.613) -- 0:00:35
502000 -- [-884.402] (-884.354) (-884.301) (-884.900) * [-884.173] (-883.816) (-883.929) (-886.685) -- 0:00:35
502500 -- (-884.922) (-887.217) [-886.767] (-884.853) * [-883.851] (-884.906) (-889.030) (-888.132) -- 0:00:36
503000 -- (-889.592) [-883.817] (-883.962) (-885.390) * (-888.994) [-885.896] (-883.885) (-886.778) -- 0:00:36
503500 -- (-886.731) (-883.299) (-885.241) [-884.220] * [-886.573] (-884.324) (-886.228) (-887.691) -- 0:00:36
504000 -- (-883.700) [-884.247] (-885.131) (-887.314) * (-883.235) (-884.178) (-883.584) [-885.732] -- 0:00:36
504500 -- (-883.131) [-886.187] (-883.277) (-889.115) * [-883.343] (-885.090) (-884.410) (-884.619) -- 0:00:36
505000 -- (-884.121) (-883.139) [-882.895] (-886.207) * (-884.301) [-886.171] (-884.339) (-887.469) -- 0:00:36
Average standard deviation of split frequencies: 0.005939
505500 -- (-886.079) [-883.757] (-884.556) (-885.999) * (-886.011) (-885.422) [-890.058] (-885.812) -- 0:00:36
506000 -- [-884.241] (-885.171) (-884.471) (-892.151) * (-891.990) (-885.236) (-885.343) [-883.066] -- 0:00:36
506500 -- [-883.761] (-884.932) (-886.693) (-884.978) * (-885.480) (-886.646) [-885.740] (-884.630) -- 0:00:36
507000 -- (-887.104) [-885.524] (-884.679) (-883.609) * (-887.518) [-886.616] (-887.699) (-883.813) -- 0:00:35
507500 -- (-887.198) (-884.450) (-888.117) [-887.824] * (-890.018) [-884.541] (-885.214) (-885.311) -- 0:00:35
508000 -- [-884.724] (-884.781) (-889.693) (-885.248) * [-886.640] (-889.541) (-885.178) (-886.295) -- 0:00:35
508500 -- [-887.050] (-883.730) (-887.552) (-883.504) * (-885.916) (-886.240) (-888.056) [-884.065] -- 0:00:35
509000 -- (-885.697) (-883.730) (-888.664) [-886.306] * (-886.986) (-890.108) (-886.554) [-882.903] -- 0:00:35
509500 -- (-887.084) (-884.946) (-884.393) [-884.611] * (-885.563) (-884.354) (-884.427) [-883.913] -- 0:00:35
510000 -- (-888.046) [-886.136] (-886.096) (-889.303) * (-883.911) (-883.109) [-883.362] (-884.955) -- 0:00:35
Average standard deviation of split frequencies: 0.006577
510500 -- (-890.983) (-885.486) (-884.042) [-885.452] * (-883.947) (-888.168) (-887.341) [-886.806] -- 0:00:35
511000 -- (-886.484) (-887.646) [-883.498] (-886.158) * (-885.156) (-883.349) [-885.886] (-885.919) -- 0:00:35
511500 -- (-883.107) (-884.018) [-882.940] (-884.717) * (-888.669) (-885.557) (-884.766) [-883.604] -- 0:00:35
512000 -- (-883.600) [-886.147] (-885.752) (-883.423) * (-883.893) (-884.597) (-884.360) [-884.929] -- 0:00:35
512500 -- (-883.640) (-884.348) (-887.747) [-884.138] * (-886.660) (-884.573) (-884.581) [-884.623] -- 0:00:35
513000 -- (-884.589) (-886.552) [-886.328] (-882.848) * [-888.231] (-893.442) (-888.638) (-884.551) -- 0:00:35
513500 -- (-888.019) (-887.601) (-884.260) [-891.927] * [-886.208] (-885.846) (-884.148) (-884.027) -- 0:00:35
514000 -- [-883.537] (-888.954) (-886.547) (-893.882) * (-887.022) (-889.448) (-884.748) [-883.495] -- 0:00:34
514500 -- [-885.346] (-885.942) (-884.027) (-892.708) * [-884.105] (-888.067) (-884.089) (-884.574) -- 0:00:34
515000 -- (-883.747) (-885.324) (-887.132) [-885.261] * (-882.946) (-885.890) (-885.479) [-884.730] -- 0:00:34
Average standard deviation of split frequencies: 0.006338
515500 -- (-886.416) (-884.869) [-883.360] (-887.824) * (-886.412) (-888.536) (-887.149) [-884.187] -- 0:00:34
516000 -- (-883.508) (-886.133) [-884.804] (-884.925) * (-884.120) [-883.072] (-890.660) (-892.675) -- 0:00:35
516500 -- (-885.146) (-882.833) (-885.063) [-884.457] * (-884.063) (-886.386) [-886.083] (-886.450) -- 0:00:35
517000 -- [-885.391] (-884.536) (-884.680) (-884.421) * [-886.720] (-883.729) (-884.072) (-887.396) -- 0:00:35
517500 -- (-886.293) [-882.879] (-885.214) (-888.841) * (-883.994) [-885.514] (-883.513) (-884.155) -- 0:00:35
518000 -- [-884.102] (-883.666) (-889.889) (-887.373) * (-887.001) [-884.595] (-884.148) (-883.397) -- 0:00:35
518500 -- [-884.458] (-883.437) (-889.342) (-887.285) * (-886.169) (-885.331) (-883.443) [-884.086] -- 0:00:35
519000 -- (-884.421) (-886.701) [-886.905] (-885.954) * (-890.101) (-884.683) [-883.366] (-884.901) -- 0:00:35
519500 -- (-885.290) [-886.257] (-883.096) (-883.731) * (-888.659) (-887.225) (-884.773) [-885.668] -- 0:00:35
520000 -- (-883.063) (-885.697) (-883.971) [-887.280] * (-886.699) [-887.202] (-884.912) (-889.141) -- 0:00:35
Average standard deviation of split frequencies: 0.006281
520500 -- (-883.203) (-882.981) [-883.167] (-883.561) * (-885.276) (-884.981) [-884.313] (-883.104) -- 0:00:35
521000 -- (-885.164) [-886.476] (-883.621) (-883.591) * (-887.920) [-884.516] (-887.340) (-882.742) -- 0:00:34
521500 -- (-884.524) [-884.303] (-885.325) (-883.075) * [-883.923] (-887.304) (-885.766) (-883.827) -- 0:00:34
522000 -- (-891.528) (-885.655) (-884.402) [-884.245] * (-884.187) [-883.570] (-885.671) (-883.665) -- 0:00:34
522500 -- (-888.692) (-886.659) (-889.123) [-884.368] * [-885.485] (-883.797) (-887.790) (-884.005) -- 0:00:34
523000 -- [-884.688] (-884.773) (-894.543) (-882.758) * [-885.302] (-884.585) (-884.750) (-890.436) -- 0:00:34
523500 -- (-884.188) (-884.426) (-886.857) [-887.670] * (-884.038) [-883.375] (-882.868) (-890.942) -- 0:00:34
524000 -- (-885.954) (-883.827) [-886.208] (-884.439) * (-885.163) [-884.050] (-883.802) (-885.599) -- 0:00:34
524500 -- (-886.322) (-884.285) (-885.926) [-885.139] * [-886.535] (-883.630) (-883.999) (-887.142) -- 0:00:34
525000 -- (-885.795) [-886.503] (-883.913) (-888.860) * [-884.413] (-884.442) (-886.761) (-884.007) -- 0:00:34
Average standard deviation of split frequencies: 0.005209
525500 -- (-886.039) [-883.651] (-884.949) (-883.905) * (-885.743) (-889.256) [-886.841] (-884.093) -- 0:00:34
526000 -- (-884.311) (-883.384) (-886.425) [-885.573] * (-887.258) (-888.898) [-887.241] (-882.975) -- 0:00:34
526500 -- (-888.326) (-884.518) [-885.028] (-888.970) * (-887.535) (-884.578) [-885.688] (-883.360) -- 0:00:34
527000 -- (-889.293) (-884.894) [-885.758] (-885.042) * (-886.788) (-885.668) [-886.168] (-888.840) -- 0:00:34
527500 -- (-888.352) (-886.730) (-888.675) [-885.662] * (-885.906) (-889.527) (-883.987) [-884.668] -- 0:00:34
528000 -- (-883.432) (-886.646) (-885.921) [-884.580] * [-887.625] (-887.611) (-885.755) (-883.773) -- 0:00:33
528500 -- (-883.993) (-891.642) (-885.801) [-884.631] * (-886.385) [-888.304] (-885.792) (-886.914) -- 0:00:33
529000 -- (-882.853) [-890.746] (-885.868) (-885.540) * (-890.795) [-883.388] (-883.483) (-887.814) -- 0:00:33
529500 -- (-882.929) (-887.877) [-885.483] (-884.722) * (-892.121) [-883.575] (-884.328) (-888.999) -- 0:00:34
530000 -- [-883.972] (-885.497) (-885.457) (-883.783) * (-885.081) [-883.941] (-883.779) (-884.801) -- 0:00:34
Average standard deviation of split frequencies: 0.005274
530500 -- (-883.476) (-887.705) (-884.435) [-885.118] * (-885.023) (-883.779) [-883.511] (-885.082) -- 0:00:34
531000 -- (-887.061) [-883.956] (-886.286) (-887.410) * [-883.952] (-883.264) (-885.008) (-887.259) -- 0:00:34
531500 -- (-886.067) [-886.633] (-887.577) (-885.214) * (-885.739) (-886.874) (-884.961) [-887.502] -- 0:00:34
532000 -- (-884.069) (-887.340) (-886.642) [-886.171] * [-883.909] (-886.919) (-886.432) (-885.755) -- 0:00:34
532500 -- [-886.215] (-885.982) (-886.276) (-883.358) * (-883.656) (-884.846) (-889.031) [-883.544] -- 0:00:34
533000 -- [-883.267] (-887.691) (-884.154) (-885.665) * (-883.142) (-883.913) (-886.596) [-885.777] -- 0:00:34
533500 -- (-887.220) (-893.889) [-886.554] (-891.841) * (-883.142) [-883.643] (-888.069) (-883.669) -- 0:00:34
534000 -- (-886.811) (-886.016) (-884.782) [-886.591] * [-884.617] (-883.505) (-885.321) (-888.895) -- 0:00:34
534500 -- (-884.464) (-886.081) [-885.511] (-887.572) * (-884.007) (-883.766) [-885.103] (-888.036) -- 0:00:33
535000 -- (-883.887) [-886.098] (-888.917) (-887.135) * (-883.086) [-883.550] (-882.890) (-883.029) -- 0:00:33
Average standard deviation of split frequencies: 0.005662
535500 -- (-883.769) (-892.503) (-883.506) [-884.548] * (-883.086) [-882.881] (-883.572) (-884.252) -- 0:00:33
536000 -- (-884.843) (-888.359) (-888.430) [-883.629] * (-882.899) [-885.044] (-884.111) (-885.207) -- 0:00:33
536500 -- (-887.761) (-886.263) (-883.786) [-886.153] * [-885.209] (-883.543) (-887.542) (-883.483) -- 0:00:33
537000 -- (-883.807) (-885.217) [-886.834] (-883.059) * (-884.742) [-884.025] (-884.173) (-886.248) -- 0:00:33
537500 -- (-884.612) [-884.638] (-884.286) (-886.315) * (-884.078) (-885.780) (-884.552) [-888.604] -- 0:00:33
538000 -- (-885.088) (-883.466) (-883.848) [-884.727] * (-885.748) [-890.513] (-884.663) (-889.195) -- 0:00:33
538500 -- (-885.832) (-883.855) [-887.237] (-888.530) * (-883.474) (-888.639) [-888.546] (-885.287) -- 0:00:33
539000 -- (-888.454) [-883.352] (-883.717) (-885.371) * (-884.907) [-885.038] (-886.989) (-885.529) -- 0:00:33
539500 -- (-883.708) (-883.995) [-884.122] (-884.081) * (-884.371) (-883.338) [-887.449] (-887.003) -- 0:00:33
540000 -- (-885.665) (-885.895) (-886.016) [-883.863] * [-884.463] (-885.218) (-884.641) (-884.625) -- 0:00:33
Average standard deviation of split frequencies: 0.005449
540500 -- (-884.515) (-884.848) (-887.660) [-885.729] * [-890.219] (-886.607) (-886.771) (-885.615) -- 0:00:33
541000 -- (-885.145) [-885.670] (-884.749) (-885.370) * (-890.354) (-887.640) (-883.626) [-883.376] -- 0:00:33
541500 -- (-883.721) [-885.458] (-885.188) (-883.848) * (-889.434) (-886.798) (-883.637) [-883.354] -- 0:00:33
542000 -- (-886.610) (-886.463) [-885.127] (-884.931) * (-885.858) (-886.290) [-883.255] (-884.705) -- 0:00:32
542500 -- (-886.611) [-883.779] (-882.964) (-886.441) * (-885.845) [-886.995] (-886.248) (-884.604) -- 0:00:32
543000 -- [-883.913] (-886.068) (-884.701) (-887.652) * (-885.880) (-885.890) [-884.496] (-886.819) -- 0:00:33
543500 -- (-884.443) (-884.770) [-885.811] (-888.920) * (-884.998) (-886.018) [-886.843] (-885.469) -- 0:00:33
544000 -- [-885.508] (-886.655) (-884.217) (-883.775) * [-886.889] (-885.494) (-890.011) (-885.459) -- 0:00:33
544500 -- (-887.460) (-888.210) [-883.855] (-885.464) * [-884.822] (-883.687) (-886.777) (-883.409) -- 0:00:33
545000 -- [-886.561] (-885.643) (-887.532) (-885.731) * (-883.574) [-887.420] (-884.656) (-885.444) -- 0:00:33
Average standard deviation of split frequencies: 0.006098
545500 -- (-886.977) (-884.539) (-885.755) [-883.922] * (-884.413) (-885.324) (-883.257) [-883.458] -- 0:00:33
546000 -- (-883.128) [-884.943] (-885.704) (-885.052) * (-886.024) [-883.460] (-885.723) (-890.835) -- 0:00:33
546500 -- (-883.566) (-884.297) [-885.371] (-883.069) * (-883.592) (-883.392) [-884.297] (-885.199) -- 0:00:33
547000 -- (-887.876) (-883.174) (-884.280) [-883.298] * [-884.447] (-883.572) (-884.808) (-884.317) -- 0:00:33
547500 -- (-885.381) [-885.286] (-883.758) (-887.838) * [-885.835] (-883.961) (-886.757) (-887.044) -- 0:00:33
548000 -- (-883.760) [-885.343] (-884.036) (-888.959) * (-883.777) [-884.687] (-887.281) (-883.977) -- 0:00:32
548500 -- (-882.672) (-886.647) (-885.642) [-882.968] * (-883.907) [-885.595] (-886.011) (-886.206) -- 0:00:32
549000 -- (-883.774) [-883.067] (-885.080) (-885.871) * (-884.289) (-884.919) [-884.842] (-885.946) -- 0:00:32
549500 -- [-882.763] (-886.548) (-884.323) (-887.132) * [-883.924] (-884.402) (-884.399) (-887.868) -- 0:00:32
550000 -- [-884.715] (-884.786) (-884.393) (-885.399) * (-888.928) [-883.911] (-885.649) (-888.759) -- 0:00:32
Average standard deviation of split frequencies: 0.006260
550500 -- (-883.463) [-885.329] (-885.055) (-886.623) * [-887.751] (-884.034) (-887.886) (-887.287) -- 0:00:32
551000 -- [-885.967] (-883.987) (-888.036) (-885.378) * (-885.931) (-883.140) [-885.818] (-883.455) -- 0:00:32
551500 -- (-889.383) (-882.854) (-886.427) [-885.155] * (-891.429) [-884.942] (-886.027) (-883.958) -- 0:00:32
552000 -- [-886.243] (-884.894) (-884.416) (-884.857) * (-885.222) (-884.456) [-883.621] (-886.433) -- 0:00:32
552500 -- [-885.176] (-887.806) (-883.604) (-884.950) * (-883.283) (-885.533) [-886.766] (-885.315) -- 0:00:32
553000 -- (-884.989) (-882.836) [-885.223] (-884.134) * [-888.418] (-885.609) (-890.042) (-885.260) -- 0:00:32
553500 -- (-884.832) (-883.135) (-887.044) [-883.612] * (-889.076) (-888.378) [-883.962] (-885.258) -- 0:00:32
554000 -- (-884.322) [-884.076] (-882.980) (-886.188) * (-886.909) (-883.062) [-884.153] (-886.523) -- 0:00:32
554500 -- (-884.415) [-886.690] (-882.736) (-893.639) * (-887.263) (-883.372) (-884.270) [-883.581] -- 0:00:32
555000 -- (-885.614) (-886.260) [-883.747] (-894.889) * (-885.973) (-882.893) [-884.918] (-887.540) -- 0:00:32
Average standard deviation of split frequencies: 0.006253
555500 -- (-887.116) [-884.674] (-885.080) (-886.416) * (-886.513) (-888.638) (-884.611) [-885.771] -- 0:00:32
556000 -- (-886.522) [-884.597] (-884.572) (-887.551) * (-885.546) (-887.590) [-884.192] (-884.380) -- 0:00:32
556500 -- [-884.733] (-882.880) (-884.271) (-888.348) * (-883.269) (-885.354) [-884.951] (-885.028) -- 0:00:32
557000 -- (-884.954) (-883.538) (-883.007) [-884.847] * (-883.599) (-886.438) [-883.005] (-890.874) -- 0:00:32
557500 -- (-885.010) (-883.382) [-883.705] (-884.956) * (-885.900) (-882.945) (-885.177) [-883.686] -- 0:00:32
558000 -- (-886.843) [-884.817] (-883.197) (-883.601) * (-885.701) (-882.854) (-883.232) [-884.834] -- 0:00:32
558500 -- [-884.055] (-885.692) (-883.213) (-887.757) * (-885.999) (-885.619) (-885.468) [-884.780] -- 0:00:32
559000 -- (-885.938) [-882.866] (-888.990) (-886.693) * (-883.343) (-884.671) (-885.719) [-886.015] -- 0:00:32
559500 -- (-885.182) [-883.163] (-886.121) (-885.464) * [-884.914] (-883.143) (-889.067) (-887.136) -- 0:00:32
560000 -- (-885.126) (-889.628) (-886.573) [-884.373] * (-883.435) (-885.201) [-884.611] (-885.221) -- 0:00:32
Average standard deviation of split frequencies: 0.005829
560500 -- (-883.121) (-883.708) (-883.194) [-883.505] * [-883.795] (-885.352) (-885.490) (-884.767) -- 0:00:32
561000 -- [-885.504] (-890.899) (-883.762) (-886.452) * (-884.313) [-883.002] (-883.698) (-887.031) -- 0:00:32
561500 -- (-884.812) (-885.727) [-886.439] (-885.983) * (-884.278) [-884.247] (-883.050) (-884.474) -- 0:00:32
562000 -- (-885.190) [-883.983] (-888.217) (-883.969) * (-883.962) [-885.745] (-888.436) (-885.419) -- 0:00:31
562500 -- (-887.976) (-883.761) [-885.801] (-890.315) * [-885.982] (-886.890) (-884.486) (-885.759) -- 0:00:31
563000 -- (-886.713) [-887.433] (-889.219) (-885.745) * (-889.632) (-885.523) [-883.664] (-884.254) -- 0:00:31
563500 -- (-887.908) [-887.076] (-885.275) (-886.345) * (-883.986) (-885.838) (-885.561) [-883.634] -- 0:00:31
564000 -- (-885.221) (-886.767) [-883.772] (-885.103) * (-886.932) (-886.036) [-884.133] (-884.544) -- 0:00:31
564500 -- [-884.916] (-885.558) (-887.055) (-883.619) * [-885.145] (-886.253) (-884.587) (-887.251) -- 0:00:31
565000 -- (-884.586) (-885.318) (-884.589) [-884.893] * (-885.216) (-883.185) (-885.647) [-884.317] -- 0:00:31
Average standard deviation of split frequencies: 0.006715
565500 -- (-884.162) [-888.775] (-885.594) (-883.894) * [-883.303] (-882.976) (-884.597) (-884.101) -- 0:00:31
566000 -- (-889.784) (-883.373) [-883.264] (-888.585) * (-887.290) (-885.981) [-883.103] (-883.482) -- 0:00:31
566500 -- (-885.822) (-885.027) [-886.119] (-888.877) * (-882.959) (-883.557) (-886.712) [-885.091] -- 0:00:31
567000 -- (-884.215) (-884.465) (-887.313) [-885.131] * [-883.791] (-883.557) (-885.743) (-885.165) -- 0:00:31
567500 -- (-885.599) (-884.067) [-883.660] (-884.431) * (-883.227) [-884.893] (-887.093) (-884.359) -- 0:00:31
568000 -- (-883.241) (-888.232) [-884.705] (-890.313) * (-882.714) (-883.249) (-884.539) [-882.776] -- 0:00:31
568500 -- [-883.064] (-891.357) (-887.204) (-888.652) * (-884.742) (-888.569) (-885.755) [-885.495] -- 0:00:31
569000 -- (-885.735) (-886.777) [-887.332] (-887.241) * [-884.391] (-885.748) (-883.257) (-886.911) -- 0:00:31
569500 -- (-885.641) [-885.601] (-883.481) (-885.908) * (-886.048) (-886.698) [-883.227] (-884.837) -- 0:00:31
570000 -- (-887.765) [-886.436] (-883.134) (-884.963) * (-886.500) (-885.463) [-883.521] (-884.035) -- 0:00:31
Average standard deviation of split frequencies: 0.006058
570500 -- (-883.271) (-887.933) (-885.351) [-883.121] * (-884.107) [-890.292] (-884.020) (-886.502) -- 0:00:31
571000 -- (-883.873) [-885.950] (-883.385) (-887.112) * [-884.983] (-884.153) (-883.487) (-883.559) -- 0:00:31
571500 -- (-885.917) (-886.012) [-883.372] (-883.877) * [-885.700] (-883.648) (-885.800) (-885.130) -- 0:00:31
572000 -- (-888.825) [-884.094] (-885.317) (-885.938) * (-886.210) [-884.739] (-885.292) (-885.529) -- 0:00:31
572500 -- (-890.671) (-889.140) (-884.115) [-885.816] * (-887.815) (-885.637) [-885.413] (-885.793) -- 0:00:31
573000 -- (-885.377) (-888.913) (-884.320) [-883.296] * (-883.993) (-886.026) [-886.525] (-886.215) -- 0:00:31
573500 -- (-883.095) (-887.809) (-885.786) [-884.797] * (-883.524) [-884.366] (-883.698) (-887.171) -- 0:00:31
574000 -- (-885.123) (-889.482) [-885.954] (-883.357) * (-883.246) (-886.604) (-884.069) [-885.662] -- 0:00:31
574500 -- [-883.758] (-886.851) (-883.955) (-883.128) * [-885.722] (-884.462) (-886.553) (-885.973) -- 0:00:31
575000 -- (-885.716) [-886.383] (-887.196) (-885.770) * (-884.026) (-884.158) (-885.151) [-885.067] -- 0:00:31
Average standard deviation of split frequencies: 0.005838
575500 -- (-885.144) [-884.831] (-884.484) (-885.441) * (-889.092) [-883.696] (-885.091) (-886.222) -- 0:00:30
576000 -- [-884.322] (-885.646) (-885.537) (-886.810) * (-885.936) (-883.772) (-884.932) [-886.305] -- 0:00:30
576500 -- (-884.870) (-885.309) (-884.058) [-884.404] * [-885.719] (-885.018) (-886.652) (-888.227) -- 0:00:30
577000 -- (-885.028) [-883.909] (-884.070) (-883.735) * (-888.324) (-885.888) (-885.368) [-885.703] -- 0:00:30
577500 -- (-886.575) [-885.036] (-890.596) (-889.521) * (-885.333) [-883.800] (-891.341) (-887.125) -- 0:00:30
