--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:35:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -737.22 -740.22
2 -737.16 -740.72
--------------------------------------
TOTAL -737.19 -740.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891955 0.091876 0.385454 1.514722 0.857537 1501.00 1501.00 1.000
r(A<->C){all} 0.159139 0.017792 0.000091 0.422114 0.123121 261.69 342.31 1.000
r(A<->G){all} 0.162222 0.019288 0.000135 0.440418 0.124040 173.38 179.26 1.000
r(A<->T){all} 0.166677 0.020564 0.000131 0.469117 0.128485 139.98 190.53 1.002
r(C<->G){all} 0.165972 0.019197 0.000007 0.433085 0.131093 194.79 232.41 1.009
r(C<->T){all} 0.179481 0.021029 0.000001 0.459274 0.147255 197.63 235.15 1.000
r(G<->T){all} 0.166509 0.020382 0.000036 0.453226 0.125120 153.17 212.19 1.003
pi(A){all} 0.212433 0.000311 0.178886 0.247428 0.212148 1070.78 1165.68 1.001
pi(C){all} 0.271496 0.000358 0.236216 0.309681 0.270886 1149.01 1156.80 1.000
pi(G){all} 0.313506 0.000374 0.277768 0.353507 0.312814 1353.71 1376.71 1.000
pi(T){all} 0.202565 0.000300 0.166202 0.233964 0.201793 1201.05 1322.61 1.000
alpha{1,2} 0.413473 0.226103 0.000129 1.382489 0.249313 1291.36 1292.33 1.000
alpha{3} 0.465597 0.263113 0.000236 1.483969 0.293367 1158.06 1188.78 1.000
pinvar{all} 0.997024 0.000012 0.990323 0.999999 0.998129 1189.10 1232.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -703.311677
Model 2: PositiveSelection -703.311675
Model 0: one-ratio -703.311677
Model 7: beta -703.311663
Model 8: beta&w>1 -703.311655
Model 0 vs 1 0.0
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 1.5999999959603883E-5
>C1
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C2
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C3
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C4
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C5
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C6
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179
C1 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C2 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C3 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C4 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C5 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C6 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
**************************************************
C1 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C2 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C3 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C4 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C5 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C6 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
**************************************************
C1 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C2 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C3 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C4 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C5 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C6 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
**************************************************
C1 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C2 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C3 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C4 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C5 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C6 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5370]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5370]--->[5370]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 30.708 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C2 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C3 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C4 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C5 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C6 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