578000 -- (-883.776) [-884.651] (-884.301) (-889.157) * [-884.913] (-882.833) (-886.467) (-886.703) -- 0:00:30
578500 -- (-883.123) [-891.660] (-884.173) (-886.471) * (-883.732) (-883.531) (-884.123) [-887.440] -- 0:00:30
579000 -- [-886.009] (-885.080) (-887.462) (-885.461) * (-884.387) (-883.325) (-885.002) [-883.892] -- 0:00:30
579500 -- [-883.962] (-885.085) (-886.404) (-884.403) * (-884.998) [-884.360] (-886.481) (-886.053) -- 0:00:30
580000 -- (-883.833) [-884.099] (-886.042) (-884.859) * (-883.658) (-885.824) [-886.264] (-887.500) -- 0:00:30
Average standard deviation of split frequencies: 0.006116
580500 -- [-887.714] (-887.592) (-883.659) (-886.130) * (-884.091) (-883.366) (-885.034) [-883.540] -- 0:00:30
581000 -- [-884.092] (-884.773) (-884.265) (-887.252) * [-883.705] (-883.730) (-884.598) (-883.097) -- 0:00:30
581500 -- (-883.633) [-885.260] (-885.197) (-886.016) * (-883.841) (-885.792) [-884.159] (-886.778) -- 0:00:30
582000 -- (-883.787) (-886.024) [-884.718] (-885.361) * (-884.262) (-885.930) (-885.538) [-885.942] -- 0:00:30
582500 -- (-884.294) [-885.170] (-886.904) (-887.137) * (-887.906) (-886.509) (-887.624) [-882.840] -- 0:00:30
583000 -- (-885.027) [-883.951] (-884.696) (-888.192) * (-885.679) [-885.640] (-887.747) (-883.332) -- 0:00:30
583500 -- (-882.999) [-884.403] (-884.697) (-885.941) * (-885.258) (-884.980) (-886.075) [-885.203] -- 0:00:30
584000 -- (-884.169) (-885.991) [-884.863] (-885.633) * [-883.236] (-885.500) (-885.071) (-883.908) -- 0:00:30
584500 -- (-887.298) [-884.221] (-885.960) (-885.271) * [-883.856] (-886.177) (-883.850) (-883.761) -- 0:00:30
585000 -- [-883.761] (-884.230) (-883.074) (-885.346) * [-887.500] (-885.623) (-883.974) (-886.265) -- 0:00:30
Average standard deviation of split frequencies: 0.006737
585500 -- (-885.387) (-885.168) (-887.539) [-884.675] * (-887.382) (-885.741) [-885.191] (-883.643) -- 0:00:30
586000 -- (-886.595) [-887.154] (-885.296) (-885.752) * [-884.029] (-887.199) (-887.612) (-883.525) -- 0:00:30
586500 -- [-883.978] (-883.477) (-889.433) (-884.108) * (-885.640) [-884.913] (-885.667) (-885.054) -- 0:00:30
587000 -- (-883.638) (-884.185) (-886.822) [-885.074] * (-887.959) (-883.408) [-885.454] (-887.973) -- 0:00:30
587500 -- [-883.469] (-884.680) (-885.391) (-884.527) * [-883.647] (-885.713) (-888.699) (-884.084) -- 0:00:30
588000 -- (-883.929) (-882.781) [-885.409] (-883.951) * (-883.647) [-884.151] (-886.262) (-885.556) -- 0:00:30
588500 -- (-886.222) [-885.467] (-884.788) (-883.368) * (-886.927) [-884.225] (-889.739) (-889.851) -- 0:00:30
589000 -- (-884.167) [-884.164] (-888.797) (-883.283) * (-884.345) (-888.781) (-892.365) [-884.612] -- 0:00:30
589500 -- (-888.536) (-885.033) (-885.283) [-883.952] * [-887.207] (-887.172) (-885.212) (-890.767) -- 0:00:29
590000 -- (-890.225) [-887.425] (-884.488) (-883.814) * (-885.591) [-886.343] (-887.327) (-886.678) -- 0:00:29
Average standard deviation of split frequencies: 0.005693
590500 -- (-883.635) (-887.314) [-883.812] (-884.407) * (-884.596) (-887.835) [-885.682] (-883.627) -- 0:00:29
591000 -- (-887.787) (-885.489) (-882.910) [-884.712] * [-889.247] (-884.786) (-883.100) (-886.008) -- 0:00:29
591500 -- (-884.055) (-884.672) (-882.949) [-883.623] * (-886.391) (-883.135) [-885.763] (-885.619) -- 0:00:29
592000 -- [-883.687] (-884.905) (-885.184) (-884.571) * (-886.954) (-889.375) (-884.821) [-887.002] -- 0:00:29
592500 -- (-886.047) (-883.796) (-883.618) [-883.997] * (-884.489) [-882.817] (-885.649) (-884.867) -- 0:00:29
593000 -- (-883.983) [-885.227] (-883.050) (-889.600) * (-888.560) (-886.225) (-886.737) [-889.284] -- 0:00:29
593500 -- (-890.125) (-884.907) (-890.532) [-886.702] * (-885.978) (-887.891) [-885.818] (-886.749) -- 0:00:29
594000 -- [-888.310] (-885.337) (-888.426) (-885.004) * [-883.104] (-886.025) (-887.591) (-883.731) -- 0:00:29
594500 -- (-884.219) (-883.812) (-884.791) [-884.434] * (-883.192) (-887.983) (-889.416) [-883.676] -- 0:00:29
595000 -- (-885.367) [-882.902] (-888.065) (-894.071) * (-884.683) (-891.977) (-886.563) [-883.482] -- 0:00:29
Average standard deviation of split frequencies: 0.006970
595500 -- (-885.267) (-884.498) (-886.270) [-890.669] * (-889.178) [-883.041] (-886.561) (-883.116) -- 0:00:29
596000 -- (-884.418) (-885.039) (-883.607) [-887.424] * (-887.800) (-885.509) (-887.461) [-883.226] -- 0:00:29
596500 -- (-887.819) (-884.202) [-883.549] (-888.023) * (-885.158) [-886.759] (-889.263) (-883.694) -- 0:00:29
597000 -- (-885.144) (-883.609) [-884.422] (-888.356) * (-883.035) [-883.360] (-884.148) (-889.704) -- 0:00:29
597500 -- (-883.937) (-884.131) (-883.086) [-887.038] * [-884.474] (-883.638) (-885.814) (-885.871) -- 0:00:29
598000 -- [-883.893] (-888.381) (-883.377) (-885.130) * (-887.321) (-884.637) [-886.025] (-885.990) -- 0:00:29
598500 -- [-883.946] (-883.458) (-882.969) (-882.893) * (-885.158) (-887.370) [-886.695] (-885.278) -- 0:00:29
599000 -- (-884.388) (-886.767) [-885.182] (-883.867) * (-884.276) (-887.275) [-884.609] (-886.881) -- 0:00:29
599500 -- (-886.492) [-886.596] (-884.661) (-883.709) * (-887.842) (-888.144) (-886.701) [-885.351] -- 0:00:29
600000 -- (-883.791) (-884.662) [-884.094] (-888.582) * (-886.678) [-884.340] (-885.896) (-888.322) -- 0:00:29
Average standard deviation of split frequencies: 0.006854
600500 -- [-889.813] (-884.814) (-884.074) (-891.414) * [-885.703] (-885.676) (-883.524) (-886.107) -- 0:00:29
601000 -- (-884.038) (-884.899) [-885.083] (-885.624) * (-885.665) (-886.407) (-883.480) [-883.180] -- 0:00:29
601500 -- (-886.044) (-884.150) [-883.542] (-884.661) * (-883.386) (-885.656) (-885.752) [-883.181] -- 0:00:29
602000 -- (-885.713) (-883.343) [-884.018] (-886.829) * (-883.548) (-889.277) (-886.037) [-883.054] -- 0:00:29
602500 -- (-883.752) (-888.103) (-884.355) [-885.311] * [-883.313] (-885.527) (-883.908) (-886.541) -- 0:00:29
603000 -- (-883.691) (-885.219) (-884.705) [-883.670] * (-884.126) (-884.155) (-884.155) [-890.268] -- 0:00:28
603500 -- (-883.809) (-884.004) (-884.342) [-882.936] * [-884.249] (-884.927) (-884.385) (-893.711) -- 0:00:28
604000 -- [-888.286] (-884.049) (-884.318) (-884.934) * (-884.123) (-883.003) [-884.132] (-887.071) -- 0:00:28
604500 -- (-883.778) (-886.864) [-883.385] (-883.470) * (-884.623) (-886.699) [-884.845] (-886.013) -- 0:00:28
605000 -- [-887.719] (-884.507) (-885.261) (-883.256) * (-884.085) (-887.016) [-883.470] (-883.456) -- 0:00:28
Average standard deviation of split frequencies: 0.006897
605500 -- (-883.790) (-884.898) (-888.589) [-884.334] * (-885.421) [-886.394] (-886.650) (-885.616) -- 0:00:28
606000 -- (-884.727) [-882.896] (-886.349) (-884.454) * (-885.357) [-885.940] (-886.367) (-887.918) -- 0:00:28
606500 -- (-884.699) [-882.908] (-884.856) (-884.467) * (-888.045) (-886.522) [-883.406] (-886.383) -- 0:00:28
607000 -- (-886.626) (-884.419) [-883.195] (-889.448) * (-884.228) (-888.331) [-883.752] (-883.889) -- 0:00:28
607500 -- [-884.220] (-884.829) (-883.579) (-888.127) * (-890.251) [-888.608] (-884.050) (-887.854) -- 0:00:28
608000 -- (-884.648) (-886.922) [-884.036] (-885.903) * (-883.602) [-888.158] (-888.851) (-891.311) -- 0:00:28
608500 -- (-889.731) (-883.973) (-883.694) [-884.304] * [-883.590] (-887.485) (-883.821) (-886.657) -- 0:00:28
609000 -- [-886.785] (-884.073) (-885.447) (-883.843) * [-884.171] (-887.438) (-884.200) (-885.786) -- 0:00:28
609500 -- [-883.144] (-886.202) (-885.003) (-885.895) * (-885.995) (-883.670) [-884.604] (-885.586) -- 0:00:28
610000 -- (-884.736) [-885.514] (-883.934) (-886.038) * (-884.935) (-884.769) (-884.454) [-885.630] -- 0:00:28
Average standard deviation of split frequencies: 0.006999
610500 -- (-882.887) (-885.856) (-887.659) [-884.048] * (-886.911) [-885.645] (-882.768) (-885.005) -- 0:00:28
611000 -- (-885.217) [-888.111] (-890.053) (-883.600) * (-886.198) [-886.131] (-882.924) (-885.274) -- 0:00:28
611500 -- [-882.945] (-885.116) (-884.042) (-891.523) * (-884.704) (-885.300) (-882.924) [-885.609] -- 0:00:28
612000 -- [-885.302] (-885.147) (-885.740) (-885.985) * (-883.044) [-883.773] (-882.924) (-886.842) -- 0:00:28
612500 -- (-887.603) [-884.722] (-885.897) (-887.658) * (-885.151) (-885.769) [-886.229] (-883.503) -- 0:00:28
613000 -- (-885.894) [-885.113] (-886.252) (-886.101) * (-884.536) (-885.828) [-885.987] (-884.490) -- 0:00:28
613500 -- (-885.848) (-883.805) (-886.085) [-884.453] * (-884.190) [-884.860] (-883.714) (-883.571) -- 0:00:28
614000 -- (-883.863) (-884.513) (-886.056) [-884.238] * (-885.976) (-885.627) [-888.048] (-883.576) -- 0:00:28
614500 -- (-884.625) [-884.248] (-883.302) (-884.983) * (-884.416) (-884.101) (-884.955) [-884.178] -- 0:00:28
615000 -- (-885.051) (-883.893) (-884.444) [-883.469] * (-883.978) [-883.722] (-885.245) (-883.444) -- 0:00:28
Average standard deviation of split frequencies: 0.007347
615500 -- (-886.022) (-883.627) (-887.966) [-883.468] * [-884.880] (-883.866) (-886.284) (-885.699) -- 0:00:28
616000 -- (-885.736) (-883.134) (-883.837) [-886.127] * [-883.387] (-884.781) (-886.431) (-884.676) -- 0:00:28
616500 -- [-889.033] (-883.777) (-884.301) (-885.708) * [-883.280] (-885.816) (-884.216) (-883.699) -- 0:00:27
617000 -- [-883.374] (-884.046) (-884.044) (-883.965) * [-885.768] (-888.500) (-886.505) (-883.690) -- 0:00:27
617500 -- (-885.625) (-886.947) [-883.299] (-885.345) * [-886.992] (-887.380) (-883.969) (-883.376) -- 0:00:27
618000 -- (-888.060) [-885.294] (-887.356) (-884.856) * (-884.416) (-886.709) (-883.950) [-883.608] -- 0:00:27
618500 -- (-887.732) (-888.366) [-883.487] (-885.208) * (-887.336) (-887.294) [-883.777] (-884.980) -- 0:00:27
619000 -- [-884.442] (-888.403) (-887.241) (-885.326) * (-886.120) [-885.585] (-883.481) (-885.939) -- 0:00:27
619500 -- [-884.592] (-885.883) (-885.685) (-883.314) * (-885.004) [-884.576] (-883.918) (-884.942) -- 0:00:27
620000 -- (-885.856) [-883.207] (-891.709) (-884.928) * (-882.875) [-885.757] (-887.450) (-886.784) -- 0:00:27
Average standard deviation of split frequencies: 0.007595
620500 -- [-884.514] (-883.839) (-888.046) (-888.016) * (-884.368) [-886.182] (-883.674) (-884.722) -- 0:00:27
621000 -- (-883.949) (-884.971) (-885.320) [-897.250] * (-887.717) [-886.247] (-884.195) (-886.612) -- 0:00:27
621500 -- (-885.845) (-885.705) [-885.216] (-889.541) * (-888.067) (-883.707) (-883.470) [-884.626] -- 0:00:28
622000 -- (-884.068) [-886.871] (-884.771) (-888.077) * (-883.936) (-888.304) [-883.895] (-884.520) -- 0:00:27
622500 -- [-883.077] (-886.803) (-883.586) (-884.845) * [-883.086] (-885.779) (-883.710) (-882.792) -- 0:00:27
623000 -- (-884.642) [-888.521] (-883.820) (-883.498) * [-883.365] (-885.087) (-883.849) (-884.519) -- 0:00:27
623500 -- [-884.732] (-887.969) (-886.248) (-883.294) * (-886.164) (-884.906) [-884.460] (-886.489) -- 0:00:27
624000 -- [-885.045] (-895.572) (-884.854) (-887.040) * (-883.679) [-884.013] (-885.625) (-883.209) -- 0:00:27
624500 -- [-883.506] (-884.366) (-884.733) (-884.377) * (-885.151) [-883.297] (-883.417) (-886.573) -- 0:00:27
625000 -- (-885.860) [-884.734] (-885.539) (-887.692) * [-886.248] (-884.729) (-888.702) (-887.459) -- 0:00:27
Average standard deviation of split frequencies: 0.007201
625500 -- [-889.508] (-886.894) (-884.086) (-889.057) * (-886.126) (-885.733) [-883.432] (-884.593) -- 0:00:27
626000 -- [-887.939] (-886.808) (-883.907) (-888.808) * [-883.365] (-885.700) (-884.499) (-884.657) -- 0:00:27
626500 -- (-884.851) (-885.782) (-884.700) [-885.391] * [-884.824] (-887.773) (-885.826) (-885.757) -- 0:00:27
627000 -- (-884.802) (-885.551) [-886.321] (-883.670) * (-884.089) (-887.921) (-885.185) [-889.335] -- 0:00:27
627500 -- (-884.490) (-885.373) (-885.058) [-885.472] * (-885.664) (-886.185) (-883.870) [-882.803] -- 0:00:27
628000 -- (-884.473) [-885.713] (-884.653) (-884.466) * (-883.369) (-884.822) (-883.319) [-883.255] -- 0:00:27
628500 -- (-886.077) (-884.583) (-884.932) [-883.671] * (-886.536) [-884.500] (-883.725) (-887.589) -- 0:00:27
629000 -- [-883.632] (-885.272) (-884.285) (-882.890) * (-884.781) (-883.400) [-884.181] (-885.148) -- 0:00:27
629500 -- (-883.165) (-885.750) (-885.140) [-886.420] * (-884.124) (-882.987) (-888.344) [-883.408] -- 0:00:27
630000 -- (-882.845) (-887.338) [-884.399] (-884.037) * [-885.539] (-888.426) (-886.357) (-884.028) -- 0:00:27
Average standard deviation of split frequencies: 0.006677
630500 -- (-886.851) (-885.044) (-886.029) [-885.089] * (-889.741) [-883.535] (-886.488) (-884.954) -- 0:00:26
631000 -- (-888.520) (-888.444) [-884.709] (-888.092) * [-887.312] (-885.684) (-887.392) (-886.583) -- 0:00:26
631500 -- (-887.926) (-889.118) [-884.591] (-884.533) * (-886.361) [-884.541] (-889.760) (-886.055) -- 0:00:26
632000 -- (-883.659) (-889.139) [-885.979] (-887.345) * (-883.975) (-883.882) [-884.359] (-888.619) -- 0:00:26
632500 -- (-884.891) (-884.721) (-884.439) [-883.490] * (-884.725) (-884.501) (-883.974) [-884.462] -- 0:00:26
633000 -- (-888.098) (-885.569) [-885.926] (-886.666) * (-888.840) [-882.994] (-883.681) (-885.146) -- 0:00:26
633500 -- [-884.697] (-887.805) (-886.470) (-884.090) * [-886.835] (-886.187) (-886.041) (-883.520) -- 0:00:26
634000 -- (-885.292) [-885.878] (-884.853) (-892.215) * (-884.958) (-883.232) (-885.269) [-882.736] -- 0:00:26
634500 -- (-885.563) [-885.954] (-888.359) (-888.533) * [-884.568] (-883.540) (-892.517) (-884.675) -- 0:00:26
635000 -- (-885.550) [-884.555] (-885.171) (-886.257) * (-889.380) (-884.533) (-887.786) [-884.440] -- 0:00:27
Average standard deviation of split frequencies: 0.006374
635500 -- [-886.737] (-884.080) (-886.009) (-886.888) * (-888.937) (-887.943) [-886.779] (-884.505) -- 0:00:26
636000 -- (-883.868) (-884.330) [-884.088] (-888.084) * (-887.756) (-886.081) (-883.456) [-883.250] -- 0:00:26
636500 -- [-883.635] (-885.457) (-884.809) (-884.888) * (-888.166) [-885.658] (-883.011) (-884.885) -- 0:00:26
637000 -- [-885.326] (-889.891) (-885.739) (-885.105) * (-883.757) [-886.903] (-891.457) (-887.542) -- 0:00:26
637500 -- (-885.299) (-884.448) [-885.514] (-884.277) * (-887.925) (-886.821) [-882.742] (-884.260) -- 0:00:26
638000 -- [-885.589] (-884.232) (-888.586) (-883.380) * (-885.408) [-885.889] (-891.729) (-885.984) -- 0:00:26
638500 -- [-889.316] (-887.827) (-886.611) (-884.677) * (-883.923) [-886.113] (-885.728) (-886.597) -- 0:00:26
639000 -- (-887.905) (-886.458) [-886.967] (-883.588) * (-885.527) (-883.483) (-883.925) [-883.890] -- 0:00:26
639500 -- (-887.287) (-884.369) (-884.526) [-885.017] * [-884.628] (-885.169) (-885.265) (-883.468) -- 0:00:26
640000 -- (-885.724) (-887.987) (-888.007) [-885.089] * (-890.552) (-887.245) [-884.623] (-886.219) -- 0:00:26
Average standard deviation of split frequencies: 0.006230
640500 -- (-887.827) (-886.465) [-891.561] (-886.045) * (-884.798) [-884.358] (-883.133) (-888.086) -- 0:00:26
641000 -- (-888.880) (-887.608) [-885.597] (-884.620) * (-883.017) (-884.448) [-886.058] (-885.008) -- 0:00:26
641500 -- [-883.203] (-883.773) (-884.206) (-884.100) * (-890.254) (-884.999) (-885.335) [-884.443] -- 0:00:26
642000 -- (-883.457) (-884.938) (-885.551) [-883.278] * [-884.955] (-885.779) (-885.714) (-886.696) -- 0:00:26
642500 -- (-884.942) (-884.938) (-882.781) [-887.300] * (-884.053) [-885.216] (-883.919) (-884.490) -- 0:00:26
643000 -- (-884.076) (-885.190) (-883.483) [-888.157] * (-885.147) (-884.774) (-886.017) [-884.269] -- 0:00:26
643500 -- (-886.674) [-888.982] (-883.510) (-885.953) * (-885.107) (-886.870) (-884.806) [-884.261] -- 0:00:26
644000 -- (-887.259) (-885.800) [-884.683] (-883.311) * [-885.344] (-884.356) (-884.036) (-883.604) -- 0:00:25
644500 -- (-884.971) [-883.241] (-886.843) (-893.733) * [-885.217] (-884.574) (-887.776) (-883.962) -- 0:00:25
645000 -- [-884.056] (-882.771) (-883.665) (-897.418) * [-883.826] (-883.588) (-885.092) (-885.144) -- 0:00:25
Average standard deviation of split frequencies: 0.006324
645500 -- (-884.529) (-882.857) (-882.990) [-885.958] * [-885.986] (-884.493) (-885.516) (-882.956) -- 0:00:25
646000 -- [-882.648] (-887.307) (-883.305) (-887.145) * (-885.957) (-885.756) (-889.842) [-883.704] -- 0:00:25
646500 -- (-882.927) (-886.776) (-885.860) [-883.077] * [-883.774] (-892.422) (-886.533) (-888.161) -- 0:00:25
647000 -- (-884.717) (-883.941) (-885.837) [-883.455] * [-882.771] (-888.926) (-885.636) (-883.969) -- 0:00:25
647500 -- (-884.207) [-883.704] (-886.014) (-883.513) * (-882.837) (-885.051) (-884.178) [-886.019] -- 0:00:25
648000 -- (-883.728) [-885.786] (-883.548) (-883.483) * (-885.730) [-884.406] (-884.423) (-884.942) -- 0:00:25
648500 -- (-884.467) (-889.063) (-885.015) [-883.483] * (-886.743) (-883.705) (-883.414) [-885.122] -- 0:00:26
649000 -- [-886.706] (-887.170) (-883.844) (-886.306) * (-885.991) (-887.221) [-883.342] (-885.141) -- 0:00:25
649500 -- (-888.182) (-884.514) (-888.002) [-884.750] * [-885.409] (-885.809) (-883.887) (-883.295) -- 0:00:25
650000 -- (-889.919) [-884.549] (-885.838) (-886.947) * (-888.929) (-885.126) (-884.485) [-885.276] -- 0:00:25
Average standard deviation of split frequencies: 0.006134
650500 -- [-883.115] (-884.676) (-883.981) (-883.365) * (-883.284) (-883.154) [-887.544] (-886.071) -- 0:00:25
651000 -- (-885.938) (-884.362) [-887.137] (-884.496) * (-884.909) (-883.211) (-885.907) [-885.918] -- 0:00:25
651500 -- (-885.902) (-886.727) (-884.516) [-883.819] * (-884.184) (-887.653) (-888.491) [-884.976] -- 0:00:25
652000 -- (-887.158) (-884.601) [-883.631] (-883.787) * (-883.877) (-887.033) (-883.875) [-885.131] -- 0:00:25
652500 -- (-884.963) [-884.391] (-886.691) (-885.675) * (-884.006) [-884.106] (-889.227) (-885.825) -- 0:00:25
653000 -- (-886.648) (-883.804) [-884.169] (-887.794) * (-884.832) (-883.011) [-889.081] (-883.491) -- 0:00:25
653500 -- (-888.261) (-886.819) (-883.451) [-884.055] * [-885.791] (-884.680) (-890.845) (-885.515) -- 0:00:25
654000 -- (-885.752) (-883.598) [-883.364] (-885.118) * (-883.537) [-886.810] (-890.836) (-884.183) -- 0:00:25
654500 -- (-884.640) (-886.105) [-883.413] (-884.799) * (-884.100) (-883.342) [-885.025] (-889.382) -- 0:00:25
655000 -- (-883.540) [-886.404] (-886.950) (-887.835) * [-883.999] (-887.758) (-889.009) (-883.418) -- 0:00:25
Average standard deviation of split frequencies: 0.005366
655500 -- (-884.323) [-884.196] (-883.979) (-888.617) * (-885.522) [-883.748] (-888.043) (-884.373) -- 0:00:25
656000 -- [-883.661] (-887.831) (-889.175) (-888.087) * (-883.314) (-882.981) (-884.210) [-886.625] -- 0:00:25
656500 -- (-882.737) (-885.783) (-884.146) [-884.941] * [-885.909] (-883.976) (-888.630) (-887.745) -- 0:00:25
657000 -- [-882.630] (-885.473) (-884.233) (-887.956) * [-883.993] (-887.893) (-884.446) (-890.804) -- 0:00:25
657500 -- [-885.165] (-887.835) (-885.179) (-888.477) * [-886.971] (-887.383) (-885.065) (-886.345) -- 0:00:25
658000 -- (-884.890) (-886.218) [-885.056] (-884.309) * [-886.226] (-885.176) (-885.898) (-885.461) -- 0:00:24
658500 -- (-884.953) (-891.424) (-885.544) [-884.106] * (-883.590) (-886.668) (-884.364) [-888.554] -- 0:00:24
659000 -- (-883.557) (-897.495) (-890.620) [-885.148] * [-883.932] (-884.993) (-884.491) (-887.583) -- 0:00:24
659500 -- (-883.280) (-893.322) [-883.820] (-887.212) * (-887.297) [-884.709] (-883.543) (-890.379) -- 0:00:24
660000 -- (-883.213) (-889.129) (-883.620) [-886.166] * (-888.701) (-884.390) (-886.077) [-892.433] -- 0:00:24
Average standard deviation of split frequencies: 0.005328
660500 -- [-887.710] (-889.451) (-883.527) (-885.056) * (-885.155) (-884.299) (-889.057) [-883.769] -- 0:00:24
661000 -- [-888.777] (-886.811) (-884.375) (-885.616) * (-884.449) [-885.980] (-888.853) (-887.475) -- 0:00:24
661500 -- (-884.155) (-884.896) [-884.826] (-884.078) * [-885.779] (-887.394) (-884.961) (-886.052) -- 0:00:24
662000 -- (-883.952) (-885.961) [-887.221] (-885.017) * (-884.117) [-883.943] (-886.323) (-883.915) -- 0:00:24
662500 -- (-885.847) (-883.326) (-884.698) [-884.107] * (-885.981) (-884.481) [-884.571] (-887.638) -- 0:00:24
663000 -- (-885.886) (-885.088) (-887.827) [-883.526] * [-885.573] (-883.045) (-889.494) (-885.901) -- 0:00:24
663500 -- (-885.595) (-884.146) (-886.009) [-883.697] * (-884.733) (-884.443) (-886.786) [-884.158] -- 0:00:24
664000 -- [-887.252] (-882.789) (-889.425) (-884.523) * (-885.977) (-885.689) (-887.050) [-884.783] -- 0:00:24
664500 -- [-886.513] (-883.729) (-885.912) (-883.715) * [-884.556] (-883.561) (-883.464) (-884.961) -- 0:00:24
665000 -- (-885.673) [-886.028] (-886.911) (-883.503) * (-884.069) [-883.597] (-884.315) (-884.784) -- 0:00:24
Average standard deviation of split frequencies: 0.005663
665500 -- (-885.756) (-884.918) (-887.998) [-885.021] * (-885.792) (-884.272) (-885.521) [-884.211] -- 0:00:24
666000 -- (-887.494) (-884.145) [-883.999] (-883.845) * [-883.400] (-885.392) (-885.107) (-887.988) -- 0:00:24
666500 -- (-885.085) [-887.284] (-888.098) (-886.924) * (-883.714) (-884.429) (-885.634) [-884.018] -- 0:00:24
667000 -- (-888.896) (-889.782) (-888.748) [-883.406] * (-883.489) (-884.265) (-884.067) [-885.287] -- 0:00:24
667500 -- (-885.410) (-889.524) [-885.260] (-887.710) * (-885.087) (-885.114) [-886.243] (-888.561) -- 0:00:24
668000 -- (-883.220) (-886.216) [-884.465] (-884.008) * [-884.285] (-885.198) (-886.784) (-883.203) -- 0:00:24
668500 -- [-883.279] (-884.134) (-886.995) (-883.772) * [-886.485] (-884.394) (-885.610) (-883.415) -- 0:00:24
669000 -- (-886.858) (-884.490) (-884.276) [-883.492] * [-883.540] (-884.484) (-885.815) (-887.505) -- 0:00:24
669500 -- (-883.719) [-885.321] (-884.281) (-883.420) * [-883.530] (-884.133) (-883.539) (-890.025) -- 0:00:24
670000 -- (-883.465) (-887.033) [-887.889] (-884.944) * (-885.279) [-883.213] (-884.496) (-886.085) -- 0:00:24
Average standard deviation of split frequencies: 0.005998
670500 -- [-889.246] (-887.382) (-884.746) (-883.497) * (-883.903) [-883.462] (-884.087) (-886.524) -- 0:00:24
671000 -- (-887.810) (-884.646) (-885.813) [-883.158] * [-883.806] (-882.836) (-883.942) (-884.525) -- 0:00:24
671500 -- (-886.494) (-884.471) [-884.011] (-883.734) * [-884.655] (-882.845) (-883.784) (-883.769) -- 0:00:23
672000 -- (-885.231) [-884.643] (-884.733) (-884.899) * (-883.904) [-883.997] (-885.727) (-885.711) -- 0:00:23
672500 -- (-883.697) (-886.135) (-884.416) [-884.821] * (-884.005) [-886.164] (-883.586) (-890.390) -- 0:00:23
673000 -- [-883.963] (-884.179) (-887.140) (-885.233) * (-891.088) (-885.009) (-883.733) [-884.218] -- 0:00:23
673500 -- [-884.003] (-886.321) (-888.906) (-884.638) * (-886.938) (-884.770) (-886.445) [-885.186] -- 0:00:23
674000 -- (-885.704) (-888.350) [-885.781] (-890.626) * (-887.124) (-884.300) (-886.764) [-886.907] -- 0:00:23
674500 -- [-886.302] (-885.356) (-887.344) (-885.141) * (-885.312) [-885.530] (-884.241) (-884.203) -- 0:00:23
675000 -- (-886.711) (-884.060) (-887.851) [-887.593] * (-886.467) (-884.781) (-886.647) [-883.748] -- 0:00:23
Average standard deviation of split frequencies: 0.006602
675500 -- [-887.680] (-886.041) (-886.039) (-887.066) * (-885.541) [-886.070] (-886.347) (-883.202) -- 0:00:23
676000 -- (-885.151) (-884.948) [-887.257] (-887.591) * (-890.849) (-883.854) (-884.379) [-884.033] -- 0:00:23
676500 -- [-883.016] (-886.325) (-886.546) (-886.599) * (-883.710) [-883.685] (-884.611) (-886.474) -- 0:00:23
677000 -- (-889.307) (-885.632) (-885.117) [-886.880] * (-886.064) [-885.989] (-885.096) (-886.076) -- 0:00:23
677500 -- [-883.760] (-886.053) (-886.016) (-883.643) * (-885.486) [-883.453] (-883.671) (-887.546) -- 0:00:23
678000 -- [-883.485] (-884.474) (-887.783) (-885.727) * (-886.980) (-884.258) [-883.598] (-887.377) -- 0:00:23
678500 -- [-883.073] (-884.847) (-885.755) (-885.896) * [-885.212] (-883.988) (-884.555) (-884.265) -- 0:00:23
679000 -- (-883.290) (-886.783) (-886.970) [-885.585] * (-885.125) [-885.228] (-885.416) (-883.188) -- 0:00:23
679500 -- [-885.745] (-887.949) (-884.658) (-883.641) * [-886.812] (-884.258) (-884.763) (-888.914) -- 0:00:23
680000 -- (-883.868) (-884.372) (-884.221) [-886.134] * [-886.349] (-888.451) (-886.261) (-887.493) -- 0:00:23
Average standard deviation of split frequencies: 0.006418
680500 -- (-883.897) (-884.888) (-883.629) [-885.140] * (-884.531) [-883.853] (-886.272) (-885.670) -- 0:00:23
681000 -- (-887.539) (-884.959) (-889.566) [-884.547] * [-885.369] (-886.797) (-890.401) (-885.306) -- 0:00:23
681500 -- [-884.298] (-883.006) (-887.117) (-883.599) * (-886.579) (-883.581) [-884.731] (-889.005) -- 0:00:23
682000 -- (-885.488) (-882.872) (-888.522) [-883.927] * (-883.904) [-882.864] (-886.669) (-884.916) -- 0:00:23
682500 -- (-884.629) (-882.922) [-883.933] (-884.663) * [-884.232] (-883.806) (-888.217) (-885.758) -- 0:00:23
683000 -- (-886.221) (-884.886) (-887.703) [-886.416] * (-884.306) (-885.471) [-885.737] (-885.711) -- 0:00:23
683500 -- (-885.913) (-884.289) (-885.965) [-887.937] * (-886.461) (-884.773) (-885.063) [-884.943] -- 0:00:23
684000 -- [-885.387] (-888.448) (-885.342) (-886.447) * (-886.467) (-890.251) [-885.126] (-885.555) -- 0:00:23
684500 -- (-885.518) [-885.789] (-887.190) (-883.994) * [-885.255] (-885.292) (-885.355) (-885.020) -- 0:00:23
685000 -- (-883.894) (-886.427) (-885.565) [-883.256] * (-884.620) [-883.659] (-889.105) (-884.524) -- 0:00:22
Average standard deviation of split frequencies: 0.006826
685500 -- (-883.321) (-887.240) (-883.976) [-884.506] * [-884.036] (-886.463) (-884.674) (-884.212) -- 0:00:22
686000 -- [-883.442] (-890.775) (-885.527) (-884.135) * [-884.205] (-887.939) (-883.821) (-886.147) -- 0:00:22
686500 -- (-884.494) (-885.564) [-884.882] (-885.924) * (-882.714) [-886.400] (-883.970) (-886.196) -- 0:00:22
687000 -- [-883.276] (-884.411) (-884.482) (-885.035) * [-882.875] (-886.806) (-885.349) (-889.505) -- 0:00:22
687500 -- [-882.652] (-885.780) (-884.089) (-884.542) * (-884.283) [-885.116] (-885.158) (-886.482) -- 0:00:22
688000 -- (-882.847) (-882.638) [-884.168] (-885.565) * (-885.164) (-885.293) [-887.248] (-884.315) -- 0:00:22
688500 -- (-882.905) (-883.030) [-886.642] (-885.750) * [-883.223] (-885.148) (-886.031) (-885.415) -- 0:00:22
689000 -- [-882.904] (-884.889) (-884.333) (-884.305) * (-884.675) [-885.357] (-884.400) (-884.184) -- 0:00:22
689500 -- (-888.461) (-884.406) [-886.581] (-883.816) * (-888.108) (-884.029) (-887.360) [-887.033] -- 0:00:22
690000 -- (-884.808) [-883.170] (-891.204) (-885.930) * (-884.767) (-886.717) (-885.290) [-888.011] -- 0:00:22
Average standard deviation of split frequencies: 0.006962
690500 -- [-884.869] (-883.405) (-889.584) (-884.352) * (-886.996) (-885.899) (-885.814) [-886.476] -- 0:00:22
691000 -- (-885.701) (-888.769) (-890.963) [-887.723] * (-891.379) (-885.662) (-884.300) [-883.538] -- 0:00:22
691500 -- (-884.799) (-886.913) (-884.108) [-883.149] * [-884.828] (-883.196) (-883.446) (-883.949) -- 0:00:22
692000 -- (-885.192) [-883.250] (-883.920) (-886.990) * (-883.386) (-882.917) [-883.912] (-884.175) -- 0:00:22
692500 -- [-884.087] (-884.770) (-883.691) (-884.425) * [-883.741] (-884.750) (-884.093) (-884.736) -- 0:00:22
693000 -- (-885.290) (-884.325) (-885.722) [-882.670] * [-884.942] (-887.626) (-888.056) (-887.661) -- 0:00:22
693500 -- (-885.181) (-887.374) (-884.632) [-882.672] * [-884.055] (-885.937) (-884.010) (-885.785) -- 0:00:22
694000 -- (-883.904) (-883.652) [-884.115] (-883.864) * [-885.476] (-884.027) (-885.448) (-889.859) -- 0:00:22
694500 -- [-883.524] (-889.984) (-883.644) (-884.877) * (-884.045) [-883.634] (-885.457) (-886.557) -- 0:00:22
695000 -- (-889.328) (-885.616) [-884.000] (-885.428) * (-885.984) (-886.220) [-885.170] (-883.759) -- 0:00:22
Average standard deviation of split frequencies: 0.006863
695500 -- (-884.228) (-886.503) [-887.180] (-887.455) * (-883.113) (-883.405) [-889.292] (-886.722) -- 0:00:22
696000 -- (-885.796) [-883.595] (-884.277) (-884.654) * (-883.500) [-885.007] (-886.175) (-884.537) -- 0:00:22
696500 -- (-884.346) (-886.525) (-889.227) [-885.902] * [-883.904] (-884.120) (-886.928) (-883.654) -- 0:00:22
697000 -- (-884.239) (-884.466) [-885.445] (-890.017) * (-887.693) [-883.875] (-885.723) (-884.727) -- 0:00:22
697500 -- (-884.301) (-884.214) (-883.632) [-884.764] * (-886.133) (-885.200) [-885.218] (-887.049) -- 0:00:22
698000 -- (-883.659) (-884.853) (-885.910) [-888.980] * (-887.430) (-887.166) [-886.479] (-886.357) -- 0:00:22
698500 -- [-883.996] (-885.091) (-884.007) (-883.685) * (-884.719) [-887.910] (-887.013) (-887.593) -- 0:00:22
699000 -- (-884.173) (-887.277) [-883.891] (-885.977) * (-883.578) [-885.487] (-887.655) (-885.409) -- 0:00:21
699500 -- (-883.892) [-884.123] (-884.621) (-885.361) * (-884.619) (-884.726) (-885.198) [-884.751] -- 0:00:21
700000 -- (-884.442) [-886.155] (-883.604) (-884.253) * (-885.406) (-888.431) [-884.278] (-885.143) -- 0:00:21
Average standard deviation of split frequencies: 0.006773
700500 -- (-884.375) [-883.935] (-884.635) (-884.339) * (-887.723) (-886.243) (-882.765) [-884.382] -- 0:00:21
701000 -- [-884.243] (-886.643) (-885.552) (-883.985) * (-887.862) (-886.251) [-884.030] (-887.589) -- 0:00:21
701500 -- [-885.620] (-888.964) (-883.548) (-888.975) * [-884.511] (-884.509) (-883.962) (-883.215) -- 0:00:21
702000 -- (-883.962) [-884.681] (-884.990) (-884.574) * [-883.912] (-887.093) (-884.990) (-883.854) -- 0:00:21
702500 -- (-884.090) [-885.140] (-885.722) (-882.803) * (-884.187) (-884.040) (-885.378) [-883.601] -- 0:00:21
703000 -- (-887.901) [-884.840] (-883.325) (-883.470) * (-884.364) [-891.176] (-885.241) (-886.235) -- 0:00:21
703500 -- (-885.052) (-887.983) [-883.112] (-882.715) * (-883.910) (-887.685) (-883.002) [-884.380] -- 0:00:21
704000 -- [-883.574] (-885.348) (-884.599) (-883.189) * (-883.895) (-885.846) [-883.980] (-883.475) -- 0:00:21
704500 -- (-885.204) (-883.167) (-884.810) [-884.695] * [-885.406] (-885.697) (-885.068) (-883.669) -- 0:00:21
705000 -- (-883.713) [-884.373] (-883.669) (-885.003) * [-886.082] (-886.893) (-887.413) (-884.058) -- 0:00:21
Average standard deviation of split frequencies: 0.006855
705500 -- (-884.437) [-883.574] (-889.943) (-888.520) * (-886.799) (-891.982) [-883.411] (-884.134) -- 0:00:21
706000 -- [-884.129] (-884.673) (-886.402) (-889.243) * (-885.241) (-892.232) (-883.255) [-886.481] -- 0:00:21
706500 -- [-886.305] (-886.178) (-885.567) (-889.965) * (-886.032) (-883.863) (-883.087) [-884.557] -- 0:00:21
707000 -- (-890.169) [-884.581] (-889.786) (-892.163) * (-885.144) (-885.197) [-884.461] (-883.581) -- 0:00:21
707500 -- (-883.907) (-884.234) [-888.558] (-886.463) * (-889.955) (-889.702) (-885.370) [-883.234] -- 0:00:21
708000 -- (-883.526) [-884.008] (-888.513) (-887.735) * (-883.578) (-887.722) [-885.055] (-884.168) -- 0:00:21
708500 -- (-884.881) (-884.751) (-884.587) [-886.040] * [-883.275] (-886.209) (-885.924) (-883.396) -- 0:00:21
709000 -- (-884.727) (-887.415) [-884.916] (-885.437) * (-883.423) [-885.468] (-889.867) (-883.226) -- 0:00:21
709500 -- (-885.680) (-886.540) (-885.043) [-884.498] * [-883.503] (-885.678) (-887.864) (-888.167) -- 0:00:21
710000 -- (-883.040) [-886.487] (-887.309) (-886.323) * (-884.193) (-885.116) (-889.011) [-885.856] -- 0:00:21
Average standard deviation of split frequencies: 0.007462
710500 -- (-884.527) (-885.127) (-886.660) [-883.999] * (-886.472) (-885.761) (-888.144) [-887.955] -- 0:00:21
711000 -- [-884.145] (-884.214) (-888.832) (-884.342) * (-885.778) [-883.270] (-885.105) (-883.054) -- 0:00:21
711500 -- (-884.708) [-884.751] (-886.560) (-883.560) * (-883.590) [-883.278] (-883.559) (-883.884) -- 0:00:21
712000 -- [-885.704] (-888.323) (-888.894) (-882.855) * (-889.029) (-883.779) [-886.101] (-883.841) -- 0:00:21
712500 -- (-884.481) [-884.826] (-886.116) (-885.772) * (-884.163) (-883.909) [-886.354] (-884.285) -- 0:00:20
713000 -- (-887.149) (-883.924) (-883.731) [-885.314] * (-884.277) [-883.656] (-884.110) (-883.508) -- 0:00:20
713500 -- [-883.536] (-889.134) (-888.956) (-886.246) * (-886.115) [-885.878] (-885.385) (-883.632) -- 0:00:20
714000 -- (-884.487) [-885.470] (-883.085) (-884.992) * [-885.219] (-885.488) (-887.477) (-884.578) -- 0:00:20
714500 -- (-886.400) (-887.578) [-884.822] (-888.171) * (-885.304) [-884.217] (-888.383) (-883.890) -- 0:00:21
715000 -- (-883.254) [-887.926] (-883.511) (-885.250) * (-885.051) [-885.512] (-888.070) (-886.048) -- 0:00:21
Average standard deviation of split frequencies: 0.007448
715500 -- (-885.889) (-883.009) [-884.132] (-883.811) * (-884.960) (-883.734) (-884.638) [-883.732] -- 0:00:21
716000 -- (-889.921) [-883.811] (-886.549) (-886.259) * (-884.642) (-884.510) (-883.070) [-886.341] -- 0:00:21
716500 -- (-884.409) [-884.147] (-885.275) (-889.717) * [-883.012] (-883.337) (-884.706) (-888.708) -- 0:00:20
717000 -- (-883.877) (-885.653) [-884.137] (-884.316) * [-884.803] (-883.318) (-885.632) (-886.682) -- 0:00:20
717500 -- (-885.762) (-886.308) [-883.668] (-885.128) * (-884.201) [-883.496] (-886.369) (-886.176) -- 0:00:20
718000 -- [-885.365] (-883.569) (-883.614) (-884.416) * (-883.698) [-883.373] (-888.896) (-885.074) -- 0:00:20
718500 -- (-884.433) [-883.598] (-884.401) (-883.389) * [-883.467] (-884.386) (-889.513) (-884.765) -- 0:00:20
719000 -- [-884.627] (-885.445) (-884.215) (-884.465) * [-883.839] (-884.808) (-887.096) (-886.281) -- 0:00:20
719500 -- (-885.083) [-885.385] (-885.719) (-883.642) * (-885.295) (-884.191) [-885.789] (-887.507) -- 0:00:20
720000 -- (-884.948) [-885.199] (-884.380) (-885.271) * (-884.136) (-884.753) (-884.683) [-883.591] -- 0:00:20
Average standard deviation of split frequencies: 0.007727
720500 -- (-884.956) (-884.195) (-884.127) [-886.533] * (-884.661) [-885.151] (-882.902) (-883.035) -- 0:00:20
721000 -- (-886.065) (-884.598) (-883.376) [-883.048] * (-887.326) (-884.848) (-883.709) [-884.193] -- 0:00:20
721500 -- (-885.415) [-883.661] (-884.316) (-885.150) * (-884.189) (-887.154) (-883.784) [-885.769] -- 0:00:20
722000 -- (-886.016) (-888.011) (-886.879) [-884.956] * (-886.735) (-887.295) (-883.281) [-884.095] -- 0:00:20
722500 -- (-884.172) [-884.362] (-886.475) (-883.491) * [-885.509] (-884.885) (-884.600) (-884.994) -- 0:00:20
723000 -- (-885.500) (-884.078) [-884.364] (-884.817) * (-886.313) [-885.016] (-886.079) (-885.481) -- 0:00:20
723500 -- (-884.533) [-885.268] (-885.528) (-885.769) * [-886.685] (-884.518) (-885.158) (-883.746) -- 0:00:20
724000 -- (-886.330) (-883.200) [-883.806] (-885.095) * (-885.725) (-887.687) [-883.621] (-888.384) -- 0:00:20
724500 -- [-887.353] (-883.756) (-884.026) (-883.498) * (-885.826) (-884.478) [-886.362] (-885.265) -- 0:00:20
725000 -- [-883.873] (-883.914) (-884.870) (-890.301) * (-883.783) (-886.682) [-889.374] (-888.956) -- 0:00:20
Average standard deviation of split frequencies: 0.008327
725500 -- (-883.769) [-885.788] (-885.460) (-885.063) * [-885.141] (-886.741) (-885.569) (-884.891) -- 0:00:20
726000 -- (-889.153) (-887.058) (-890.495) [-884.725] * (-884.277) (-884.676) (-884.269) [-885.984] -- 0:00:20
726500 -- (-884.568) (-886.254) (-886.291) [-883.998] * (-885.597) [-887.915] (-884.232) (-887.054) -- 0:00:20
727000 -- (-884.516) [-883.908] (-883.562) (-884.026) * (-885.851) (-883.554) (-886.247) [-884.577] -- 0:00:20
727500 -- [-886.146] (-886.735) (-884.544) (-883.474) * [-884.114] (-888.146) (-885.813) (-886.050) -- 0:00:20
728000 -- (-883.821) (-884.161) (-884.401) [-884.828] * (-886.422) (-884.016) [-888.660] (-888.497) -- 0:00:20
728500 -- (-885.124) [-882.670] (-885.052) (-884.356) * (-885.957) [-883.438] (-889.101) (-885.613) -- 0:00:20
729000 -- (-884.100) (-882.668) (-886.816) [-884.405] * (-885.834) (-885.343) (-884.391) [-883.911] -- 0:00:20