**************************************************
C1 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C2 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C3 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C4 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C5 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C6 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
**************************************************
C1 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C2 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C3 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C4 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C5 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C6 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
**************************************************
C1 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C2 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C3 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C4 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C5 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C6 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C2 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C3 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C4 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C5 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C6 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
**************************************************
C1 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C2 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C3 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C4 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C5 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C6 CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
**************************************************
C1 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C2 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C3 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C4 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C5 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C6 ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
**************************************************
C1 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C2 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C3 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C4 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C5 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C6 ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
**************************************************
C1 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C2 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C3 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C4 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C5 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C6 ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
**************************************************
C1 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C2 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C3 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C4 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C5 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C6 ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
**************************************************
C1 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C2 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C3 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C4 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C5 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C6 GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
**************************************************
C1 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C2 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C3 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C4 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C5 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C6 GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
**************************************************
C1 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C2 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C3 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C4 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C5 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C6 TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
**************************************************
C1 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C2 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C3 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C4 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C5 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C6 CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
**************************************************
C1 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C2 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C3 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C4 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C5 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C6 CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
*************************************
>C1
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C2
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C3
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C4
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C5
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C6
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C1
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C2
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C3
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C4
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C5
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C6
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 537 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790008
Setting output file names to "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 965419037
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0395276445
Seed = 1318977423
Swapseed = 1579790008
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1201.831744 -- -24.965149
Chain 2 -- -1201.831561 -- -24.965149
Chain 3 -- -1201.831674 -- -24.965149
Chain 4 -- -1201.831744 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1201.831561 -- -24.965149
Chain 2 -- -1201.831561 -- -24.965149
Chain 3 -- -1201.831674 -- -24.965149
Chain 4 -- -1201.831561 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1201.832] (-1201.832) (-1201.832) (-1201.832) * [-1201.832] (-1201.832) (-1201.832) (-1201.832)
500 -- (-749.697) [-745.111] (-748.833) (-743.578) * (-750.583) (-759.125) (-755.633) [-751.461] -- 0:00:00
1000 -- (-747.339) (-750.024) (-762.711) [-746.669] * (-749.922) (-742.659) [-743.674] (-747.535) -- 0:00:00
1500 -- (-745.909) (-746.465) [-742.787] (-748.400) * (-749.931) (-749.568) (-743.866) [-746.907] -- 0:00:00
2000 -- (-750.348) (-744.094) [-748.245] (-745.333) * (-741.130) (-746.885) [-746.044] (-749.078) -- 0:00:00
2500 -- (-756.896) [-749.353] (-749.687) (-751.386) * (-748.427) [-744.854] (-749.160) (-755.734) -- 0:00:00
3000 -- (-744.406) (-742.343) (-747.937) [-745.609] * (-748.165) (-748.072) (-753.727) [-740.578] -- 0:00:00
3500 -- (-749.928) (-739.827) (-747.956) [-748.911] * (-745.861) (-744.412) (-760.608) [-751.251] -- 0:00:00
4000 -- (-750.453) (-745.082) [-741.961] (-750.180) * (-743.900) [-745.137] (-740.863) (-746.186) -- 0:00:00
4500 -- [-747.660] (-750.179) (-746.790) (-748.838) * (-756.091) [-749.638] (-753.432) (-750.010) -- 0:00:00
5000 -- (-742.414) [-742.612] (-746.657) (-749.101) * [-741.143] (-753.514) (-745.660) (-751.886) -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-743.187) (-743.376) [-744.032] (-749.111) * (-746.543) (-741.416) [-749.759] (-743.417) -- 0:00:00
6000 -- [-751.635] (-747.646) (-746.562) (-748.707) * (-745.904) [-748.765] (-744.920) (-743.450) -- 0:00:00
6500 -- (-748.182) (-747.336) [-741.085] (-742.954) * [-743.186] (-755.604) (-742.042) (-750.533) -- 0:00:00
7000 -- (-750.022) (-753.232) [-746.938] (-751.132) * (-749.871) (-745.768) [-749.277] (-749.742) -- 0:00:00