729500 -- (-885.752) (-884.372) [-883.900] (-884.715) * [-889.549] (-884.637) (-883.954) (-888.797) -- 0:00:20
730000 -- (-886.486) [-889.752] (-884.882) (-884.458) * [-884.667] (-883.754) (-885.214) (-885.426) -- 0:00:19
Average standard deviation of split frequencies: 0.007903
730500 -- (-885.724) [-885.438] (-889.598) (-887.753) * [-883.889] (-886.518) (-890.081) (-883.625) -- 0:00:19
731000 -- (-882.895) (-888.289) (-886.279) [-886.317] * [-883.146] (-884.990) (-884.073) (-884.647) -- 0:00:19
731500 -- (-886.276) (-884.015) (-885.193) [-885.307] * (-882.706) [-883.605] (-882.712) (-883.810) -- 0:00:19
732000 -- [-886.849] (-887.177) (-884.059) (-884.912) * [-887.488] (-883.704) (-883.793) (-884.559) -- 0:00:19
732500 -- (-883.183) [-884.612] (-885.261) (-884.391) * [-883.449] (-884.509) (-885.633) (-883.534) -- 0:00:19
733000 -- (-883.164) (-883.483) [-886.813] (-885.672) * [-884.012] (-883.647) (-885.965) (-883.575) -- 0:00:19
733500 -- (-886.092) [-883.106] (-883.266) (-884.599) * (-883.918) (-884.729) (-885.726) [-884.720] -- 0:00:19
734000 -- (-886.120) [-884.303] (-884.635) (-885.456) * [-884.104] (-883.123) (-887.573) (-884.674) -- 0:00:19
734500 -- (-886.420) (-883.354) [-885.195] (-892.421) * (-886.848) (-885.803) (-884.803) [-885.273] -- 0:00:19
735000 -- (-885.530) (-884.879) [-884.215] (-887.149) * (-887.176) [-887.950] (-882.720) (-884.962) -- 0:00:19
Average standard deviation of split frequencies: 0.008289
735500 -- (-885.919) (-888.122) [-884.579] (-885.822) * (-886.677) (-884.595) [-884.096] (-885.492) -- 0:00:19
736000 -- (-887.699) (-887.053) (-885.242) [-886.109] * (-885.998) (-885.706) [-886.222] (-891.047) -- 0:00:19
736500 -- (-886.258) (-887.881) (-884.663) [-887.319] * (-885.031) (-887.026) [-883.624] (-884.573) -- 0:00:19
737000 -- (-884.696) (-885.307) (-884.206) [-884.458] * (-888.985) [-884.581] (-883.685) (-883.493) -- 0:00:19
737500 -- [-887.007] (-886.135) (-883.800) (-885.706) * (-886.774) (-885.353) (-884.578) [-884.522] -- 0:00:19
738000 -- (-884.340) (-887.325) (-885.044) [-883.387] * (-887.319) (-883.928) (-886.848) [-883.050] -- 0:00:19
738500 -- (-883.621) [-885.254] (-884.232) (-888.207) * [-885.038] (-884.313) (-888.822) (-885.777) -- 0:00:19
739000 -- (-883.817) (-884.725) [-884.356] (-888.991) * [-888.249] (-884.562) (-891.793) (-884.149) -- 0:00:19
739500 -- (-883.513) (-886.185) [-883.213] (-886.706) * [-886.226] (-887.625) (-889.214) (-884.085) -- 0:00:19
740000 -- (-883.505) (-885.113) (-883.185) [-884.406] * [-885.164] (-883.563) (-884.643) (-884.622) -- 0:00:19
Average standard deviation of split frequencies: 0.008115
740500 -- (-883.534) (-884.027) (-884.805) [-885.475] * [-888.224] (-883.580) (-885.109) (-887.062) -- 0:00:19
741000 -- [-884.736] (-884.641) (-885.286) (-887.837) * (-886.844) (-886.086) [-887.354] (-888.641) -- 0:00:19
741500 -- (-886.687) [-886.666] (-883.834) (-883.814) * [-883.569] (-883.572) (-885.472) (-885.945) -- 0:00:19
742000 -- (-883.627) (-885.498) [-883.877] (-883.396) * [-885.118] (-886.811) (-883.594) (-885.332) -- 0:00:19
742500 -- (-884.479) (-887.400) [-884.908] (-885.521) * (-886.509) (-885.120) [-883.483] (-884.196) -- 0:00:19
743000 -- (-883.834) (-890.086) (-886.138) [-889.588] * (-886.019) [-887.061] (-885.468) (-883.615) -- 0:00:19
743500 -- (-886.463) (-885.447) [-884.511] (-883.810) * (-886.158) (-884.515) [-885.233] (-883.748) -- 0:00:18
744000 -- (-884.891) [-884.932] (-884.495) (-889.708) * [-883.454] (-883.416) (-883.703) (-883.800) -- 0:00:18
744500 -- (-886.687) (-884.890) (-884.301) [-883.861] * (-883.287) (-883.213) [-886.263] (-885.164) -- 0:00:18
745000 -- (-885.949) [-883.570] (-886.908) (-885.303) * [-884.846] (-886.884) (-889.505) (-888.638) -- 0:00:18
Average standard deviation of split frequencies: 0.008438
745500 -- (-884.877) (-883.793) [-884.366] (-884.007) * [-886.441] (-885.643) (-889.492) (-886.479) -- 0:00:18
746000 -- (-884.937) (-884.587) (-885.941) [-886.843] * (-883.217) (-883.108) [-885.124] (-885.494) -- 0:00:18
746500 -- (-887.773) (-883.342) [-887.522] (-882.822) * (-883.217) (-883.383) [-885.504] (-882.797) -- 0:00:18
747000 -- (-888.552) (-886.071) (-886.939) [-885.854] * (-884.226) (-883.917) [-884.192] (-886.705) -- 0:00:18
747500 -- (-885.942) (-886.830) [-883.633] (-883.236) * (-883.140) [-884.053] (-884.658) (-888.588) -- 0:00:18
748000 -- (-885.424) [-885.859] (-884.973) (-883.851) * [-882.688] (-884.311) (-887.432) (-885.623) -- 0:00:18
748500 -- (-883.805) (-885.737) [-885.194] (-887.481) * (-883.928) (-884.382) [-885.728] (-885.911) -- 0:00:18
749000 -- [-885.119] (-883.129) (-884.804) (-887.564) * (-887.680) (-883.713) [-887.201] (-883.346) -- 0:00:18
749500 -- (-884.160) (-883.434) [-883.067] (-886.628) * [-883.745] (-884.379) (-885.270) (-883.284) -- 0:00:18
750000 -- [-884.645] (-885.940) (-886.502) (-886.524) * (-889.144) [-889.862] (-885.256) (-885.011) -- 0:00:18
Average standard deviation of split frequencies: 0.008085
750500 -- [-885.607] (-885.935) (-883.421) (-886.547) * [-884.883] (-888.328) (-883.876) (-884.617) -- 0:00:18
751000 -- (-886.842) (-887.079) (-886.018) [-885.044] * (-886.218) (-887.806) [-882.962] (-888.364) -- 0:00:18
751500 -- (-886.937) [-885.308] (-883.684) (-886.387) * (-884.049) [-884.891] (-883.577) (-887.687) -- 0:00:18
752000 -- (-884.937) [-884.164] (-884.671) (-884.157) * [-886.987] (-883.659) (-883.032) (-885.862) -- 0:00:18
752500 -- (-885.352) [-882.911] (-884.239) (-884.004) * (-885.954) [-883.130] (-885.104) (-884.815) -- 0:00:18
753000 -- (-884.385) [-883.226] (-885.119) (-884.142) * (-886.909) [-883.455] (-885.560) (-885.243) -- 0:00:18
753500 -- (-887.166) [-883.359] (-888.726) (-883.905) * (-885.601) [-887.533] (-882.798) (-886.089) -- 0:00:18
754000 -- (-885.177) (-884.038) (-887.580) [-885.240] * [-885.189] (-888.211) (-882.946) (-885.658) -- 0:00:18
754500 -- (-886.259) [-883.195] (-885.273) (-883.870) * (-884.059) [-884.859] (-883.085) (-889.945) -- 0:00:18
755000 -- (-885.209) (-886.002) (-886.212) [-883.564] * (-885.126) [-884.436] (-888.569) (-884.283) -- 0:00:18
Average standard deviation of split frequencies: 0.008145
755500 -- (-886.338) (-885.149) (-885.001) [-885.247] * (-885.908) (-884.780) (-883.061) [-888.999] -- 0:00:18
756000 -- (-887.455) (-883.237) [-884.995] (-883.224) * (-888.108) (-884.452) [-887.176] (-885.688) -- 0:00:18
756500 -- [-884.500] (-883.328) (-884.212) (-883.369) * (-885.663) (-884.950) [-884.769] (-886.260) -- 0:00:18
757000 -- (-885.006) (-886.495) (-883.031) [-888.062] * (-884.496) [-883.120] (-883.012) (-887.275) -- 0:00:17
757500 -- (-883.404) (-884.923) [-883.551] (-884.779) * (-883.319) (-884.683) [-885.273] (-887.644) -- 0:00:17
758000 -- (-885.210) (-883.998) [-885.308] (-887.867) * (-884.751) [-884.518] (-883.030) (-888.365) -- 0:00:17
758500 -- [-885.565] (-883.848) (-885.636) (-882.999) * (-885.291) (-885.263) [-884.389] (-884.564) -- 0:00:17
759000 -- (-886.166) [-884.143] (-883.746) (-886.720) * [-886.342] (-884.441) (-883.841) (-884.438) -- 0:00:17
759500 -- (-886.313) (-885.214) (-888.227) [-886.118] * (-884.478) [-888.165] (-885.257) (-883.650) -- 0:00:17
760000 -- [-884.684] (-885.106) (-891.643) (-884.688) * (-885.863) (-885.619) (-889.664) [-884.193] -- 0:00:17
Average standard deviation of split frequencies: 0.007979
760500 -- (-884.418) (-886.422) (-889.195) [-884.647] * [-885.139] (-883.736) (-885.204) (-886.085) -- 0:00:17
761000 -- (-883.871) [-885.261] (-886.103) (-887.777) * (-886.450) [-883.829] (-884.556) (-883.859) -- 0:00:17
761500 -- (-882.887) (-884.600) [-884.524] (-883.599) * (-886.012) (-883.522) (-888.223) [-884.743] -- 0:00:17
762000 -- (-884.035) [-885.016] (-884.505) (-885.502) * (-885.295) (-885.521) [-885.227] (-884.317) -- 0:00:17
762500 -- (-891.193) (-885.978) [-884.244] (-883.562) * (-886.858) [-884.755] (-884.879) (-885.916) -- 0:00:17
763000 -- [-885.511] (-888.140) (-883.299) (-884.175) * (-888.069) (-888.641) [-883.072] (-885.511) -- 0:00:17
763500 -- (-884.027) (-883.034) (-884.244) [-887.661] * (-890.258) [-885.940] (-884.521) (-887.836) -- 0:00:17
764000 -- (-884.375) (-886.218) [-885.049] (-888.599) * [-887.239] (-885.178) (-884.464) (-885.145) -- 0:00:17
764500 -- (-883.252) (-883.243) (-885.233) [-885.187] * (-890.634) (-883.704) [-886.403] (-884.006) -- 0:00:17
765000 -- [-883.813] (-885.219) (-892.369) (-886.230) * (-883.868) [-884.764] (-889.681) (-886.361) -- 0:00:17
Average standard deviation of split frequencies: 0.007808
765500 -- (-883.736) [-883.759] (-884.541) (-884.004) * (-884.395) (-886.260) [-885.080] (-883.478) -- 0:00:17
766000 -- (-883.964) (-887.154) (-885.438) [-883.262] * [-884.205] (-888.290) (-884.431) (-883.281) -- 0:00:17
766500 -- (-884.291) [-884.590] (-885.551) (-886.010) * [-884.359] (-886.279) (-884.845) (-885.966) -- 0:00:17
767000 -- (-885.175) (-885.342) (-887.132) [-882.837] * (-883.104) (-885.073) (-885.890) [-883.994] -- 0:00:17
767500 -- [-883.762] (-886.763) (-886.772) (-884.821) * (-884.578) [-885.362] (-887.602) (-883.971) -- 0:00:17
768000 -- [-885.345] (-884.921) (-886.984) (-892.815) * [-883.388] (-891.113) (-885.667) (-886.333) -- 0:00:17
768500 -- [-887.206] (-886.438) (-884.915) (-885.406) * (-884.861) (-883.899) (-885.656) [-884.276] -- 0:00:17
769000 -- (-888.130) (-883.467) (-883.014) [-885.889] * (-883.614) [-883.441] (-882.745) (-884.770) -- 0:00:17
769500 -- (-884.169) [-883.396] (-885.178) (-884.187) * (-883.074) [-884.605] (-885.776) (-883.839) -- 0:00:17
770000 -- [-884.270] (-883.173) (-885.359) (-887.338) * [-886.815] (-886.431) (-884.786) (-885.840) -- 0:00:17
Average standard deviation of split frequencies: 0.007570
770500 -- (-891.583) (-886.924) [-886.793] (-883.539) * (-886.737) (-883.888) [-883.553] (-889.914) -- 0:00:16
771000 -- [-887.438] (-885.349) (-886.728) (-883.500) * (-883.482) [-890.278] (-883.523) (-885.407) -- 0:00:16
771500 -- (-884.890) [-885.200] (-883.031) (-885.186) * (-886.451) (-884.722) (-883.438) [-883.552] -- 0:00:16
772000 -- [-885.927] (-885.443) (-886.380) (-883.253) * (-883.673) [-884.876] (-884.992) (-882.974) -- 0:00:16
772500 -- (-886.320) [-884.586] (-884.589) (-885.389) * (-885.363) (-889.466) (-887.554) [-886.720] -- 0:00:16
773000 -- [-889.045] (-884.152) (-883.654) (-889.261) * (-883.263) (-889.527) [-885.948] (-884.844) -- 0:00:17
773500 -- (-889.649) (-884.137) [-883.208] (-883.359) * (-883.388) (-887.864) (-887.819) [-884.444] -- 0:00:16
774000 -- (-888.657) (-887.381) (-886.747) [-885.701] * (-883.544) [-886.137] (-886.067) (-883.809) -- 0:00:16
774500 -- [-888.396] (-888.487) (-885.577) (-888.242) * (-884.740) (-887.673) (-884.405) [-883.691] -- 0:00:16
775000 -- (-885.593) (-883.387) (-887.164) [-885.845] * (-883.468) [-886.341] (-885.667) (-883.764) -- 0:00:16
Average standard deviation of split frequencies: 0.006644
775500 -- (-885.788) [-884.276] (-887.266) (-887.508) * [-884.564] (-887.756) (-885.457) (-883.871) -- 0:00:16
776000 -- (-885.717) [-883.876] (-886.723) (-886.983) * (-887.233) (-886.786) (-883.567) [-886.048] -- 0:00:16
776500 -- [-883.605] (-882.829) (-885.739) (-884.478) * (-886.431) (-883.906) (-886.270) [-884.067] -- 0:00:16
777000 -- (-883.348) [-883.170] (-887.943) (-885.397) * (-886.245) (-883.927) (-884.814) [-889.780] -- 0:00:16
777500 -- (-883.448) (-885.712) [-884.854] (-886.983) * [-884.762] (-883.211) (-883.949) (-884.129) -- 0:00:16
778000 -- (-884.122) [-885.553] (-884.063) (-884.779) * (-884.871) (-884.213) (-887.031) [-883.065] -- 0:00:16
778500 -- [-885.456] (-885.148) (-885.354) (-884.751) * (-884.953) (-884.249) (-885.967) [-882.911] -- 0:00:16
779000 -- (-887.101) [-885.116] (-885.844) (-883.983) * (-884.488) [-884.507] (-885.175) (-885.128) -- 0:00:16
779500 -- (-886.465) [-886.242] (-886.590) (-889.644) * (-884.219) (-884.808) (-884.845) [-883.677] -- 0:00:16
780000 -- [-885.985] (-886.014) (-885.326) (-889.921) * (-883.378) (-886.453) [-883.774] (-883.838) -- 0:00:16
Average standard deviation of split frequencies: 0.006529
780500 -- (-883.248) (-887.164) (-887.945) [-884.496] * [-883.061] (-884.127) (-885.773) (-885.649) -- 0:00:16
781000 -- [-883.581] (-884.675) (-889.597) (-888.439) * (-885.538) [-882.639] (-885.207) (-884.319) -- 0:00:16
781500 -- [-883.831] (-884.942) (-883.953) (-885.749) * [-883.762] (-884.707) (-883.806) (-883.061) -- 0:00:16
782000 -- [-884.436] (-887.819) (-882.651) (-884.537) * (-885.388) [-885.003] (-884.616) (-883.236) -- 0:00:16
782500 -- [-887.904] (-886.506) (-884.591) (-883.616) * (-888.844) (-882.915) (-883.692) [-885.107] -- 0:00:16
783000 -- [-884.391] (-886.475) (-885.266) (-883.616) * (-884.875) (-882.945) [-884.162] (-886.720) -- 0:00:16
783500 -- [-883.760] (-886.882) (-883.944) (-884.866) * (-885.842) (-883.669) (-883.890) [-882.630] -- 0:00:16
784000 -- (-883.824) (-886.723) [-884.540] (-885.040) * (-883.237) [-883.989] (-883.622) (-885.818) -- 0:00:15
784500 -- (-883.422) [-887.661] (-885.833) (-885.668) * [-883.729] (-884.960) (-884.405) (-886.906) -- 0:00:15
785000 -- (-883.631) (-885.792) (-884.095) [-884.767] * (-884.903) [-885.278] (-884.418) (-888.565) -- 0:00:16
Average standard deviation of split frequencies: 0.006710
785500 -- (-884.345) (-883.335) (-884.073) [-885.729] * [-884.962] (-886.686) (-886.962) (-889.767) -- 0:00:16
786000 -- (-886.151) (-886.025) (-884.389) [-887.046] * (-889.378) (-884.733) [-885.052] (-888.052) -- 0:00:16
786500 -- (-891.295) (-887.282) [-885.340] (-886.483) * (-886.093) (-883.306) (-885.076) [-886.318] -- 0:00:16
787000 -- (-889.752) [-886.153] (-888.300) (-887.570) * (-885.163) (-886.444) (-883.839) [-883.774] -- 0:00:15
787500 -- (-884.236) (-888.317) [-886.385] (-886.219) * (-885.686) (-884.331) [-884.475] (-884.147) -- 0:00:15
788000 -- (-885.597) (-887.675) (-885.423) [-884.247] * (-884.476) (-884.082) [-883.783] (-885.989) -- 0:00:15
788500 -- [-883.927] (-888.754) (-883.036) (-883.822) * (-888.568) (-884.528) [-885.052] (-887.583) -- 0:00:15
789000 -- (-886.232) (-884.290) [-884.999] (-885.482) * [-885.655] (-884.513) (-885.213) (-885.044) -- 0:00:15
789500 -- (-884.794) (-887.534) [-884.220] (-885.781) * (-885.752) [-884.897] (-884.477) (-884.975) -- 0:00:15
790000 -- (-884.220) (-886.846) [-884.109] (-887.635) * (-883.311) (-884.131) [-883.872] (-883.758) -- 0:00:15
Average standard deviation of split frequencies: 0.006521
790500 -- [-885.438] (-885.577) (-885.869) (-883.668) * [-884.379] (-885.209) (-885.163) (-885.027) -- 0:00:15
791000 -- [-885.255] (-886.373) (-882.983) (-888.075) * (-885.328) (-887.352) (-884.919) [-884.594] -- 0:00:15
791500 -- [-884.257] (-882.946) (-883.465) (-884.836) * (-883.372) (-892.195) (-886.158) [-882.846] -- 0:00:15
792000 -- [-885.624] (-883.247) (-886.978) (-886.585) * (-887.806) (-887.638) [-883.825] (-884.205) -- 0:00:15
792500 -- [-886.921] (-888.190) (-884.056) (-884.543) * [-883.601] (-887.629) (-883.907) (-886.544) -- 0:00:15
793000 -- (-885.194) (-888.852) [-889.205] (-883.350) * (-884.847) (-889.196) [-887.459] (-883.521) -- 0:00:15
793500 -- (-883.633) (-883.623) (-888.715) [-885.462] * (-884.855) (-886.277) [-883.970] (-885.760) -- 0:00:15
794000 -- (-883.441) (-883.622) (-888.633) [-886.047] * (-887.793) (-891.392) (-883.831) [-884.629] -- 0:00:15
794500 -- (-882.900) [-885.584] (-884.026) (-885.233) * [-884.352] (-886.188) (-885.664) (-883.887) -- 0:00:15
795000 -- [-883.036] (-885.080) (-884.578) (-883.256) * [-883.474] (-885.505) (-884.884) (-884.672) -- 0:00:15
Average standard deviation of split frequencies: 0.006625
795500 -- (-884.157) (-889.220) [-885.166] (-885.709) * [-891.837] (-886.588) (-883.807) (-886.332) -- 0:00:15
796000 -- [-884.327] (-887.072) (-885.014) (-885.854) * (-893.509) (-886.160) (-884.438) [-883.902] -- 0:00:15
796500 -- (-886.520) (-888.355) [-884.643] (-884.162) * (-885.976) [-884.195] (-885.479) (-885.613) -- 0:00:15
797000 -- (-884.015) (-886.552) [-884.561] (-887.072) * (-885.441) [-885.615] (-886.784) (-884.533) -- 0:00:15
797500 -- [-887.472] (-886.913) (-888.380) (-888.090) * (-887.854) (-885.318) (-884.100) [-885.302] -- 0:00:14
798000 -- (-886.011) [-888.925] (-888.549) (-885.357) * (-883.446) (-885.263) [-883.130] (-884.063) -- 0:00:15
798500 -- (-883.629) (-892.028) (-887.416) [-886.010] * (-885.720) (-883.450) (-884.215) [-884.798] -- 0:00:15
799000 -- (-883.555) [-883.235] (-887.412) (-883.809) * (-885.758) (-887.984) (-887.193) [-883.940] -- 0:00:15
799500 -- (-884.714) [-883.663] (-891.585) (-886.169) * (-885.060) [-883.726] (-888.215) (-884.579) -- 0:00:15
800000 -- (-883.693) (-884.161) [-883.561] (-887.180) * (-888.143) (-884.738) (-885.045) [-884.830] -- 0:00:14
Average standard deviation of split frequencies: 0.005888
800500 -- (-883.809) (-884.326) (-885.127) [-886.494] * (-890.524) (-883.357) [-884.005] (-884.364) -- 0:00:14
801000 -- (-885.525) (-884.072) (-884.263) [-885.546] * [-883.002] (-883.085) (-883.709) (-883.726) -- 0:00:14
801500 -- [-885.143] (-885.892) (-884.308) (-886.445) * [-883.658] (-883.794) (-884.715) (-887.684) -- 0:00:14
802000 -- [-883.573] (-884.770) (-884.755) (-886.865) * (-883.859) (-885.244) (-886.498) [-884.476] -- 0:00:14
802500 -- [-884.455] (-883.799) (-886.302) (-886.445) * (-887.898) [-885.384] (-885.505) (-887.886) -- 0:00:14
803000 -- (-885.136) [-887.369] (-883.542) (-886.604) * [-884.271] (-888.484) (-884.647) (-887.788) -- 0:00:14
803500 -- [-886.106] (-888.094) (-883.427) (-886.228) * (-888.919) [-883.058] (-887.246) (-885.731) -- 0:00:14
804000 -- [-888.180] (-886.462) (-887.420) (-883.855) * (-885.219) (-883.325) [-886.031] (-883.193) -- 0:00:14
804500 -- (-884.700) (-884.234) (-883.556) [-884.985] * (-888.697) [-883.133] (-883.838) (-884.088) -- 0:00:14
805000 -- (-885.496) [-885.491] (-883.356) (-888.402) * (-885.718) [-885.949] (-883.272) (-884.178) -- 0:00:14