7500 -- [-742.987] (-753.798) (-752.840) (-745.068) * (-747.097) (-745.420) [-745.649] (-753.078) -- 0:00:00
8000 -- (-748.160) (-748.997) [-743.285] (-743.118) * [-750.666] (-751.831) (-751.603) (-757.365) -- 0:00:00
8500 -- (-748.060) (-747.492) (-748.327) [-745.073] * (-747.717) (-747.384) (-754.519) [-745.876] -- 0:00:00
9000 -- (-751.967) (-750.697) (-746.214) [-746.999] * (-743.464) [-745.510] (-751.435) (-744.658) -- 0:00:00
9500 -- (-745.796) (-747.662) (-745.580) [-742.856] * (-749.702) [-745.066] (-750.443) (-753.749) -- 0:00:00
10000 -- (-747.958) (-752.202) (-746.225) [-744.345] * (-748.611) [-745.355] (-747.453) (-753.055) -- 0:00:00
Average standard deviation of split frequencies: 0.083736
10500 -- (-748.056) (-745.670) [-756.432] (-752.513) * [-743.681] (-745.249) (-749.032) (-751.758) -- 0:00:00
11000 -- (-749.663) (-743.845) [-746.182] (-747.456) * [-745.996] (-746.155) (-747.174) (-743.270) -- 0:00:00
11500 -- (-751.601) [-744.854] (-751.564) (-749.701) * (-745.871) [-745.186] (-750.702) (-744.495) -- 0:00:00
12000 -- [-746.393] (-744.896) (-742.016) (-750.788) * (-743.895) [-742.890] (-741.006) (-745.485) -- 0:00:00
12500 -- (-752.907) (-746.005) (-744.795) [-747.931] * (-745.481) [-741.849] (-749.214) (-747.542) -- 0:00:00
13000 -- (-747.511) [-742.047] (-748.351) (-742.010) * (-750.335) (-743.162) (-742.444) [-748.358] -- 0:00:00
13500 -- (-747.062) [-742.147] (-751.586) (-744.699) * (-741.605) [-750.114] (-748.965) (-747.303) -- 0:00:00
14000 -- (-744.303) [-747.437] (-761.982) (-750.056) * [-737.735] (-747.756) (-744.951) (-749.314) -- 0:01:10
14500 -- (-744.037) (-747.075) (-746.073) [-747.690] * (-736.789) (-756.787) [-744.910] (-738.989) -- 0:01:07
15000 -- (-745.284) [-746.835] (-746.719) (-745.144) * (-738.467) (-745.593) (-745.605) [-739.649] -- 0:01:05
Average standard deviation of split frequencies: 0.071331
15500 -- (-749.634) (-743.470) (-755.201) [-745.123] * [-739.560] (-744.884) (-746.079) (-741.728) -- 0:01:03
16000 -- (-743.989) [-747.756] (-750.385) (-740.848) * (-737.943) [-751.024] (-748.017) (-737.981) -- 0:01:01
16500 -- [-754.193] (-749.869) (-744.317) (-746.914) * (-736.162) [-746.182] (-753.855) (-735.813) -- 0:00:59
17000 -- [-744.427] (-749.628) (-746.598) (-751.544) * (-740.680) (-750.233) (-743.587) [-740.532] -- 0:00:57
17500 -- (-747.741) [-742.998] (-745.980) (-753.709) * (-742.292) (-747.245) (-752.613) [-739.282] -- 0:00:56
18000 -- [-749.678] (-745.960) (-748.696) (-753.203) * (-738.201) (-742.232) (-755.712) [-739.983] -- 0:00:54
18500 -- [-755.847] (-746.213) (-743.457) (-745.427) * (-743.873) (-746.153) (-757.985) [-737.936] -- 0:00:53
19000 -- (-748.358) (-743.098) [-746.819] (-742.849) * [-739.566] (-742.805) (-754.759) (-736.930) -- 0:00:51
19500 -- (-747.194) (-758.987) [-745.170] (-746.638) * (-737.769) [-743.325] (-747.988) (-735.961) -- 0:00:50
20000 -- (-756.523) (-754.205) [-746.010] (-754.019) * [-737.891] (-752.388) (-743.698) (-737.676) -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- (-765.395) (-752.521) [-746.995] (-745.438) * (-737.451) (-750.943) [-745.049] (-739.177) -- 0:00:47
21000 -- [-737.600] (-750.160) (-759.504) (-749.371) * (-737.437) (-748.613) (-748.897) [-738.936] -- 0:00:46
21500 -- [-737.668] (-752.231) (-752.442) (-749.109) * (-738.391) [-754.284] (-747.729) (-738.412) -- 0:00:45
22000 -- (-738.356) (-744.828) [-739.811] (-753.687) * (-739.376) (-756.755) (-751.332) [-736.390] -- 0:00:44
22500 -- (-736.870) (-748.308) (-741.419) [-749.004] * (-743.130) (-748.633) [-747.297] (-741.233) -- 0:00:43
23000 -- [-736.430] (-741.290) (-737.625) (-753.418) * (-740.537) (-749.946) (-749.078) [-743.713] -- 0:00:42
23500 -- [-738.517] (-745.205) (-738.067) (-748.182) * (-738.543) (-753.871) (-751.584) [-737.844] -- 0:00:41
24000 -- (-739.401) (-751.076) (-736.830) [-746.067] * (-737.451) (-748.745) (-742.550) [-737.825] -- 0:00:40
24500 -- (-737.519) (-739.989) [-740.152] (-742.092) * (-738.242) (-744.478) (-743.438) [-737.992] -- 0:00:39
25000 -- [-737.694] (-742.498) (-740.748) (-757.087) * (-738.356) (-744.424) [-744.692] (-741.685) -- 0:00:39