Average standard deviation of split frequencies: 0.006005
805500 -- [-883.365] (-885.922) (-883.065) (-883.018) * (-883.650) (-884.716) [-884.540] (-883.597) -- 0:00:14
806000 -- (-883.547) (-888.526) (-887.118) [-883.164] * (-884.235) (-884.587) [-885.221] (-883.346) -- 0:00:14
806500 -- (-884.780) [-886.635] (-886.811) (-886.742) * (-886.868) (-885.875) [-884.659] (-886.242) -- 0:00:14
807000 -- [-885.739] (-888.681) (-885.860) (-890.414) * (-887.406) (-883.682) [-884.586] (-885.478) -- 0:00:14
807500 -- (-886.179) (-885.083) (-882.944) [-883.327] * [-884.705] (-885.275) (-884.157) (-884.755) -- 0:00:14
808000 -- (-886.777) [-885.219] (-883.398) (-883.710) * [-884.419] (-883.337) (-882.757) (-887.646) -- 0:00:14
808500 -- (-883.517) (-892.101) (-883.538) [-885.331] * [-885.959] (-887.555) (-883.259) (-887.484) -- 0:00:14
809000 -- (-885.468) [-887.057] (-884.143) (-884.339) * (-887.622) (-885.252) [-886.874] (-885.042) -- 0:00:14
809500 -- (-885.426) (-883.885) (-887.919) [-888.919] * (-888.383) (-885.648) (-884.579) [-885.355] -- 0:00:14
810000 -- (-888.129) (-890.315) [-887.088] (-884.901) * (-884.188) (-886.166) (-885.025) [-883.637] -- 0:00:14
Average standard deviation of split frequencies: 0.005854
810500 -- (-886.737) [-884.261] (-888.757) (-889.569) * (-886.059) (-883.888) [-884.087] (-884.148) -- 0:00:14
811000 -- (-886.728) [-887.442] (-885.147) (-883.588) * [-883.347] (-884.295) (-884.229) (-887.144) -- 0:00:13
811500 -- [-883.629] (-883.891) (-885.876) (-884.418) * (-883.690) (-883.142) [-882.894] (-883.970) -- 0:00:14
812000 -- (-883.695) [-886.609] (-887.068) (-888.787) * [-883.131] (-884.194) (-883.773) (-886.006) -- 0:00:14
812500 -- (-885.436) (-884.663) (-885.894) [-883.389] * (-882.755) (-884.302) (-885.073) [-885.716] -- 0:00:14
813000 -- (-884.394) (-883.670) [-888.372] (-884.255) * [-883.368] (-885.988) (-884.945) (-884.436) -- 0:00:14
813500 -- (-883.852) (-885.879) (-889.509) [-883.538] * (-885.339) [-884.887] (-889.879) (-885.765) -- 0:00:13
814000 -- [-883.825] (-886.309) (-886.460) (-883.732) * (-885.076) (-884.331) (-885.916) [-885.739] -- 0:00:13
814500 -- (-885.805) (-886.447) (-887.863) [-886.569] * (-885.064) (-885.860) (-883.407) [-883.609] -- 0:00:13
815000 -- (-883.748) [-885.751] (-887.770) (-884.155) * (-885.679) (-886.003) [-883.170] (-887.155) -- 0:00:13
Average standard deviation of split frequencies: 0.005623
815500 -- (-887.581) (-883.035) [-885.779] (-886.920) * (-884.196) [-883.520] (-882.915) (-885.853) -- 0:00:13
816000 -- (-888.491) (-885.025) (-885.107) [-884.077] * [-884.193] (-883.086) (-885.301) (-884.888) -- 0:00:13
816500 -- [-884.186] (-885.126) (-884.746) (-886.977) * (-883.101) [-885.780] (-883.359) (-885.974) -- 0:00:13
817000 -- (-883.664) (-886.506) (-885.228) [-884.380] * [-883.006] (-883.902) (-883.479) (-883.615) -- 0:00:13
817500 -- (-883.288) (-884.169) [-886.733] (-883.259) * [-883.030] (-889.212) (-884.152) (-883.185) -- 0:00:13
818000 -- (-883.980) (-884.677) [-885.448] (-883.543) * (-885.097) [-886.635] (-885.607) (-888.336) -- 0:00:13
818500 -- [-884.927] (-884.519) (-885.833) (-883.957) * (-884.534) [-886.116] (-886.285) (-890.095) -- 0:00:13
819000 -- (-886.104) [-884.149] (-886.842) (-883.540) * (-885.566) (-883.616) [-888.491] (-885.154) -- 0:00:13
819500 -- (-883.003) (-886.563) [-883.997] (-884.262) * (-886.690) (-885.493) [-885.824] (-884.786) -- 0:00:13
820000 -- (-884.062) (-890.862) (-884.001) [-883.173] * (-887.602) (-883.027) [-883.935] (-885.652) -- 0:00:13
Average standard deviation of split frequencies: 0.005323
820500 -- [-883.905] (-884.686) (-886.118) (-885.526) * [-887.010] (-884.162) (-885.889) (-886.551) -- 0:00:13
821000 -- (-885.975) [-883.783] (-883.631) (-889.493) * (-887.491) [-883.070] (-886.412) (-883.500) -- 0:00:13
821500 -- (-883.488) [-884.755] (-891.244) (-884.745) * (-884.322) (-884.273) (-884.914) [-885.396] -- 0:00:13
822000 -- (-885.620) [-885.366] (-887.724) (-886.995) * (-888.783) (-887.765) [-883.591] (-884.062) -- 0:00:13
822500 -- (-886.694) (-886.123) (-886.256) [-882.990] * (-887.814) [-884.176] (-886.218) (-886.074) -- 0:00:13
823000 -- (-884.441) [-883.490] (-886.604) (-883.903) * [-888.240] (-883.495) (-883.811) (-883.240) -- 0:00:13
823500 -- (-884.587) (-882.797) [-883.410] (-883.314) * (-887.448) (-883.247) [-885.031] (-884.616) -- 0:00:13
824000 -- (-887.361) (-884.809) [-883.252] (-886.583) * (-884.824) (-883.186) [-884.691] (-883.898) -- 0:00:13
824500 -- (-885.119) [-885.504] (-883.798) (-884.110) * (-885.224) (-884.426) [-887.907] (-884.081) -- 0:00:12
825000 -- (-884.636) [-884.336] (-889.970) (-884.031) * [-883.892] (-883.040) (-885.177) (-884.681) -- 0:00:12
Average standard deviation of split frequencies: 0.005859
825500 -- (-886.486) [-884.931] (-884.570) (-883.452) * (-891.147) [-883.328] (-885.785) (-883.499) -- 0:00:13
826000 -- (-885.231) [-885.422] (-886.541) (-885.187) * (-884.594) [-885.253] (-887.322) (-884.527) -- 0:00:13
826500 -- (-885.812) (-884.121) [-882.881] (-885.656) * [-884.308] (-883.808) (-885.322) (-884.525) -- 0:00:13
827000 -- [-884.951] (-883.390) (-883.047) (-885.359) * (-885.409) [-884.215] (-883.876) (-884.809) -- 0:00:12
827500 -- [-885.396] (-885.040) (-883.103) (-886.040) * (-888.055) (-887.079) (-885.688) [-884.749] -- 0:00:12
828000 -- (-884.571) (-883.667) [-885.156] (-886.537) * (-887.429) [-884.917] (-886.991) (-887.649) -- 0:00:12
828500 -- (-886.051) (-884.157) (-887.294) [-887.676] * (-889.993) (-884.550) (-883.018) [-883.842] -- 0:00:12
829000 -- (-884.315) (-884.406) [-884.411] (-886.735) * (-891.636) (-884.186) (-883.030) [-883.594] -- 0:00:12
829500 -- (-886.136) [-886.777] (-885.363) (-885.045) * (-889.472) [-885.243] (-888.272) (-883.705) -- 0:00:12
830000 -- [-884.042] (-887.250) (-888.821) (-885.119) * (-889.613) [-883.215] (-886.626) (-885.685) -- 0:00:12
Average standard deviation of split frequencies: 0.006313
830500 -- [-884.651] (-886.787) (-886.161) (-884.132) * (-885.095) [-884.897] (-885.734) (-885.248) -- 0:00:12
831000 -- (-884.133) [-887.717] (-885.825) (-885.717) * (-884.883) (-886.628) (-885.946) [-885.939] -- 0:00:12
831500 -- (-885.793) [-886.983] (-884.838) (-884.199) * (-884.787) (-884.027) [-888.177] (-887.366) -- 0:00:12
832000 -- [-886.703] (-885.849) (-883.552) (-886.114) * [-887.063] (-886.836) (-886.129) (-888.710) -- 0:00:12
832500 -- (-887.980) (-886.837) [-884.552] (-885.036) * (-887.473) [-883.640] (-884.030) (-886.566) -- 0:00:12
833000 -- [-885.020] (-886.762) (-884.237) (-886.785) * (-886.829) (-886.081) [-886.788] (-885.704) -- 0:00:12
833500 -- (-884.388) (-885.068) (-888.454) [-883.335] * [-885.224] (-885.563) (-883.580) (-884.679) -- 0:00:12
834000 -- [-884.038] (-883.971) (-883.624) (-885.595) * (-884.355) (-889.720) (-884.507) [-884.749] -- 0:00:12
834500 -- (-885.105) (-884.154) (-884.123) [-885.442] * (-884.952) (-887.766) (-886.251) [-885.480] -- 0:00:12
835000 -- (-885.512) (-886.801) [-884.450] (-884.704) * [-885.135] (-886.386) (-887.559) (-887.013) -- 0:00:12
Average standard deviation of split frequencies: 0.006344
835500 -- (-890.717) (-887.194) (-884.610) [-886.577] * (-884.089) (-884.972) (-882.961) [-883.664] -- 0:00:12
836000 -- (-886.513) (-884.988) (-887.422) [-882.860] * [-883.259] (-885.078) (-882.961) (-885.222) -- 0:00:12
836500 -- (-884.083) (-883.900) (-885.403) [-884.144] * (-885.170) (-883.366) [-884.265] (-886.700) -- 0:00:12
837000 -- [-884.226] (-883.255) (-886.779) (-883.802) * [-885.054] (-888.969) (-884.476) (-883.491) -- 0:00:12
837500 -- [-885.822] (-891.129) (-886.748) (-886.734) * (-885.869) (-886.518) [-887.147] (-883.113) -- 0:00:12
838000 -- (-885.696) (-886.538) (-886.707) [-883.675] * (-886.692) [-883.363] (-886.608) (-886.173) -- 0:00:12
838500 -- [-885.001] (-885.283) (-882.895) (-883.296) * [-891.165] (-884.450) (-885.941) (-887.682) -- 0:00:12
839000 -- (-887.345) [-888.070] (-894.021) (-884.775) * (-886.447) [-885.438] (-886.916) (-887.328) -- 0:00:12
839500 -- [-890.205] (-884.039) (-884.513) (-885.381) * (-883.424) [-887.137] (-885.075) (-883.961) -- 0:00:12
840000 -- (-885.591) (-886.991) [-888.489] (-885.990) * (-886.787) [-889.163] (-885.373) (-886.955) -- 0:00:11
Average standard deviation of split frequencies: 0.005608
840500 -- [-884.436] (-888.248) (-884.721) (-886.247) * (-886.381) [-886.573] (-885.552) (-884.116) -- 0:00:11
841000 -- (-885.294) [-884.358] (-886.065) (-884.608) * [-885.532] (-883.823) (-888.325) (-886.969) -- 0:00:11
841500 -- [-885.293] (-887.540) (-886.622) (-883.924) * (-884.170) [-886.703] (-884.946) (-891.054) -- 0:00:11
842000 -- (-886.957) (-885.769) (-885.194) [-884.087] * (-883.686) (-884.396) [-883.742] (-886.922) -- 0:00:11
842500 -- [-884.814] (-885.259) (-887.460) (-890.036) * [-883.486] (-887.226) (-884.739) (-888.352) -- 0:00:11
843000 -- (-890.773) (-884.303) (-882.964) [-885.712] * (-885.434) (-888.878) [-885.290] (-889.163) -- 0:00:11
843500 -- (-884.691) (-882.945) (-885.823) [-886.059] * (-885.857) (-886.778) [-887.339] (-885.252) -- 0:00:11
844000 -- (-884.295) (-887.947) [-884.460] (-886.433) * [-886.221] (-883.846) (-885.056) (-884.115) -- 0:00:11
844500 -- (-883.902) [-887.948] (-887.465) (-886.085) * [-885.315] (-883.865) (-888.053) (-884.925) -- 0:00:11
845000 -- (-885.840) [-885.568] (-887.350) (-884.441) * (-885.899) [-885.110] (-891.909) (-883.494) -- 0:00:11
Average standard deviation of split frequencies: 0.005646
845500 -- [-884.133] (-883.428) (-887.840) (-884.637) * (-884.564) (-886.581) [-884.783] (-884.295) -- 0:00:11
846000 -- (-886.182) (-884.857) (-889.361) [-884.319] * (-883.989) (-884.349) (-886.999) [-886.699] -- 0:00:11
846500 -- (-886.153) (-892.393) [-883.905] (-886.932) * (-886.023) (-886.248) [-886.051] (-883.730) -- 0:00:11
847000 -- (-884.585) (-886.432) [-884.830] (-884.016) * [-883.500] (-883.548) (-884.411) (-886.030) -- 0:00:11
847500 -- [-884.445] (-883.774) (-887.551) (-884.800) * (-883.449) (-889.844) [-885.541] (-883.910) -- 0:00:11
848000 -- (-885.330) (-884.426) (-887.090) [-889.574] * (-883.308) [-884.087] (-884.862) (-883.645) -- 0:00:11
848500 -- (-884.638) (-883.255) (-886.731) [-885.146] * (-884.263) [-884.038] (-884.429) (-885.237) -- 0:00:11
849000 -- (-883.747) (-886.920) (-884.266) [-884.125] * (-886.283) (-887.217) (-884.826) [-884.602] -- 0:00:11
849500 -- (-883.923) (-885.734) [-885.205] (-883.293) * (-885.210) (-887.709) [-882.858] (-885.054) -- 0:00:11
850000 -- (-883.705) (-885.986) [-887.072] (-884.179) * (-883.551) [-884.049] (-882.636) (-885.619) -- 0:00:11
Average standard deviation of split frequencies: 0.005615
850500 -- (-886.641) (-884.924) (-884.349) [-883.616] * (-884.014) [-883.990] (-883.488) (-883.368) -- 0:00:11
851000 -- [-886.823] (-884.968) (-888.889) (-883.326) * [-884.702] (-885.470) (-884.255) (-886.403) -- 0:00:11
851500 -- (-889.611) [-884.130] (-891.876) (-883.165) * (-885.786) (-887.470) [-884.573] (-886.716) -- 0:00:11
852000 -- (-884.580) (-886.710) [-884.887] (-885.099) * (-885.990) (-886.761) (-883.876) [-884.454] -- 0:00:11
852500 -- [-883.996] (-884.837) (-886.772) (-884.555) * [-884.774] (-884.615) (-887.841) (-883.547) -- 0:00:11
853000 -- (-884.191) (-885.948) [-886.321] (-886.128) * (-885.192) [-884.424] (-883.927) (-885.983) -- 0:00:11
853500 -- (-887.357) (-885.617) (-888.769) [-886.173] * (-884.145) (-885.029) (-885.924) [-885.867] -- 0:00:10
854000 -- [-886.859] (-882.982) (-884.608) (-887.381) * [-884.432] (-885.184) (-883.890) (-886.416) -- 0:00:10
854500 -- (-886.557) (-884.186) [-888.731] (-884.160) * (-885.041) (-883.004) [-888.565] (-885.786) -- 0:00:10
855000 -- [-884.914] (-885.989) (-885.583) (-885.332) * (-886.595) [-882.768] (-887.576) (-885.534) -- 0:00:10
Average standard deviation of split frequencies: 0.006168
855500 -- (-885.483) (-888.717) [-883.460] (-883.868) * (-886.692) (-890.206) (-886.492) [-883.103] -- 0:00:10
856000 -- (-885.127) (-888.060) (-885.400) [-883.187] * (-884.010) (-885.268) (-885.651) [-883.635] -- 0:00:10
856500 -- (-888.253) (-886.081) (-884.326) [-884.475] * (-884.569) (-889.670) [-884.069] (-886.821) -- 0:00:10
857000 -- (-884.559) (-883.606) (-886.607) [-884.343] * [-884.512] (-885.748) (-883.648) (-885.998) -- 0:00:10
857500 -- [-885.218] (-886.413) (-885.671) (-882.912) * [-884.441] (-886.200) (-884.396) (-884.496) -- 0:00:10
858000 -- (-885.418) [-885.924] (-884.224) (-886.012) * (-884.919) (-883.719) [-885.769] (-885.386) -- 0:00:10
858500 -- (-885.616) (-889.571) (-883.312) [-883.215] * (-885.524) [-884.345] (-884.639) (-884.715) -- 0:00:10
859000 -- [-885.772] (-884.995) (-884.805) (-887.198) * [-885.211] (-883.766) (-886.330) (-883.627) -- 0:00:10
859500 -- [-884.052] (-884.005) (-890.742) (-883.341) * (-884.269) (-887.091) (-884.084) [-883.676] -- 0:00:10
860000 -- (-885.877) (-883.175) [-888.659] (-888.419) * (-885.600) (-887.067) [-883.890] (-886.234) -- 0:00:10
Average standard deviation of split frequencies: 0.005915
860500 -- (-885.217) [-884.663] (-883.992) (-884.027) * (-885.948) (-887.569) (-883.888) [-884.463] -- 0:00:10
861000 -- (-884.513) (-889.304) [-883.557] (-885.235) * [-883.122] (-886.294) (-885.830) (-886.583) -- 0:00:10
861500 -- [-885.888] (-884.729) (-883.712) (-884.991) * (-884.294) (-892.411) [-884.297] (-890.188) -- 0:00:10
862000 -- [-884.885] (-883.741) (-884.720) (-884.630) * [-884.726] (-888.653) (-883.395) (-888.015) -- 0:00:10
862500 -- (-883.715) (-887.177) (-886.217) [-889.392] * [-886.036] (-889.514) (-885.015) (-886.414) -- 0:00:10
863000 -- (-883.749) [-885.448] (-884.458) (-886.918) * [-886.004] (-883.785) (-885.356) (-887.815) -- 0:00:10
863500 -- (-883.654) [-883.879] (-884.010) (-885.510) * [-885.596] (-884.058) (-886.412) (-885.531) -- 0:00:10
864000 -- [-884.376] (-886.103) (-885.833) (-885.984) * (-885.965) (-886.073) (-886.170) [-886.693] -- 0:00:10
864500 -- [-883.369] (-885.001) (-884.370) (-886.912) * (-883.960) (-884.815) [-884.858] (-887.093) -- 0:00:10
865000 -- (-884.443) (-886.769) [-883.728] (-883.639) * [-887.934] (-883.460) (-884.818) (-884.734) -- 0:00:10
Average standard deviation of split frequencies: 0.006206
865500 -- [-884.430] (-889.793) (-884.100) (-888.479) * [-885.335] (-883.780) (-886.811) (-884.015) -- 0:00:10
866000 -- (-884.886) (-884.284) (-884.635) [-883.190] * (-885.280) (-888.079) [-885.481] (-884.870) -- 0:00:10
866500 -- [-884.842] (-883.413) (-885.835) (-885.947) * (-884.976) (-887.463) (-885.960) [-884.991] -- 0:00:10
867000 -- [-883.190] (-885.410) (-894.239) (-891.363) * (-885.509) (-883.962) [-883.940] (-884.726) -- 0:00:09
867500 -- (-883.558) (-884.710) (-885.460) [-883.333] * [-885.134] (-885.367) (-883.311) (-884.032) -- 0:00:09
868000 -- (-885.293) (-884.157) (-883.904) [-886.378] * (-884.299) (-884.322) [-886.546] (-888.927) -- 0:00:09
868500 -- (-884.445) (-884.946) (-884.027) [-884.075] * [-883.014] (-884.742) (-884.999) (-885.270) -- 0:00:09
869000 -- (-883.907) [-883.539] (-883.816) (-885.218) * (-885.576) (-886.608) [-884.085] (-886.468) -- 0:00:09
869500 -- (-885.722) (-884.296) [-884.014] (-888.434) * (-883.961) (-886.333) [-884.482] (-887.117) -- 0:00:09
870000 -- (-887.258) [-883.434] (-886.588) (-884.608) * [-889.713] (-887.809) (-884.342) (-888.196) -- 0:00:09
Average standard deviation of split frequencies: 0.006172
870500 -- (-883.281) (-885.639) [-886.897] (-887.062) * (-883.485) (-886.247) [-884.989] (-889.766) -- 0:00:09
871000 -- (-885.609) (-889.747) [-886.414] (-885.104) * (-883.566) [-887.087] (-886.548) (-886.394) -- 0:00:09
871500 -- (-884.279) (-884.817) [-884.226] (-885.727) * (-883.298) (-887.314) (-888.052) [-885.528] -- 0:00:09
872000 -- (-884.455) (-883.294) (-884.226) [-889.169] * [-884.071] (-886.739) (-889.353) (-884.752) -- 0:00:09
872500 -- (-886.972) (-889.592) (-883.388) [-887.405] * [-882.769] (-888.179) (-884.629) (-883.612) -- 0:00:09
873000 -- (-885.207) (-886.700) [-887.306] (-889.562) * [-883.775] (-885.272) (-893.396) (-883.846) -- 0:00:09
873500 -- (-884.159) (-884.967) (-884.506) [-889.410] * (-884.384) (-889.761) [-885.140] (-887.209) -- 0:00:09
874000 -- (-884.969) (-886.588) [-885.858] (-892.614) * [-883.285] (-885.649) (-887.043) (-888.977) -- 0:00:09
874500 -- (-883.721) [-885.004] (-884.730) (-886.262) * [-888.852] (-884.334) (-883.562) (-888.054) -- 0:00:09
875000 -- [-883.612] (-885.435) (-883.773) (-884.836) * (-891.516) (-884.248) (-883.429) [-887.204] -- 0:00:09
Average standard deviation of split frequencies: 0.006135
875500 -- (-885.595) (-884.113) [-889.898] (-884.394) * (-884.936) (-893.056) [-883.379] (-885.697) -- 0:00:09
876000 -- (-884.189) (-883.712) (-884.461) [-886.740] * (-884.496) (-885.377) (-883.264) [-883.630] -- 0:00:09
876500 -- (-886.166) [-884.811] (-886.435) (-885.074) * (-884.424) (-885.756) (-883.542) [-885.762] -- 0:00:09
877000 -- [-884.907] (-885.262) (-887.358) (-885.022) * (-885.367) [-883.989] (-884.705) (-886.211) -- 0:00:09
877500 -- [-886.866] (-886.794) (-884.070) (-885.212) * (-885.195) (-887.623) (-884.583) [-890.891] -- 0:00:09
878000 -- [-884.377] (-885.548) (-885.714) (-885.096) * (-884.831) [-884.716] (-884.243) (-888.826) -- 0:00:09
878500 -- (-883.418) (-883.732) (-885.116) [-885.025] * (-883.646) (-886.199) (-883.041) [-885.141] -- 0:00:09
879000 -- (-883.135) (-883.976) [-883.968] (-882.943) * (-883.219) (-886.665) (-883.280) [-883.488] -- 0:00:09
879500 -- (-886.899) (-883.610) [-883.553] (-884.971) * [-884.255] (-888.381) (-888.558) (-884.139) -- 0:00:09
880000 -- (-891.319) (-883.785) (-884.399) [-886.857] * (-886.516) (-887.644) [-884.687] (-890.581) -- 0:00:09
Average standard deviation of split frequencies: 0.005995
880500 -- (-888.480) (-884.238) [-884.106] (-883.550) * (-885.581) [-887.265] (-883.601) (-885.442) -- 0:00:08
881000 -- (-886.884) (-885.032) [-886.402] (-883.446) * [-884.692] (-886.698) (-883.213) (-887.190) -- 0:00:08
881500 -- (-888.030) (-886.214) (-884.698) [-884.074] * (-883.765) [-885.205] (-887.600) (-885.434) -- 0:00:08
882000 -- (-889.835) (-888.657) [-885.189] (-884.036) * (-884.038) (-884.530) [-883.078] (-884.830) -- 0:00:08
882500 -- (-887.405) (-885.011) (-884.443) [-885.016] * [-883.931] (-883.740) (-883.057) (-886.001) -- 0:00:08
883000 -- (-889.319) (-886.306) (-883.561) [-885.132] * (-884.185) (-887.396) (-883.322) [-885.266] -- 0:00:08
883500 -- (-885.672) [-884.586] (-886.755) (-882.880) * (-885.481) (-885.682) (-885.536) [-883.639] -- 0:00:08
884000 -- (-883.294) (-885.872) [-884.028] (-882.808) * [-884.849] (-884.434) (-884.375) (-890.645) -- 0:00:08
884500 -- (-883.534) [-886.251] (-882.754) (-884.052) * [-883.520] (-883.245) (-885.280) (-887.249) -- 0:00:08
885000 -- (-890.857) (-885.812) (-888.326) [-885.236] * [-883.003] (-883.760) (-884.757) (-886.555) -- 0:00:08
Average standard deviation of split frequencies: 0.005817
885500 -- (-884.140) (-884.887) (-884.069) [-885.777] * (-887.534) (-885.928) [-884.872] (-887.932) -- 0:00:08
886000 -- [-885.191] (-884.416) (-888.295) (-885.384) * [-883.210] (-883.600) (-885.709) (-887.476) -- 0:00:08
886500 -- (-887.339) (-886.504) [-889.778] (-888.473) * [-884.771] (-884.707) (-886.846) (-887.700) -- 0:00:08
887000 -- [-886.882] (-885.456) (-886.608) (-885.732) * [-883.455] (-885.605) (-887.585) (-885.799) -- 0:00:08
887500 -- (-885.500) (-886.006) (-884.280) [-885.800] * (-884.392) [-886.022] (-886.938) (-889.887) -- 0:00:08
888000 -- (-884.190) (-890.128) (-886.173) [-883.855] * [-886.346] (-886.703) (-884.334) (-889.723) -- 0:00:08
888500 -- (-885.930) [-887.112] (-885.393) (-888.205) * (-884.494) [-883.794] (-885.261) (-885.273) -- 0:00:08
889000 -- (-884.697) (-887.463) (-885.456) [-884.136] * (-887.302) (-886.232) (-885.931) [-882.951] -- 0:00:08
889500 -- (-889.874) [-884.600] (-888.642) (-883.452) * (-885.260) (-884.962) (-888.800) [-882.851] -- 0:00:08
890000 -- (-887.483) [-884.679] (-884.629) (-883.595) * (-883.263) (-885.695) [-884.833] (-884.531) -- 0:00:08
Average standard deviation of split frequencies: 0.005716
890500 -- [-885.090] (-884.166) (-887.414) (-888.130) * (-885.210) (-887.227) [-883.243] (-884.025) -- 0:00:08
891000 -- [-883.836] (-885.920) (-883.493) (-883.948) * (-883.839) [-884.497] (-884.407) (-884.184) -- 0:00:08
891500 -- (-886.249) (-886.751) (-884.113) [-884.179] * [-883.773] (-883.742) (-884.038) (-884.145) -- 0:00:08
892000 -- (-886.500) [-887.292] (-883.374) (-884.590) * [-883.569] (-884.951) (-884.057) (-889.843) -- 0:00:08
892500 -- (-886.628) (-884.667) [-883.340] (-884.356) * (-884.578) (-889.747) (-884.022) [-883.999] -- 0:00:08
893000 -- (-887.119) (-884.563) [-886.035] (-883.479) * (-888.086) [-886.781] (-888.107) (-889.406) -- 0:00:08
893500 -- (-885.447) [-885.671] (-884.877) (-883.833) * [-886.790] (-886.381) (-884.307) (-885.578) -- 0:00:07
894000 -- (-884.455) [-884.510] (-884.894) (-885.015) * (-886.176) (-884.713) (-884.273) [-885.787] -- 0:00:07
894500 -- [-884.105] (-884.558) (-883.493) (-890.388) * [-885.356] (-884.605) (-883.738) (-887.500) -- 0:00:07
895000 -- (-884.294) (-887.073) [-884.164] (-887.813) * (-882.740) (-884.809) [-886.388] (-883.179) -- 0:00:07
Average standard deviation of split frequencies: 0.005577
895500 -- (-886.447) (-890.473) [-886.645] (-884.864) * (-882.771) [-884.151] (-886.270) (-884.629) -- 0:00:07
896000 -- (-887.769) [-885.623] (-884.696) (-885.948) * [-885.532] (-888.537) (-886.428) (-885.759) -- 0:00:07
896500 -- (-890.225) (-885.370) [-885.930] (-885.744) * [-885.843] (-883.988) (-891.685) (-888.180) -- 0:00:07
897000 -- (-884.545) (-884.630) (-887.987) [-884.637] * (-883.922) (-886.480) [-890.677] (-885.173) -- 0:00:07
897500 -- (-884.570) (-882.907) [-885.251] (-887.346) * [-886.523] (-884.023) (-887.848) (-888.377) -- 0:00:07
898000 -- (-886.749) (-885.030) (-883.790) [-886.426] * (-883.683) (-883.795) (-884.316) [-886.984] -- 0:00:07
898500 -- (-887.314) [-883.765] (-887.248) (-885.104) * (-882.754) [-883.605] (-889.465) (-884.214) -- 0:00:07
899000 -- (-889.064) [-885.349] (-884.618) (-886.326) * (-885.237) (-883.029) (-883.443) [-884.831] -- 0:00:07
899500 -- (-888.549) [-884.115] (-889.428) (-882.794) * (-883.888) (-883.867) (-886.280) [-885.129] -- 0:00:07
900000 -- (-889.826) [-883.301] (-887.578) (-883.545) * [-883.601] (-884.239) (-886.738) (-887.837) -- 0:00:07
Average standard deviation of split frequencies: 0.005478
900500 -- (-887.399) [-887.539] (-885.343) (-884.320) * (-884.456) (-885.769) (-886.008) [-884.868] -- 0:00:07
901000 -- (-883.584) (-884.702) [-883.576] (-884.551) * (-883.726) (-886.222) [-889.265] (-883.823) -- 0:00:07
901500 -- (-883.948) (-886.188) [-886.508] (-885.978) * (-888.982) (-885.977) (-884.978) [-884.528] -- 0:00:07
902000 -- (-883.551) (-886.763) (-887.697) [-885.260] * (-887.338) (-885.267) [-882.890] (-885.441) -- 0:00:07
902500 -- (-884.250) (-886.936) (-885.019) [-885.805] * (-894.340) [-884.123] (-884.263) (-887.449) -- 0:00:07
903000 -- (-883.579) (-885.696) [-886.297] (-888.573) * (-889.125) (-883.872) [-886.435] (-887.042) -- 0:00:07
903500 -- [-884.603] (-884.767) (-885.331) (-887.136) * [-887.813] (-884.734) (-884.193) (-887.168) -- 0:00:07
904000 -- [-884.486] (-884.818) (-885.981) (-886.358) * (-884.346) (-891.200) (-886.475) [-883.386] -- 0:00:07
904500 -- (-883.655) (-883.315) [-883.843] (-883.454) * (-885.401) [-887.061] (-890.300) (-887.000) -- 0:00:07
905000 -- (-884.349) (-885.913) [-884.839] (-883.989) * [-885.488] (-886.330) (-887.909) (-883.352) -- 0:00:07
Average standard deviation of split frequencies: 0.005398
905500 -- (-883.549) [-889.937] (-886.337) (-883.402) * (-883.642) (-888.107) [-883.634] (-885.965) -- 0:00:07
906000 -- (-886.069) (-888.583) [-885.255] (-883.260) * (-884.775) [-888.399] (-885.441) (-884.711) -- 0:00:07
906500 -- (-887.496) (-885.891) (-889.609) [-883.317] * (-886.665) (-885.276) [-886.860] (-887.846) -- 0:00:07
907000 -- [-886.691] (-886.978) (-892.119) (-883.412) * [-886.391] (-888.036) (-883.563) (-885.370) -- 0:00:06
907500 -- (-885.119) (-889.195) [-884.188] (-884.086) * [-888.671] (-886.056) (-884.647) (-884.246) -- 0:00:06
908000 -- (-885.096) [-889.933] (-884.587) (-884.659) * (-888.181) [-884.132] (-885.625) (-889.002) -- 0:00:06
908500 -- (-883.949) (-883.944) [-883.392] (-883.961) * [-889.257] (-883.668) (-884.684) (-888.379) -- 0:00:06
909000 -- (-885.788) (-884.217) [-883.504] (-888.423) * (-887.094) [-884.175] (-886.479) (-888.028) -- 0:00:06
909500 -- (-888.123) [-885.558] (-888.097) (-884.700) * (-883.415) [-885.026] (-885.471) (-883.592) -- 0:00:06
910000 -- (-887.379) (-885.802) [-883.699] (-885.497) * (-884.942) [-886.002] (-884.643) (-884.214) -- 0:00:06
Average standard deviation of split frequencies: 0.005349
910500 -- [-885.916] (-884.397) (-883.781) (-887.178) * [-887.151] (-884.483) (-887.128) (-883.976) -- 0:00:06
911000 -- [-883.485] (-885.558) (-888.801) (-884.158) * (-886.163) [-884.800] (-888.243) (-885.948) -- 0:00:06
911500 -- (-883.680) [-882.904] (-883.409) (-884.652) * [-884.169] (-883.911) (-887.130) (-886.999) -- 0:00:06
912000 -- [-885.942] (-883.732) (-885.059) (-885.099) * [-885.540] (-885.833) (-885.401) (-882.809) -- 0:00:06
912500 -- [-883.239] (-885.879) (-885.506) (-885.205) * [-884.619] (-885.567) (-886.177) (-885.513) -- 0:00:06
913000 -- (-885.213) (-885.814) [-883.204] (-884.646) * [-884.626] (-884.613) (-884.559) (-883.214) -- 0:00:06
913500 -- [-886.257] (-888.237) (-882.982) (-883.339) * (-886.261) (-884.630) (-887.609) [-886.371] -- 0:00:06
914000 -- (-885.641) (-883.415) [-884.503] (-884.111) * (-885.052) [-883.815] (-886.410) (-883.703) -- 0:00:06
914500 -- (-886.455) (-885.091) (-886.283) [-887.338] * (-883.897) (-885.456) (-885.471) [-884.500] -- 0:00:06
915000 -- [-884.393] (-885.855) (-883.553) (-884.812) * [-883.971] (-890.338) (-885.827) (-883.084) -- 0:00:06
Average standard deviation of split frequencies: 0.005524
915500 -- [-884.995] (-887.561) (-884.992) (-883.051) * (-884.631) [-884.028] (-884.367) (-887.398) -- 0:00:06
916000 -- [-884.174] (-886.012) (-887.761) (-885.451) * (-884.764) [-883.586] (-886.209) (-888.428) -- 0:00:06
916500 -- (-887.159) (-884.926) [-884.344] (-883.281) * (-884.195) [-883.678] (-884.197) (-884.916) -- 0:00:06
917000 -- (-889.362) [-884.672] (-884.089) (-883.318) * [-886.219] (-883.986) (-884.591) (-886.817) -- 0:00:06
917500 -- (-886.158) [-884.436] (-885.103) (-883.220) * (-885.720) (-884.796) [-886.664] (-890.592) -- 0:00:06
918000 -- [-882.735] (-883.822) (-884.565) (-884.782) * (-887.224) (-884.055) [-884.085] (-884.159) -- 0:00:06
918500 -- (-884.210) (-886.275) [-884.372] (-885.407) * (-886.092) (-885.521) [-885.035] (-885.699) -- 0:00:06
919000 -- (-884.103) [-888.779] (-884.766) (-887.413) * (-885.466) (-884.190) (-883.654) [-885.841] -- 0:00:06
919500 -- (-889.308) (-885.513) [-883.646] (-883.205) * (-887.612) (-886.255) (-883.212) [-883.145] -- 0:00:06
920000 -- (-883.531) (-883.822) [-885.175] (-884.891) * (-886.022) (-882.660) [-883.553] (-883.209) -- 0:00:05
Average standard deviation of split frequencies: 0.005803
920500 -- (-884.353) [-886.223] (-885.905) (-889.113) * (-885.127) (-885.770) [-886.263] (-883.673) -- 0:00:05
921000 -- (-885.122) (-885.137) (-885.405) [-890.702] * (-894.010) (-889.709) (-885.895) [-883.088] -- 0:00:05
921500 -- (-885.737) (-884.643) [-884.788] (-885.104) * (-889.674) [-883.334] (-884.422) (-886.734) -- 0:00:05
922000 -- (-886.877) (-885.468) (-885.874) [-883.697] * [-889.519] (-884.049) (-887.962) (-883.436) -- 0:00:05
922500 -- (-884.923) [-885.280] (-887.172) (-888.001) * [-883.934] (-884.504) (-887.561) (-883.928) -- 0:00:05
923000 -- (-885.164) (-883.195) [-883.353] (-888.842) * (-885.010) [-883.231] (-884.641) (-882.831) -- 0:00:05
923500 -- (-887.650) (-885.215) [-883.346] (-887.438) * (-883.794) (-884.300) (-884.076) [-883.047] -- 0:00:05
924000 -- (-885.962) [-889.277] (-883.966) (-884.694) * [-884.699] (-883.806) (-882.726) (-887.438) -- 0:00:05
924500 -- (-883.428) (-884.030) (-884.934) [-884.435] * (-884.336) [-885.727] (-885.929) (-883.801) -- 0:00:05
925000 -- (-884.101) [-884.603] (-883.453) (-885.251) * [-883.488] (-884.342) (-889.789) (-886.789) -- 0:00:05
Average standard deviation of split frequencies: 0.005918
925500 -- (-882.688) (-885.309) [-884.456] (-883.757) * (-883.529) (-883.810) (-886.625) [-884.419] -- 0:00:05
926000 -- (-882.687) (-889.915) (-886.357) [-884.608] * (-883.740) (-884.170) (-885.285) [-885.559] -- 0:00:05
926500 -- [-882.877] (-883.835) (-884.477) (-886.032) * (-883.783) (-885.338) (-887.156) [-889.423] -- 0:00:05
927000 -- (-884.661) (-886.682) [-885.839] (-886.537) * (-884.316) [-885.377] (-883.377) (-884.295) -- 0:00:05
927500 -- (-887.745) (-892.188) (-886.522) [-882.992] * [-886.143] (-885.228) (-887.830) (-884.090) -- 0:00:05
928000 -- [-884.245] (-886.340) (-886.924) (-884.960) * [-885.185] (-884.848) (-885.453) (-884.164) -- 0:00:05
928500 -- [-884.948] (-884.900) (-883.889) (-885.616) * (-887.062) (-887.185) [-884.587] (-884.238) -- 0:00:05
929000 -- [-885.036] (-883.815) (-884.520) (-883.708) * (-884.691) (-883.178) (-885.359) [-882.875] -- 0:00:05
929500 -- [-883.636] (-885.615) (-884.122) (-885.792) * (-889.612) [-884.159] (-885.915) (-887.189) -- 0:00:05
930000 -- (-884.076) [-886.817] (-883.055) (-885.307) * (-890.638) (-885.454) (-887.356) [-884.242] -- 0:00:05
Average standard deviation of split frequencies: 0.005572
930500 -- (-884.742) (-885.769) [-883.291] (-882.846) * (-885.526) [-885.371] (-884.994) (-885.908) -- 0:00:05
931000 -- (-884.226) [-883.136] (-883.183) (-884.078) * (-887.337) (-888.317) (-883.573) [-884.925] -- 0:00:05
931500 -- [-883.932] (-884.491) (-883.034) (-887.606) * (-886.131) [-884.043] (-884.201) (-883.406) -- 0:00:05
932000 -- (-883.915) (-885.196) (-885.931) [-883.086] * [-884.760] (-885.393) (-884.516) (-883.563) -- 0:00:05
932500 -- (-883.784) (-885.208) (-886.673) [-887.680] * [-884.874] (-886.619) (-884.992) (-883.337) -- 0:00:05
933000 -- [-884.690] (-882.964) (-885.814) (-886.528) * (-885.836) (-885.232) (-885.390) [-884.143] -- 0:00:05
933500 -- (-884.334) (-882.962) [-884.103] (-882.964) * [-887.629] (-886.952) (-882.977) (-884.541) -- 0:00:04
934000 -- (-884.586) (-884.756) [-887.651] (-884.254) * (-890.670) (-884.436) [-884.093] (-887.554) -- 0:00:04
934500 -- [-885.030] (-883.795) (-884.663) (-883.799) * [-885.045] (-886.991) (-884.647) (-884.639) -- 0:00:04
935000 -- [-887.241] (-885.310) (-882.975) (-886.595) * (-885.095) (-883.857) [-883.880] (-883.206) -- 0:00:04
Average standard deviation of split frequencies: 0.005271
935500 -- (-884.569) (-884.159) [-883.545] (-883.097) * [-884.915] (-884.728) (-890.355) (-883.750) -- 0:00:04
936000 -- [-884.366] (-883.721) (-886.206) (-882.700) * (-884.172) (-888.498) [-885.926] (-884.425) -- 0:00:04
936500 -- (-889.236) (-883.454) (-885.591) [-883.489] * [-884.406] (-886.674) (-885.921) (-886.523) -- 0:00:04
937000 -- (-886.978) [-885.551] (-885.953) (-883.785) * (-885.106) (-886.740) [-885.189] (-886.128) -- 0:00:04
937500 -- [-884.374] (-883.239) (-883.492) (-885.920) * [-884.207] (-884.803) (-885.457) (-886.701) -- 0:00:04
938000 -- (-885.149) (-883.281) [-883.469] (-884.975) * (-883.818) (-884.746) (-887.025) [-885.664] -- 0:00:04
938500 -- (-886.540) [-883.541] (-882.842) (-888.863) * (-883.640) [-886.778] (-887.900) (-887.807) -- 0:00:04
939000 -- [-885.293] (-883.494) (-883.379) (-889.300) * (-885.633) [-883.996] (-885.387) (-884.917) -- 0:00:04
939500 -- (-887.220) (-883.729) (-883.117) [-887.625] * (-883.950) (-886.367) [-886.729] (-884.341) -- 0:00:04
940000 -- (-884.176) (-888.482) [-884.259] (-890.996) * (-883.830) (-884.600) [-883.492] (-885.389) -- 0:00:04
Average standard deviation of split frequencies: 0.005045
940500 -- [-885.676] (-884.880) (-884.397) (-889.396) * (-886.673) [-887.222] (-883.054) (-882.880) -- 0:00:04
941000 -- (-887.383) [-883.589] (-886.683) (-888.226) * (-883.857) (-884.156) (-884.600) [-885.207] -- 0:00:04
941500 -- (-885.079) (-883.792) (-883.542) [-883.294] * (-884.872) (-883.358) (-885.724) [-884.908] -- 0:00:04
942000 -- (-885.459) [-884.797] (-885.987) (-888.167) * [-887.209] (-882.870) (-885.422) (-886.321) -- 0:00:04
942500 -- [-883.069] (-884.214) (-888.288) (-883.972) * (-888.223) (-887.355) (-885.487) [-884.040] -- 0:00:04
943000 -- (-887.570) (-885.145) (-884.636) [-883.352] * (-884.696) (-888.761) (-888.449) [-886.535] -- 0:00:04
943500 -- (-884.997) (-884.414) [-884.267] (-886.891) * (-885.172) (-886.191) (-888.190) [-885.836] -- 0:00:04
944000 -- (-885.813) (-884.107) (-884.697) [-884.149] * (-887.953) (-885.116) (-885.826) [-883.827] -- 0:00:04
944500 -- (-888.489) (-883.097) (-883.390) [-884.193] * (-884.515) [-883.869] (-888.230) (-883.475) -- 0:00:04
945000 -- (-886.824) (-883.107) [-886.488] (-884.290) * (-888.235) (-884.495) [-884.636] (-884.352) -- 0:00:04
Average standard deviation of split frequencies: 0.004796
945500 -- (-884.965) (-883.847) [-888.855] (-886.272) * (-883.600) [-883.813] (-885.701) (-883.005) -- 0:00:04
946000 -- (-884.121) [-883.095] (-886.113) (-885.720) * (-883.678) (-886.163) [-885.980] (-887.386) -- 0:00:04
946500 -- (-884.702) (-883.072) [-884.646] (-884.754) * [-883.070] (-883.377) (-885.262) (-887.132) -- 0:00:04
947000 -- [-886.323] (-883.243) (-893.691) (-885.008) * (-884.312) (-884.437) (-888.465) [-885.222] -- 0:00:03
947500 -- (-888.133) (-882.950) (-888.026) [-887.713] * [-889.749] (-885.000) (-886.807) (-889.347) -- 0:00:03
948000 -- (-884.913) [-884.576] (-887.272) (-887.567) * (-885.901) (-885.149) (-886.120) [-883.432] -- 0:00:03
948500 -- (-884.803) (-885.123) [-884.468] (-887.237) * (-888.208) (-883.180) [-883.764] (-885.366) -- 0:00:03
949000 -- (-883.793) [-885.882] (-885.762) (-887.396) * (-885.597) (-886.812) [-885.146] (-887.114) -- 0:00:03
949500 -- [-885.007] (-883.240) (-887.945) (-885.849) * (-885.174) [-884.061] (-884.691) (-885.954) -- 0:00:03
950000 -- (-885.598) [-888.487] (-884.022) (-885.849) * [-883.112] (-886.403) (-886.913) (-883.742) -- 0:00:03
Average standard deviation of split frequencies: 0.004793
950500 -- (-886.760) (-886.908) [-886.040] (-884.235) * (-882.639) [-883.845] (-886.830) (-884.274) -- 0:00:03
951000 -- (-884.331) (-885.393) [-884.942] (-887.453) * (-882.618) (-886.173) (-882.910) [-884.551] -- 0:00:03
951500 -- (-888.229) [-886.349] (-884.741) (-889.157) * [-885.992] (-885.642) (-884.489) (-885.200) -- 0:00:03
952000 -- (-888.921) (-884.445) [-883.742] (-883.635) * [-885.265] (-884.341) (-885.585) (-885.314) -- 0:00:03
952500 -- (-883.703) [-886.349] (-885.044) (-887.333) * (-886.511) [-883.049] (-885.083) (-883.729) -- 0:00:03
953000 -- (-884.731) (-888.276) (-885.182) [-887.569] * [-883.823] (-885.116) (-885.623) (-884.850) -- 0:00:03
953500 -- [-885.696] (-886.303) (-885.821) (-882.732) * [-885.303] (-885.739) (-886.096) (-890.727) -- 0:00:03
954000 -- (-884.146) (-884.377) [-884.511] (-886.814) * (-884.841) (-887.346) [-883.639] (-887.511) -- 0:00:03
954500 -- (-885.239) [-884.846] (-883.684) (-888.473) * [-885.169] (-884.400) (-891.371) (-883.293) -- 0:00:03
955000 -- [-885.159] (-885.178) (-885.623) (-888.493) * [-884.769] (-885.494) (-886.968) (-887.107) -- 0:00:03
Average standard deviation of split frequencies: 0.004372
955500 -- (-889.500) (-887.805) (-883.543) [-885.762] * [-885.041] (-883.852) (-887.544) (-885.402) -- 0:00:03
956000 -- [-884.525] (-885.059) (-885.292) (-885.722) * (-884.597) (-887.195) (-885.858) [-887.265] -- 0:00:03
956500 -- (-883.272) [-887.871] (-886.570) (-885.328) * (-884.130) (-886.540) (-883.929) [-884.412] -- 0:00:03