Average standard deviation of split frequencies: 0.056983
25500 -- (-735.748) (-746.138) [-741.129] (-747.403) * [-736.860] (-748.952) (-746.917) (-737.185) -- 0:00:38
26000 -- (-736.704) (-749.209) [-737.687] (-742.295) * [-735.850] (-754.097) (-743.025) (-738.263) -- 0:00:37
26500 -- (-736.735) (-756.933) (-737.766) [-746.061] * [-737.883] (-745.465) (-750.891) (-736.459) -- 0:00:36
27000 -- [-736.119] (-747.482) (-746.135) (-752.711) * (-737.550) (-741.089) (-741.924) [-738.992] -- 0:00:36
27500 -- (-737.204) (-753.112) (-747.785) [-740.851] * (-736.407) (-753.071) [-748.231] (-737.707) -- 0:00:35
28000 -- (-739.200) (-747.348) (-741.300) [-746.412] * [-736.625] (-749.759) (-745.001) (-737.366) -- 0:00:34
28500 -- (-738.488) [-750.035] (-736.660) (-750.848) * (-737.349) (-746.430) (-751.014) [-738.424] -- 0:00:34
29000 -- (-740.718) (-749.078) (-739.327) [-757.932] * [-740.513] (-762.709) (-750.275) (-736.710) -- 0:00:33
29500 -- (-737.683) (-753.570) (-736.333) [-745.822] * (-743.463) (-745.256) (-749.560) [-741.218] -- 0:00:32
30000 -- (-741.058) (-753.472) (-737.959) [-741.540] * (-739.804) (-756.481) (-754.290) [-737.668] -- 0:00:32
Average standard deviation of split frequencies: 0.047653
30500 -- (-738.262) (-748.346) (-737.941) [-753.706] * (-737.532) (-747.867) [-742.820] (-737.533) -- 0:01:03
31000 -- [-739.580] (-745.990) (-739.683) (-745.458) * (-737.805) (-751.807) (-749.570) [-735.766] -- 0:01:02
31500 -- (-736.247) (-749.617) (-737.414) [-742.654] * (-737.593) (-743.327) [-741.443] (-737.676) -- 0:01:01
32000 -- (-737.177) (-749.457) (-740.288) [-744.399] * [-737.785] (-749.803) (-747.144) (-740.868) -- 0:01:00
32500 -- (-736.555) [-751.744] (-740.298) (-744.817) * [-735.771] (-746.320) (-745.619) (-740.271) -- 0:00:59
33000 -- (-736.870) [-747.656] (-738.699) (-750.293) * (-737.411) (-742.452) [-742.794] (-744.043) -- 0:00:58
33500 -- (-739.018) [-748.316] (-739.183) (-751.508) * [-742.125] (-740.663) (-750.058) (-742.823) -- 0:00:57
34000 -- (-740.288) (-747.914) (-736.858) [-743.620] * (-736.348) (-751.566) (-753.055) [-739.285] -- 0:00:56
34500 -- (-738.446) [-747.928] (-737.641) (-743.855) * (-740.670) (-744.205) [-753.507] (-740.613) -- 0:00:55
35000 -- (-738.867) (-754.788) (-738.428) [-748.655] * [-737.234] (-749.366) (-746.661) (-738.374) -- 0:00:55
Average standard deviation of split frequencies: 0.038595
35500 -- (-737.837) (-742.023) (-739.928) [-754.252] * [-738.344] (-749.788) (-762.527) (-738.245) -- 0:00:54
36000 -- [-739.692] (-746.042) (-738.008) (-748.425) * (-739.069) (-754.724) (-745.706) [-736.376] -- 0:00:53
36500 -- (-740.190) (-747.684) [-736.968] (-744.622) * [-738.168] (-742.610) (-754.168) (-735.678) -- 0:00:52
37000 -- (-737.914) (-747.257) [-738.892] (-749.743) * (-736.885) [-738.805] (-746.831) (-735.956) -- 0:00:52
37500 -- [-737.749] (-744.756) (-740.958) (-746.258) * [-738.397] (-736.745) (-748.941) (-736.173) -- 0:00:51
38000 -- (-737.732) (-748.970) (-741.302) [-742.120] * (-742.812) (-736.677) (-743.734) [-737.430] -- 0:00:50
38500 -- (-736.202) [-747.917] (-738.825) (-757.656) * (-742.467) (-738.954) [-745.345] (-738.572) -- 0:00:49
39000 -- (-736.080) (-742.288) [-736.550] (-756.682) * (-740.653) (-739.826) (-750.489) [-735.868] -- 0:00:49
39500 -- (-738.670) (-750.730) (-740.065) [-746.074] * (-739.899) [-739.074] (-746.231) (-736.752) -- 0:00:48
40000 -- [-737.612] (-749.477) (-737.308) (-744.544) * (-736.744) (-737.525) [-747.049] (-741.685) -- 0:00:48
Average standard deviation of split frequencies: 0.034776
40500 -- (-739.798) (-747.820) [-737.777] (-751.225) * [-735.740] (-742.522) (-745.760) (-739.093) -- 0:00:47
41000 -- (-739.359) [-740.340] (-738.621) (-747.038) * (-737.220) (-737.315) [-751.741] (-737.312) -- 0:00:46
41500 -- (-741.150) (-742.320) (-737.997) [-745.308] * [-736.421] (-738.565) (-751.550) (-736.847) -- 0:00:46
42000 -- (-738.310) [-739.893] (-737.835) (-749.840) * (-736.114) [-737.827] (-748.501) (-738.422) -- 0:00:45
42500 -- (-736.871) [-737.721] (-736.328) (-746.951) * (-740.171) (-736.410) [-748.288] (-739.808) -- 0:00:45