957000 -- [-885.906] (-887.886) (-884.856) (-885.100) * (-890.401) [-887.059] (-884.478) (-884.936) -- 0:00:03
957500 -- [-885.029] (-885.125) (-885.853) (-884.093) * (-884.000) (-885.115) [-883.857] (-883.706) -- 0:00:03
958000 -- (-886.329) (-885.393) (-889.162) [-883.229] * (-883.740) (-890.217) (-884.208) [-886.459] -- 0:00:03
958500 -- (-887.098) [-886.727] (-887.782) (-884.922) * (-883.150) (-885.804) (-884.550) [-884.514] -- 0:00:03
959000 -- (-886.768) (-886.430) [-883.797] (-884.278) * (-884.954) [-883.436] (-884.467) (-885.718) -- 0:00:03
959500 -- (-887.109) (-884.495) (-885.057) [-887.152] * (-885.982) [-883.706] (-885.109) (-884.404) -- 0:00:03
960000 -- [-885.627] (-882.856) (-883.604) (-886.613) * (-884.745) (-884.774) (-884.843) [-884.664] -- 0:00:02
Average standard deviation of split frequencies: 0.004351
960500 -- (-882.868) (-883.432) [-884.001] (-889.165) * (-887.446) (-887.745) [-883.527] (-883.702) -- 0:00:02
961000 -- (-884.684) [-884.413] (-884.657) (-885.844) * [-884.475] (-886.647) (-887.214) (-884.153) -- 0:00:02
961500 -- [-886.861] (-883.767) (-886.724) (-887.401) * (-884.364) (-886.783) (-883.774) [-884.398] -- 0:00:02
962000 -- (-883.313) [-884.125] (-889.856) (-888.038) * (-888.619) (-885.609) [-887.019] (-883.604) -- 0:00:02
962500 -- (-886.415) [-883.866] (-884.751) (-884.948) * [-883.585] (-885.917) (-886.677) (-884.049) -- 0:00:02
963000 -- (-883.533) (-884.571) (-884.146) [-886.949] * (-884.837) [-886.012] (-886.547) (-884.489) -- 0:00:02
963500 -- (-884.029) [-886.016] (-884.772) (-884.929) * (-886.132) [-886.182] (-885.490) (-885.849) -- 0:00:02
964000 -- (-885.156) (-886.929) [-885.930] (-886.121) * (-886.670) (-886.297) (-885.437) [-883.633] -- 0:00:02
964500 -- (-883.053) (-887.708) [-887.593] (-886.474) * (-886.679) (-883.940) (-888.087) [-886.539] -- 0:00:02
965000 -- (-889.065) (-887.392) [-883.558] (-884.246) * (-886.954) [-885.075] (-885.945) (-883.931) -- 0:00:02
Average standard deviation of split frequencies: 0.004425
965500 -- [-883.323] (-889.700) (-884.618) (-884.336) * (-884.887) [-885.726] (-886.572) (-883.871) -- 0:00:02
966000 -- (-886.120) (-886.173) [-884.256] (-885.038) * [-886.373] (-889.029) (-883.725) (-884.118) -- 0:00:02
966500 -- (-885.417) (-883.113) (-884.375) [-885.670] * (-885.987) (-884.012) (-883.552) [-884.267] -- 0:00:02
967000 -- [-883.945] (-887.781) (-885.046) (-890.373) * (-884.013) (-884.117) (-884.663) [-884.935] -- 0:00:02
967500 -- [-887.300] (-885.779) (-884.106) (-887.186) * (-885.572) [-884.849] (-886.319) (-883.909) -- 0:00:02
968000 -- [-885.024] (-886.143) (-886.725) (-886.645) * (-884.778) (-884.332) [-885.381] (-884.708) -- 0:00:02
968500 -- (-890.193) (-884.606) (-883.427) [-887.729] * (-883.210) (-883.364) (-886.263) [-884.867] -- 0:00:02
969000 -- (-885.973) (-884.940) [-890.888] (-888.524) * [-883.230] (-883.008) (-884.858) (-888.715) -- 0:00:02
969500 -- (-883.548) (-885.189) [-885.421] (-885.861) * [-884.968] (-884.152) (-887.417) (-886.327) -- 0:00:02
970000 -- [-887.658] (-887.046) (-890.416) (-884.472) * (-887.745) (-884.216) (-888.259) [-882.815] -- 0:00:02
Average standard deviation of split frequencies: 0.004241
970500 -- (-885.180) (-883.332) [-885.265] (-883.455) * (-884.992) (-884.079) [-884.148] (-883.023) -- 0:00:02
971000 -- (-885.835) [-882.727] (-888.963) (-884.186) * (-886.960) [-883.088] (-883.901) (-883.686) -- 0:00:02
971500 -- [-883.154] (-885.285) (-890.237) (-884.317) * [-883.665] (-891.145) (-887.920) (-887.674) -- 0:00:02
972000 -- [-882.906] (-884.795) (-888.653) (-884.953) * (-882.954) (-890.930) [-883.365] (-886.998) -- 0:00:02
972500 -- (-884.709) [-884.041] (-888.373) (-885.765) * [-883.610] (-886.959) (-883.584) (-885.896) -- 0:00:02
973000 -- [-884.708] (-885.838) (-885.401) (-884.624) * [-884.507] (-886.109) (-885.732) (-884.031) -- 0:00:02
973500 -- [-886.276] (-887.065) (-885.915) (-884.508) * (-883.772) (-886.399) (-883.784) [-887.890] -- 0:00:01
974000 -- (-884.932) [-883.823] (-888.772) (-885.193) * (-886.064) (-884.500) (-884.430) [-887.660] -- 0:00:01
974500 -- (-886.098) [-883.333] (-885.930) (-884.900) * [-883.794] (-884.874) (-887.218) (-886.366) -- 0:00:01
975000 -- (-886.272) (-886.456) (-886.215) [-887.763] * (-883.561) [-883.454] (-883.749) (-888.455) -- 0:00:01
Average standard deviation of split frequencies: 0.004379
975500 -- [-884.698] (-884.971) (-884.573) (-883.661) * (-884.996) [-883.553] (-884.236) (-887.609) -- 0:00:01
976000 -- (-884.533) (-887.981) [-886.610] (-888.641) * (-885.589) (-883.657) [-884.019] (-887.445) -- 0:00:01
976500 -- (-884.600) [-883.593] (-883.894) (-890.945) * (-885.359) [-883.184] (-883.727) (-884.648) -- 0:00:01
977000 -- [-885.006] (-885.580) (-886.133) (-883.106) * [-883.998] (-883.601) (-885.007) (-885.913) -- 0:00:01
977500 -- (-885.835) (-888.469) [-886.425] (-883.783) * (-882.993) (-885.244) (-883.364) [-883.442] -- 0:00:01
978000 -- (-888.266) (-884.144) (-885.325) [-885.517] * (-884.186) (-884.838) [-884.075] (-884.197) -- 0:00:01
978500 -- [-885.291] (-884.447) (-886.336) (-883.189) * (-885.016) (-886.108) [-883.081] (-883.178) -- 0:00:01
979000 -- (-884.075) [-887.498] (-885.667) (-888.214) * (-888.273) [-883.779] (-887.308) (-886.637) -- 0:00:01
979500 -- [-885.095] (-883.813) (-885.070) (-884.942) * (-886.030) (-883.333) [-883.243] (-888.397) -- 0:00:01
980000 -- [-885.150] (-887.069) (-884.972) (-886.195) * [-886.398] (-885.807) (-885.464) (-884.455) -- 0:00:01
Average standard deviation of split frequencies: 0.004198
980500 -- [-884.716] (-885.961) (-884.361) (-885.027) * (-884.901) (-886.297) (-884.653) [-884.608] -- 0:00:01
981000 -- [-885.854] (-887.904) (-883.858) (-886.235) * (-884.042) (-883.425) (-885.131) [-885.478] -- 0:00:01
981500 -- (-883.689) (-885.247) [-884.234] (-886.986) * [-887.554] (-883.954) (-883.578) (-886.306) -- 0:00:01
982000 -- (-885.596) (-884.159) [-886.242] (-886.763) * [-883.765] (-885.711) (-883.823) (-884.031) -- 0:00:01
982500 -- [-886.000] (-886.326) (-885.430) (-885.065) * (-884.384) (-884.018) [-885.303] (-884.236) -- 0:00:01
983000 -- (-885.613) (-883.036) (-883.904) [-887.020] * [-883.067] (-887.991) (-884.726) (-884.373) -- 0:00:01
983500 -- (-890.048) (-886.721) (-884.889) [-885.679] * (-887.320) [-887.739] (-885.568) (-888.119) -- 0:00:01
984000 -- (-885.609) [-884.421] (-886.645) (-885.343) * (-885.251) [-887.321] (-884.141) (-887.314) -- 0:00:01
984500 -- (-885.632) (-884.287) (-885.692) [-884.074] * (-883.106) (-890.298) [-887.226] (-883.554) -- 0:00:01
985000 -- (-884.447) (-885.513) (-885.476) [-882.953] * (-884.386) (-886.038) (-885.668) [-884.165] -- 0:00:01
Average standard deviation of split frequencies: 0.004016
985500 -- (-883.627) [-885.877] (-883.474) (-884.089) * [-884.262] (-883.716) (-886.658) (-883.923) -- 0:00:01
986000 -- (-883.192) (-884.339) (-885.853) [-885.990] * (-886.218) (-885.253) (-888.499) [-884.940] -- 0:00:01
986500 -- (-883.824) (-887.711) (-885.647) [-883.229] * (-884.454) (-883.900) [-884.753] (-885.160) -- 0:00:01
987000 -- (-883.921) (-888.343) (-884.324) [-883.314] * (-887.528) (-883.593) (-885.580) [-885.023] -- 0:00:00
987500 -- (-886.469) [-885.687] (-885.636) (-885.328) * (-887.879) [-883.046] (-884.223) (-883.578) -- 0:00:00
988000 -- (-887.844) (-887.287) (-888.956) [-885.775] * (-883.690) [-883.254] (-883.899) (-884.463) -- 0:00:00
988500 -- (-884.455) [-884.663] (-885.908) (-885.524) * [-883.747] (-884.281) (-883.596) (-883.618) -- 0:00:00
989000 -- (-884.658) (-886.642) (-887.003) [-886.418] * (-883.251) [-883.974] (-884.351) (-885.269) -- 0:00:00
989500 -- (-886.409) [-883.300] (-886.717) (-884.086) * (-887.181) (-884.906) (-886.383) [-884.750] -- 0:00:00
990000 -- (-886.397) [-883.780] (-883.199) (-887.058) * (-885.417) (-883.746) (-884.765) [-884.599] -- 0:00:00
Average standard deviation of split frequencies: 0.003934
990500 -- (-889.449) [-884.067] (-883.556) (-884.292) * (-885.872) (-883.374) [-886.660] (-888.266) -- 0:00:00
991000 -- [-885.237] (-886.419) (-884.206) (-884.459) * [-884.035] (-883.664) (-884.653) (-884.197) -- 0:00:00
991500 -- [-883.765] (-886.362) (-884.448) (-885.334) * (-884.188) [-883.399] (-887.583) (-885.153) -- 0:00:00
992000 -- (-883.111) [-882.837] (-884.423) (-885.349) * [-884.474] (-883.765) (-885.994) (-885.287) -- 0:00:00
992500 -- (-887.399) (-884.012) (-884.232) [-885.076] * (-885.280) (-887.120) [-884.454] (-884.006) -- 0:00:00
993000 -- (-884.709) [-884.289] (-885.128) (-885.878) * (-886.524) [-886.509] (-883.582) (-884.738) -- 0:00:00
993500 -- (-884.053) (-885.899) [-885.068] (-885.602) * (-883.667) (-887.746) [-883.814] (-887.303) -- 0:00:00
994000 -- (-885.027) (-884.863) [-883.435] (-888.095) * [-884.574] (-884.599) (-884.804) (-887.025) -- 0:00:00
994500 -- (-883.932) (-886.899) (-884.524) [-884.594] * (-884.272) (-883.044) (-886.083) [-887.305] -- 0:00:00
995000 -- (-885.495) [-885.155] (-887.036) (-885.021) * [-883.599] (-883.006) (-886.653) (-886.264) -- 0:00:00
Average standard deviation of split frequencies: 0.003913
995500 -- (-886.014) (-884.017) (-883.574) [-883.507] * (-885.444) [-882.987] (-884.770) (-884.840) -- 0:00:00
996000 -- (-884.922) (-886.277) [-884.715] (-885.293) * (-884.063) (-883.358) (-884.255) [-886.498] -- 0:00:00
996500 -- (-884.426) (-888.243) [-883.786] (-884.449) * (-884.539) (-889.732) [-883.495] (-884.557) -- 0:00:00
997000 -- (-887.051) (-885.526) [-885.175] (-883.887) * (-884.927) (-885.744) (-883.480) [-884.354] -- 0:00:00
997500 -- (-882.862) [-884.709] (-887.405) (-886.119) * (-885.032) [-884.167] (-884.320) (-887.351) -- 0:00:00
998000 -- (-883.629) (-891.686) (-884.564) [-887.013] * (-885.228) (-889.480) (-883.157) [-883.809] -- 0:00:00
998500 -- (-884.399) (-886.615) (-884.566) [-885.296] * (-888.921) [-883.355] (-884.048) (-884.036) -- 0:00:00
999000 -- [-884.092] (-885.089) (-885.566) (-885.273) * (-888.694) [-886.888] (-883.546) (-885.660) -- 0:00:00
999500 -- (-883.173) (-887.181) (-883.954) [-882.818] * (-883.524) (-885.288) [-883.299] (-884.628) -- 0:00:00
1000000 -- (-887.088) (-887.151) [-885.115] (-882.783) * (-885.383) (-891.955) [-884.990] (-887.895) -- 0:00:00
Average standard deviation of split frequencies: 0.004208
Analysis completed in 1 mins 15 seconds
Analysis used 74.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -882.57
Likelihood of best state for "cold" chain of run 2 was -882.58
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.5 % ( 32 %) Dirichlet(Pi{all})
30.4 % ( 33 %) Slider(Pi{all})
78.6 % ( 49 %) Multiplier(Alpha{1,2})
78.1 % ( 59 %) Multiplier(Alpha{3})
21.6 % ( 29 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 21 %) Dirichlet(Pi{all})
30.1 % ( 25 %) Slider(Pi{all})
79.3 % ( 52 %) Multiplier(Alpha{1,2})
77.8 % ( 57 %) Multiplier(Alpha{3})
20.9 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.3 % ( 22 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166431 0.82 0.67
3 | 166848 166960 0.83
4 | 165653 167363 166745
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166839 0.82 0.67
3 | 166752 166994 0.84
4 | 166327 166685 166403
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -884.23
| 1 |
| 1 2 2 |
|1 2 2 2 2 2|
| 1 2 2 1 1 2 1|
| 2 * 1 2 2 2 1 2 2 1 2 2 |
| 1 * 12 2 22 12 1 21 2 2 |
| *22 2 1 21 |
| *1 21 221 2 11 1 2 21 1 1 |
|2 1 2 11* 1 1 1 2 |
| 2 1 2 122*1 1 1 2 1 1 11 2 11 |
| 2 1 1 2 2 2 2 |
| 1 |
| 1 1 1 1 1 1 |
| 2 2 |
| 1 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -885.85
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -884.27 -890.01
2 -884.22 -887.07
--------------------------------------
TOTAL -884.25 -889.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893195 0.088705 0.367561 1.502073 0.862723 1256.80 1328.45 1.000
r(A<->C){all} 0.170917 0.019601 0.000329 0.447180 0.140154 194.59 236.57 1.000
r(A<->G){all} 0.162792 0.019633 0.000011 0.442165 0.126340 188.57 202.70 1.000
r(A<->T){all} 0.159126 0.018644 0.000056 0.441958 0.122819 226.32 232.60 1.000
r(C<->G){all} 0.159992 0.020049 0.000017 0.438220 0.122750 210.56 305.07 1.014
r(C<->T){all} 0.160912 0.020176 0.000043 0.447143 0.120222 77.86 203.67 1.001
r(G<->T){all} 0.186260 0.022142 0.000055 0.484796 0.147147 127.60 157.60 1.009
pi(A){all} 0.206536 0.000241 0.174930 0.235309 0.206014 1252.26 1332.29 1.000
pi(C){all} 0.280887 0.000304 0.249621 0.317037 0.280492 1303.93 1338.50 1.000
pi(G){all} 0.343722 0.000336 0.308221 0.379382 0.344022 1209.83 1243.75 1.000
pi(T){all} 0.168854 0.000212 0.140854 0.197086 0.168426 1297.62 1308.69 1.000
alpha{1,2} 0.423902 0.235997 0.000206 1.398856 0.253879 1367.36 1373.23 1.000
alpha{3} 0.447536 0.224541 0.000119 1.368161 0.293008 1187.33 1246.66 1.000
pinvar{all} 0.997628 0.000008 0.992391 1.000000 0.998501 1244.17 1372.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .**...
9 -- ....**
10 -- ..*.*.
11 -- .*.*..
12 -- ...**.
13 -- ..**..
14 -- ..****
15 -- .*..*.
16 -- ..*..*
17 -- .**.**
18 -- .*.***
19 -- .****.
20 -- .***.*
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.003298 0.152565 0.157229 2
8 447 0.148901 0.004240 0.145903 0.151899 2
9 442 0.147235 0.004711 0.143904 0.150566 2
10 435 0.144903 0.006124 0.140573 0.149234 2
11 434 0.144570 0.000942 0.143904 0.145237 2
12 433 0.144237 0.003298 0.141905 0.146569 2
13 428 0.142572 0.000942 0.141905 0.143238 2
14 426 0.141905 0.003769 0.139241 0.144570 2
15 423 0.140906 0.000471 0.140573 0.141239 2
16 422 0.140573 0.005653 0.136576 0.144570 2
17 421 0.140240 0.002355 0.138574 0.141905 2
18 420 0.139907 0.001884 0.138574 0.141239 2
19 420 0.139907 0.014133 0.129913 0.149900 2
20 411 0.136909 0.007066 0.131912 0.141905 2
21 383 0.127582 0.004240 0.124584 0.130580 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100296 0.009671 0.000040 0.298982 0.069534 1.000 2
length{all}[2] 0.098384 0.009895 0.000037 0.290288 0.069087 1.001 2
length{all}[3] 0.096327 0.009220 0.000018 0.292075 0.066940 1.000 2
length{all}[4] 0.102757 0.010217 0.000020 0.295995 0.072059 1.000 2
length{all}[5] 0.100615 0.009858 0.000105 0.309086 0.070951 1.000 2
length{all}[6] 0.098659 0.009434 0.000082 0.286753 0.068926 1.000 2
length{all}[7] 0.097048 0.009519 0.000095 0.306795 0.067017 0.998 2
length{all}[8] 0.098614 0.009886 0.000168 0.295012 0.066017 1.004 2
length{all}[9] 0.105138 0.011456 0.000100 0.326339 0.071486 1.001 2
length{all}[10] 0.098889 0.009985 0.000040 0.273756 0.068703 0.998 2
length{all}[11] 0.101911 0.009886 0.000008 0.283943 0.071173 0.998 2
length{all}[12] 0.103036 0.010851 0.000226 0.315680 0.068859 1.000 2
length{all}[13] 0.105742 0.009796 0.001382 0.318802 0.071285 1.004 2
length{all}[14] 0.114266 0.014664 0.000136 0.334282 0.073460 0.998 2
length{all}[15] 0.099259 0.009258 0.000020 0.291122 0.071774 0.999 2
length{all}[16] 0.096138 0.009075 0.000214 0.298544 0.064874 0.998 2
length{all}[17] 0.091642 0.009132 0.000228 0.288589 0.063369 0.998 2
length{all}[18] 0.098625 0.010393 0.000290 0.282471 0.066667 1.002 2
length{all}[19] 0.092432 0.009994 0.000295 0.274423 0.064504 1.003 2
length{all}[20] 0.096579 0.010854 0.000068 0.279343 0.064767 1.001 2
length{all}[21] 0.095337 0.008342 0.000116 0.281971 0.069680 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004208
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 657
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
2 sites are removed. 1 219
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 217 / 217 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 217 / 217 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027936 0.025669 0.047323 0.054305 0.010968 0.093880 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -897.581866
Iterating by ming2
Initial: fx= 897.581866
x= 0.02794 0.02567 0.04732 0.05430 0.01097 0.09388 0.30000 1.30000
1 h-m-p 0.0000 0.0001 521.2443 ++ 883.651742 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0074 62.4232 ----------.. | 1/8
3 h-m-p 0.0000 0.0001 476.2161 ++ 868.014905 m 0.0001 43 | 2/8
4 h-m-p 0.0006 0.0099 49.6821 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 426.6153 ++ 866.081087 m 0.0000 74 | 3/8
6 h-m-p 0.0001 0.0130 39.1231 ---------.. | 3/8
7 h-m-p 0.0000 0.0001 368.9779 ++ 853.646392 m 0.0001 103 | 4/8
8 h-m-p 0.0009 0.0179 29.1732 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 301.8472 ++ 850.648835 m 0.0000 134 | 5/8
10 h-m-p 0.0004 0.0294 18.8799 ----------.. | 5/8
11 h-m-p 0.0000 0.0002 212.9294 +++ 842.105984 m 0.0002 165 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 842.105984 m 8.0000 176 | 6/8
13 h-m-p 0.1176 8.0000 0.0005 -------C 842.105984 0 0.0000 196
Out..
lnL = -842.105984
197 lfun, 197 eigenQcodon, 1182 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109199 0.062397 0.017282 0.045579 0.037363 0.042630 0.300005 0.886370 0.375754
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.716920
np = 9
lnL0 = -909.019808
Iterating by ming2
Initial: fx= 909.019808
x= 0.10920 0.06240 0.01728 0.04558 0.03736 0.04263 0.30000 0.88637 0.37575
1 h-m-p 0.0000 0.0001 513.4158 ++ 887.346041 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 441.7093 ++ 865.855743 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 6231.5924 ++ 861.400552 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 307.9032 ++ 859.230119 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 1667.5833 ++ 851.455045 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 2605.2938 ++ 842.106045 m 0.0001 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 842.106045 m 8.0000 86 | 6/9
8 h-m-p 0.0128 6.4185 0.1433 +++++ 842.105997 m 6.4185 104 | 7/9
9 h-m-p 1.6000 8.0000 0.0025 ++ 842.105997 m 8.0000 119 | 7/9
10 h-m-p 0.0035 0.0574 5.7462 --------C 842.105997 0 0.0000 141 | 7/9
11 h-m-p 0.2096 8.0000 0.0000 --------C 842.105997 0 0.0000 161 | 7/9
12 h-m-p 0.2658 8.0000 0.0000 -----Y 842.105997 0 0.0001 180
Out..
lnL = -842.105997
181 lfun, 543 eigenQcodon, 2172 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.019868 0.075786 0.083880 0.021792 0.067881 0.083503 0.314196 1.345390 0.361165 0.420663 1.457030
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.131033
np = 11
lnL0 = -915.368218
Iterating by ming2
Initial: fx= 915.368218
x= 0.01987 0.07579 0.08388 0.02179 0.06788 0.08350 0.31420 1.34539 0.36116 0.42066 1.45703
1 h-m-p 0.0000 0.0001 491.7837 ++ 891.358804 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 216.3164 ++ 889.280717 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0004 361.7826 ++ 851.727544 m 0.0004 44 | 3/11
4 h-m-p 0.0002 0.0010 85.4318 ++ 845.489803 m 0.0010 58 | 4/11
5 h-m-p 0.0002 0.0010 236.6764 ++ 843.079609 m 0.0010 72 | 4/11
6 h-m-p 0.0051 0.0257 39.4204 ------------.. | 4/11
7 h-m-p 0.0000 0.0000 305.5353 ++ 842.187821 m 0.0000 110 | 5/11
8 h-m-p 0.0008 0.3873 3.4250 -----------.. | 5/11
9 h-m-p 0.0000 0.0000 216.8908 ++ 842.106044 m 0.0000 147 | 6/11
10 h-m-p 0.0160 8.0000 0.0000 --------C 842.106044 0 0.0000 169 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 842.106044 m 8.0000 191 | 6/11
12 h-m-p 0.0090 4.4790 0.1507 +++Y 842.106044 0 0.9607 213 | 6/11
13 h-m-p 1.6000 8.0000 0.0039 Y 842.106044 0 0.8950 232 | 6/11
14 h-m-p 1.6000 8.0000 0.0000 ++ 842.106044 m 8.0000 251 | 6/11
15 h-m-p 0.0160 8.0000 0.1290 +++C 842.106044 0 1.0211 273 | 6/11
16 h-m-p 0.8663 4.3313 0.0287 --------C 842.106044 0 0.0000 300 | 6/11
17 h-m-p 0.0160 8.0000 0.0723 +++C 842.106044 0 1.6234 322 | 6/11
18 h-m-p 1.6000 8.0000 0.0014 ------C 842.106044 0 0.0001 347 | 6/11
19 h-m-p 0.0160 8.0000 0.0081 +++++ 842.106044 m 8.0000 369 | 6/11
20 h-m-p 1.6000 8.0000 0.0057 Y 842.106044 0 3.5418 388 | 6/11
21 h-m-p 1.6000 8.0000 0.0008 ++ 842.106044 m 8.0000 407 | 6/11
22 h-m-p 0.0357 1.0350 0.1884 --------N 842.106044 0 0.0000 434 | 6/11
23 h-m-p 0.0160 8.0000 0.1116 ++++Y 842.106043 0 2.9548 457 | 6/11
24 h-m-p 1.6000 8.0000 0.0055 C 842.106043 0 0.4160 476 | 6/11
25 h-m-p 1.6000 8.0000 0.0002 ------C 842.106043 0 0.0001 501
Out..
lnL = -842.106043
502 lfun, 2008 eigenQcodon, 9036 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -842.120358 S = -842.103129 -0.006603
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:04
did 30 / 52 patterns 0:04
did 40 / 52 patterns 0:04
did 50 / 52 patterns 0:04
did 52 / 52 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056236 0.101795 0.102232 0.047867 0.012150 0.024726 0.244520 0.223379 1.789135
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 25.163717
np = 9
lnL0 = -914.445626
Iterating by ming2
Initial: fx= 914.445626
x= 0.05624 0.10180 0.10223 0.04787 0.01215 0.02473 0.24452 0.22338 1.78913
1 h-m-p 0.0000 0.0001 492.8511 ++ 900.006525 m 0.0001 14 | 1/9
2 h-m-p 0.0002 0.0011 107.7366 ++ 889.033745 m 0.0011 26 | 2/9
3 h-m-p 0.0001 0.0004 222.2790 ++ 865.736882 m 0.0004 38 | 3/9
4 h-m-p 0.0001 0.0006 27.9304 ++ 865.545821 m 0.0006 50 | 4/9
5 h-m-p 0.0006 0.0110 20.9786 -----------.. | 4/9
6 h-m-p 0.0000 0.0003 295.9704 +++ 842.223221 m 0.0003 84 | 5/9
7 h-m-p 0.0053 0.0362 10.1753 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 219.8042 ++ 842.106114 m 0.0000 118 | 6/9
9 h-m-p 0.0218 8.0000 0.0000 N 842.106114 0 0.0054 130 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 N 842.106114 0 0.0160 145
Out..
lnL = -842.106114
146 lfun, 1606 eigenQcodon, 8760 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085287 0.079750 0.101542 0.035906 0.088555 0.031774 0.191600 0.900000 0.999773 1.512376 1.300099
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.639106
np = 11
lnL0 = -928.203026
Iterating by ming2
Initial: fx= 928.203026
x= 0.08529 0.07975 0.10154 0.03591 0.08856 0.03177 0.19160 0.90000 0.99977 1.51238 1.30010
1 h-m-p 0.0000 0.0002 470.7703 +++ 890.997151 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0002 176.5148 ++ 886.572864 m 0.0002 31 | 2/11
3 h-m-p 0.0001 0.0005 248.8052 ++ 849.741606 m 0.0005 45 | 3/11
4 h-m-p 0.0003 0.0014 66.8917 ++ 846.073717 m 0.0014 59 | 4/11
5 h-m-p 0.0000 0.0000 2876.1634 ++ 844.642977 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 14424.1876 ++ 842.106009 m 0.0000 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0003 ++ 842.106009 m 8.0000 101 | 6/11
8 h-m-p 0.0018 0.5368 1.4940 +++++ 842.105975 m 0.5368 123 | 7/11
9 h-m-p 0.0991 0.4953 1.3440 ++ 842.105959 m 0.4953 137 | 7/11
10 h-m-p 0.0000 0.0000 1.0501
h-m-p: 1.66325012e-18 8.31625062e-18 1.05011257e+00 842.105959
.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 842.105959 m 8.0000 165 | 7/11
12 h-m-p 0.0000 0.0000 0.0228
h-m-p: 2.46537289e-12 1.23268645e-11 2.27958386e-02 842.105959
.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 842.105959 m 8.0000 201 | 7/11
14 h-m-p 0.0005 0.2583 0.5223 +++++ 842.105955 m 0.2583 222
QuantileBeta(0.15, 0.00496, 1.97128) = 6.760496e-162 2000 rounds
| 8/11
15 h-m-p 0.1501 8.0000 0.2706 +++ 842.105944 m 8.0000 241 | 8/11
16 h-m-p 1.6000 8.0000 1.1288 ++ 842.105935 m 8.0000 258 | 8/11
17 h-m-p 1.6000 8.0000 1.7951 ++ 842.105932 m 8.0000 272 | 8/11
18 h-m-p 1.6000 8.0000 1.3873 ++ 842.105931 m 8.0000 286 | 8/11
19 h-m-p 0.3780 8.0000 29.3635 +++ 842.105929 m 8.0000 301 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 Y 842.105929 0 1.6000 315 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 C 842.105929 0 0.0040 332
Out..
lnL = -842.105929
333 lfun, 3996 eigenQcodon, 21978 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -842.100902 S = -842.100842 -0.000026
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:12
did 20 / 52 patterns 0:12
did 30 / 52 patterns 0:12
did 40 / 52 patterns 0:13
did 50 / 52 patterns 0:13
did 52 / 52 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
NC_002677_1_NP_302265_1_1137_rplC VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA
*************************************************
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
NC_002677_1_NP_302265_1_1137_rplC VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ
**************************************************
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
NC_002677_1_NP_302265_1_1137_rplC ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG
**************************************************
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
NC_002677_1_NP_302265_1_1137_rplC SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP
**************************************************
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 GRTGGLVMVRSAIKRGEKo
NC_002677_1_NP_302265_1_1137_rplC GRTGGLVMVRSAIKRGEK-
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 GRTGGLVMVRSAIKRGEKo
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 GRTGGLVMVRSAIKRGEKo
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 GRTGGLVMVRSAIKRGEKo
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 GRTGGLVMVRSAIKRGEKo
******************
>NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA--- >NC_002677_1_NP_302265_1_1137_rplC GTGATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA--- >NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA--- >NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA--- >NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA--- >NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 ---ATGGCGCGAAAGGGCATTCTTGGTACCAAGCTGGGCATGACGCAGGT ATTCGACGAAAACAACAGAGTGGTACCGGTGACTGTGGTCAAGGCCGGCC CGAACGTGGTGACTCGCATCCGCACACTGGAGCGCGATGGCTATAGTGCT GTACAGCTGGCCTACGGCGAAATCAGCCCGCGGAAGGTCAACAAGCCGGT GACAGGCCAGTACAACTCTGCGGGGGTGAACCCGCGTCGTTACTTGGCTG AACTACGTCTGGACCACCCGGACGCGGCGGCTGAGTACGAGGTCGGCCAA GAACTGACGGCGGAGATCTTCGCCGATGCCACGTACGTCGACGTGACCGG GACCTCCAAGGGCAAGGGCTTCTCCGGCACTATGAAGCGGCACGGCTTCC GTGGGCAGGGCGCCAGTCACGGTGCCCAGGCAGTACACCGCCGTCCGGGT TCGATCGGCGGTTGCGCTACTCCTGCCCGAGTATTTAAGGGCACCCGGAT GGCTGGCCGCATGGGTAACGACAGGGTGACGGTCCAGAACTTGTTGGTGC ACAAGGTTGATACCGAGAACGGCGTGCTGCTGATCAAGGGTGCCGTCCCC GGCCGCACGGGTGGGCTCGTCATGGTCCGCAGCGCGATCAAACGAGGTGA GAAA---
>NC_011896_1_WP_041323030_1_1990_MLBR_RS09445 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK >NC_002677_1_NP_302265_1_1137_rplC VMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK >NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK >NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK >NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK >NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515 -MARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTLERDGYSA VQLAYGEISPRKVNKPVTGQYNSAGVNPRRYLAELRLDHPDAAAEYEVGQ ELTAEIFADATYVDVTGTSKGKGFSGTMKRHGFRGQGASHGAQAVHRRPG SIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVP GRTGGLVMVRSAIKRGEK
#NEXUS
[ID: 0062468981]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_041323030_1_1990_MLBR_RS09445
NC_002677_1_NP_302265_1_1137_rplC
NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570
NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190
NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245
NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515
;
end;
begin trees;
translate
1 NC_011896_1_WP_041323030_1_1990_MLBR_RS09445,
2 NC_002677_1_NP_302265_1_1137_rplC,
3 NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570,
4 NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190,
5 NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245,
6 NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06953405,2:0.06908741,3:0.06694047,4:0.07205928,5:0.07095053,6:0.06892592);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06953405,2:0.06908741,3:0.06694047,4:0.07205928,5:0.07095053,6:0.06892592);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -884.27 -890.01
2 -884.22 -887.07
--------------------------------------
TOTAL -884.25 -889.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893195 0.088705 0.367561 1.502073 0.862723 1256.80 1328.45 1.000
r(A<->C){all} 0.170917 0.019601 0.000329 0.447180 0.140154 194.59 236.57 1.000
r(A<->G){all} 0.162792 0.019633 0.000011 0.442165 0.126340 188.57 202.70 1.000
r(A<->T){all} 0.159126 0.018644 0.000056 0.441958 0.122819 226.32 232.60 1.000
r(C<->G){all} 0.159992 0.020049 0.000017 0.438220 0.122750 210.56 305.07 1.014
r(C<->T){all} 0.160912 0.020176 0.000043 0.447143 0.120222 77.86 203.67 1.001
r(G<->T){all} 0.186260 0.022142 0.000055 0.484796 0.147147 127.60 157.60 1.009
pi(A){all} 0.206536 0.000241 0.174930 0.235309 0.206014 1252.26 1332.29 1.000
pi(C){all} 0.280887 0.000304 0.249621 0.317037 0.280492 1303.93 1338.50 1.000
pi(G){all} 0.343722 0.000336 0.308221 0.379382 0.344022 1209.83 1243.75 1.000
pi(T){all} 0.168854 0.000212 0.140854 0.197086 0.168426 1297.62 1308.69 1.000
alpha{1,2} 0.423902 0.235997 0.000206 1.398856 0.253879 1367.36 1373.23 1.000
alpha{3} 0.447536 0.224541 0.000119 1.368161 0.293008 1187.33 1246.66 1.000
pinvar{all} 0.997628 0.000008 0.992391 1.000000 0.998501 1244.17 1372.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 217
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 2 2 2 2 2 2 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 5 5 5 5 5 5
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 5 5 5 5 5 5 | CGC 7 7 7 7 7 7
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 7 7 7 7 7 7 | CCG 7 7 7 7 7 7 | CAG 6 6 6 6 6 6 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 4 4 4 4 4 4 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 6 6 6 6 6 6 | ACC 5 5 5 5 5 5 | AAC 9 9 9 9 9 9 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 6 6 6 6 6 6 | ACG 5 5 5 5 5 5 | AAG 11 11 11 11 11 11 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 5 5 5 | Asp GAT 3 3 3 3 3 3 | Gly GGT 8 8 8 8 8 8
GTC 8 8 8 8 8 8 | GCC 8 8 8 8 8 8 | GAC 5 5 5 5 5 5 | GGC 17 17 17 17 17 17
GTA 5 5 5 5 5 5 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 11 11 11 11 11 11 | GCG 6 6 6 6 6 6 | GAG 6 6 6 6 6 6 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_041323030_1_1990_MLBR_RS09445
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
#2: NC_002677_1_NP_302265_1_1137_rplC
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
#3: NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
#4: NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
#5: NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
#6: NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 12 | TAC 30 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 30
CTC 6 | CCC 6 | CAC 30 | CGC 42
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 18
CTG 42 | CCG 42 | CAG 36 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 24 | Asn N AAT 0 | Ser S AGT 12
ATC 36 | ACC 30 | AAC 54 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 36 | ACG 30 | AAG 66 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 30 | Asp D GAT 18 | Gly G GGT 48
GTC 48 | GCC 48 | GAC 30 | GGC 102
GTA 30 | GCA 6 | Glu E GAA 24 | GGA 0
GTG 66 | GCG 36 | GAG 36 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08756 C:0.22581 A:0.26267 G:0.42396
position 2: T:0.25806 C:0.22581 A:0.26728 G:0.24885
position 3: T:0.15668 C:0.39631 A:0.09217 G:0.35484
Average T:0.16743 C:0.28264 A:0.20737 G:0.34255
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -842.105984 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300005 1.300099
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323030_1_1990_MLBR_RS09445: 0.000004, NC_002677_1_NP_302265_1_1137_rplC: 0.000004, NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570: 0.000004, NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190: 0.000004, NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245: 0.000004, NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30000
omega (dN/dS) = 1.30010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 516.5 134.5 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -842.105997 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.314196 0.327834 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323030_1_1990_MLBR_RS09445: 0.000004, NC_002677_1_NP_302265_1_1137_rplC: 0.000004, NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570: 0.000004, NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190: 0.000004, NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245: 0.000004, NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.31420
MLEs of dN/dS (w) for site classes (K=2)
p: 0.32783 0.67217
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 516.3 134.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -842.106043 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.244520 0.678884 0.171934 0.062270 1.665357
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323030_1_1990_MLBR_RS09445: 0.000004, NC_002677_1_NP_302265_1_1137_rplC: 0.000004, NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570: 0.000004, NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190: 0.000004, NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245: 0.000004, NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24452
MLEs of dN/dS (w) for site classes (K=3)
p: 0.67888 0.17193 0.14918
w: 0.06227 1.00000 1.66536
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
7..2 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
7..3 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
7..4 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
7..5 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
7..6 0.000 517.1 133.9 0.4626 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323030_1_1990_MLBR_RS09445)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323030_1_1990_MLBR_RS09445)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -842.106114 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.191600 0.395053 1.721763
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323030_1_1990_MLBR_RS09445: 0.000004, NC_002677_1_NP_302265_1_1137_rplC: 0.000004, NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570: 0.000004, NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190: 0.000004, NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245: 0.000004, NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.19160
Parameters in M7 (beta):
p = 0.39505 q = 1.72176
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00026 0.00422 0.01546 0.03663 0.07046 0.12026 0.19081 0.29001 0.43408 0.67444
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
7..2 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
7..3 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
7..4 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
7..5 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
7..6 0.000 517.8 133.2 0.1837 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -842.105929 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.116275 1.959508 274.369466
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323030_1_1990_MLBR_RS09445: 0.000004, NC_002677_1_NP_302265_1_1137_rplC: 0.000004, NZ_LVXE01000034_1_WP_041323030_1_1545_A3216_RS09570: 0.000004, NZ_LYPH01000037_1_WP_041323030_1_1501_A8144_RS07190: 0.000004, NZ_CP029543_1_WP_041323030_1_2013_DIJ64_RS10245: 0.000004, NZ_AP014567_1_WP_041323030_1_2067_JK2ML_RS10515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.11628 q = 1.95951
(p1 = 0.99999) w = 274.36947
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00005 0.00041 0.00233 0.00988 0.03457 0.10810 0.34782 274.36947
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
7..2 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
7..3 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
7..4 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
7..5 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
7..6 0.000 520.4 130.6 274.3667 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323030_1_1990_MLBR_RS09445)
Pr(w>1) post mean +- SE for w
1 M 1.000** 274.367
2 A 1.000** 274.367
3 R 1.000** 274.367
4 K 1.000** 274.367
5 G 1.000** 274.367
6 I 1.000** 274.367
7 L 1.000** 274.367
8 G 1.000** 274.367
9 T 1.000** 274.367
10 K 1.000** 274.367
11 L 1.000** 274.367
12 G 1.000** 274.367
13 M 1.000** 274.367
14 T 1.000** 274.367
15 Q 1.000** 274.367
16 V 1.000** 274.367
17 F 1.000** 274.367
18 D 1.000** 274.367
19 E 1.000** 274.367
20 N 1.000** 274.367
21 N 1.000** 274.367
22 R 1.000** 274.367
23 V 1.000** 274.367
24 V 1.000** 274.367
25 P 1.000** 274.367
26 V 1.000** 274.367
27 T 1.000** 274.367
28 V 1.000** 274.367
29 V 1.000** 274.367
30 K 1.000** 274.367
31 A 1.000** 274.367
32 G 1.000** 274.367
33 P 1.000** 274.367
34 N 1.000** 274.367
35 V 1.000** 274.367
36 V 1.000** 274.367
37 T 1.000** 274.367
38 R 1.000** 274.367
39 I 1.000** 274.367
40 R 1.000** 274.367
41 T 1.000** 274.367
42 L 1.000** 274.367
43 E 1.000** 274.367
44 R 1.000** 274.367
45 D 1.000** 274.367
46 G 1.000** 274.367
47 Y 1.000** 274.367
48 S 1.000** 274.367
49 A 1.000** 274.367
50 V 1.000** 274.367
51 Q 1.000** 274.367
52 L 1.000** 274.367
53 A 1.000** 274.367
54 Y 1.000** 274.367
55 G 1.000** 274.367
56 E 1.000** 274.367
57 I 1.000** 274.367
58 S 1.000** 274.367
59 P 1.000** 274.367
60 R 1.000** 274.367
61 K 1.000** 274.367
62 V 1.000** 274.367
63 N 1.000** 274.367
64 K 1.000** 274.367
65 P 1.000** 274.367
66 V 1.000** 274.367
67 T 1.000** 274.367
68 G 1.000** 274.367
69 Q 1.000** 274.367
70 Y 1.000** 274.367
71 N 1.000** 274.367
72 S 1.000** 274.367
73 A 1.000** 274.367
74 G 1.000** 274.367
75 V 1.000** 274.367
76 N 1.000** 274.367
77 P 1.000** 274.367
78 R 1.000** 274.367
79 R 1.000** 274.367
80 Y 1.000** 274.367
81 L 1.000** 274.367
82 A 1.000** 274.367
83 E 1.000** 274.367
84 L 1.000** 274.367
85 R 1.000** 274.367
86 L 1.000** 274.367
87 D 1.000** 274.367
88 H 1.000** 274.367
89 P 1.000** 274.367
90 D 1.000** 274.367
91 A 1.000** 274.367
92 A 1.000** 274.367
93 A 1.000** 274.367
94 E 1.000** 274.367
95 Y 1.000** 274.367
96 E 1.000** 274.367
97 V 1.000** 274.367
98 G 1.000** 274.367
99 Q 1.000** 274.367
100 E 1.000** 274.367
101 L 1.000** 274.367
102 T 1.000** 274.367
103 A 1.000** 274.367
104 E 1.000** 274.367
105 I 1.000** 274.367
106 F 1.000** 274.367
107 A 1.000** 274.367
108 D 1.000** 274.367
109 A 1.000** 274.367
110 T 1.000** 274.367
111 Y 1.000** 274.367
112 V 1.000** 274.367
113 D 1.000** 274.367
114 V 1.000** 274.367
115 T 1.000** 274.367
116 G 1.000** 274.367
117 T 1.000** 274.367
118 S 1.000** 274.367
119 K 1.000** 274.367
120 G 1.000** 274.367
121 K 1.000** 274.367
122 G 1.000** 274.367
123 F 1.000** 274.367
124 S 1.000** 274.367
125 G 1.000** 274.367
126 T 1.000** 274.367
127 M 1.000** 274.367
128 K 1.000** 274.367
129 R 1.000** 274.367
130 H 1.000** 274.367
131 G 1.000** 274.367
132 F 1.000** 274.367
133 R 1.000** 274.367
134 G 1.000** 274.367
135 Q 1.000** 274.367
136 G 1.000** 274.367
137 A 1.000** 274.367
138 S 1.000** 274.367
139 H 1.000** 274.367
140 G 1.000** 274.367
141 A 1.000** 274.367
142 Q 1.000** 274.367
143 A 1.000** 274.367
144 V 1.000** 274.367
145 H 1.000** 274.367
146 R 1.000** 274.367
147 R 1.000** 274.367
148 P 1.000** 274.367
149 G 1.000** 274.367
150 S 1.000** 274.367
151 I 1.000** 274.367
152 G 1.000** 274.367
153 G 1.000** 274.367
154 C 1.000** 274.367
155 A 1.000** 274.367
156 T 1.000** 274.367
157 P 1.000** 274.367
158 A 1.000** 274.367
159 R 1.000** 274.367
160 V 1.000** 274.367
161 F 1.000** 274.367
162 K 1.000** 274.367
163 G 1.000** 274.367
164 T 1.000** 274.367
165 R 1.000** 274.367
166 M 1.000** 274.367
167 A 1.000** 274.367
168 G 1.000** 274.367
169 R 1.000** 274.367
170 M 1.000** 274.367
171 G 1.000** 274.367
172 N 1.000** 274.367
173 D 1.000** 274.367
174 R 1.000** 274.367
175 V 1.000** 274.367
176 T 1.000** 274.367
177 V 1.000** 274.367
178 Q 1.000** 274.367
179 N 1.000** 274.367
180 L 1.000** 274.367
181 L 1.000** 274.367
182 V 1.000** 274.367
183 H 1.000** 274.367
184 K 1.000** 274.367
185 V 1.000** 274.367
186 D 1.000** 274.367
187 T 1.000** 274.367
188 E 1.000** 274.367
189 N 1.000** 274.367
190 G 1.000** 274.367
191 V 1.000** 274.367
192 L 1.000** 274.367
193 L 1.000** 274.367
194 I 1.000** 274.367
195 K 1.000** 274.367
196 G 1.000** 274.367
197 A 1.000** 274.367
198 V 1.000** 274.367
199 P 1.000** 274.367
200 G 1.000** 274.367
201 R 1.000** 274.367
202 T 1.000** 274.367
203 G 1.000** 274.367
204 G 1.000** 274.367
205 L 1.000** 274.367
206 V 1.000** 274.367
207 M 1.000** 274.367
208 V 1.000** 274.367
209 R 1.000** 274.367
210 S 1.000** 274.367
211 A 1.000** 274.367
212 I 1.000** 274.367
213 K 1.000** 274.367
214 R 1.000** 274.367
215 G 1.000** 274.367
216 E 1.000** 274.367
217 K 1.000** 274.367
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323030_1_1990_MLBR_RS09445)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -842.105997 Model 2: PositiveSelection -842.106043 Model 0: one-ratio -842.105984 Model 7: beta -842.106114 Model 8: beta&w>1 -842.105929 Model 0 vs 1 2.599999993435631E-5 Model 2 vs 1 9.1999999995096E-5 Model 8 vs 7 3.700000002027082E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