43000 -- [-736.867] (-738.327) (-737.684) (-756.921) * [-736.962] (-738.617) (-747.327) (-737.198) -- 0:00:44
43500 -- (-738.165) (-742.247) (-740.782) [-746.693] * (-738.998) [-737.935] (-756.140) (-737.356) -- 0:00:43
44000 -- (-736.931) (-737.691) (-739.750) [-744.546] * (-740.498) (-737.132) [-742.920] (-736.123) -- 0:00:43
44500 -- (-738.984) (-737.621) (-736.670) [-743.524] * (-738.248) (-736.280) [-745.344] (-736.861) -- 0:00:42
45000 -- (-738.431) (-737.353) [-737.513] (-754.304) * [-742.728] (-736.744) (-747.642) (-738.300) -- 0:00:42
Average standard deviation of split frequencies: 0.026840
45500 -- (-740.153) (-736.601) (-740.638) [-746.850] * (-738.266) (-736.342) (-745.862) [-735.866] -- 0:00:41
46000 -- (-739.956) (-735.936) (-737.254) [-745.572] * [-740.532] (-737.537) (-751.491) (-736.559) -- 0:00:41
46500 -- [-739.971] (-737.101) (-736.833) (-753.202) * (-743.239) (-736.910) (-758.118) [-737.248] -- 0:00:41
47000 -- (-740.916) [-738.389] (-737.737) (-751.042) * (-735.829) (-736.256) (-742.602) [-737.837] -- 0:01:00
47500 -- (-736.990) [-737.414] (-736.642) (-743.403) * (-740.448) (-736.871) (-750.606) [-739.760] -- 0:01:00
48000 -- (-736.566) (-736.132) (-738.076) [-747.706] * (-740.316) [-737.083] (-745.527) (-738.119) -- 0:00:59
48500 -- (-737.060) (-738.271) [-736.881] (-743.955) * [-737.263] (-737.800) (-756.255) (-736.218) -- 0:00:58
49000 -- (-736.670) [-736.286] (-739.604) (-746.465) * (-738.914) (-738.308) (-745.025) [-737.078] -- 0:00:58
49500 -- (-736.262) (-745.826) [-737.335] (-753.655) * (-740.358) (-737.675) (-745.834) [-736.249] -- 0:00:57
50000 -- (-740.080) (-740.457) [-736.791] (-750.744) * (-738.202) (-736.743) (-751.482) [-735.764] -- 0:00:57
Average standard deviation of split frequencies: 0.030872
50500 -- (-738.301) (-736.820) [-737.728] (-747.593) * (-737.332) (-737.220) [-745.261] (-738.959) -- 0:00:56
51000 -- (-742.034) (-740.601) (-740.329) [-744.182] * (-740.766) [-738.802] (-751.601) (-739.579) -- 0:00:55
51500 -- (-737.540) [-739.792] (-737.989) (-745.593) * (-736.656) (-739.962) (-753.229) [-737.572] -- 0:00:55
52000 -- (-742.633) [-741.389] (-736.333) (-745.029) * [-736.491] (-746.077) (-752.402) (-737.639) -- 0:00:54
52500 -- (-740.309) (-739.157) (-735.769) [-743.692] * (-740.527) (-744.430) (-747.006) [-736.657] -- 0:00:54
53000 -- [-740.023] (-737.729) (-743.521) (-744.995) * [-737.737] (-737.736) (-752.246) (-737.583) -- 0:00:53
53500 -- (-740.925) [-737.712] (-741.061) (-747.263) * (-736.401) (-738.097) (-740.194) [-737.204] -- 0:00:53
54000 -- (-737.290) [-737.067] (-744.339) (-744.293) * (-736.827) [-736.386] (-735.505) (-737.536) -- 0:00:52
54500 -- [-739.593] (-739.642) (-740.018) (-751.399) * (-739.595) (-737.399) [-740.892] (-737.330) -- 0:00:52
55000 -- (-737.113) [-736.183] (-737.698) (-752.804) * (-738.435) [-737.587] (-740.186) (-737.293) -- 0:00:51
Average standard deviation of split frequencies: 0.033672
55500 -- (-735.906) [-736.937] (-738.009) (-746.521) * (-743.363) (-739.086) [-738.159] (-736.484) -- 0:00:51
56000 -- (-739.359) [-737.644] (-736.966) (-747.847) * (-743.762) [-737.822] (-738.022) (-737.479) -- 0:00:50
56500 -- (-738.530) [-738.950] (-736.817) (-746.435) * (-739.822) (-739.162) (-739.344) [-738.074] -- 0:00:50
57000 -- (-737.857) (-740.755) [-736.613] (-754.853) * [-736.401] (-736.752) (-737.101) (-738.860) -- 0:00:49
57500 -- [-737.449] (-736.638) (-736.865) (-753.107) * (-737.539) (-738.107) [-735.960] (-738.732) -- 0:00:49
58000 -- [-737.592] (-738.606) (-736.580) (-745.066) * [-737.355] (-738.016) (-735.657) (-738.082) -- 0:00:48
58500 -- [-738.064] (-737.704) (-736.542) (-748.624) * (-735.772) [-739.090] (-738.279) (-738.712) -- 0:00:48
59000 -- (-737.542) (-736.577) (-742.902) [-750.284] * (-736.834) (-737.333) (-739.568) [-739.189] -- 0:00:47
59500 -- (-741.593) (-737.400) [-742.522] (-760.268) * (-739.694) [-737.539] (-737.456) (-738.177) -- 0:00:47
60000 -- (-739.182) [-740.960] (-738.254) (-749.590) * (-738.338) (-739.996) (-737.207) [-736.534] -- 0:00:47
Average standard deviation of split frequencies: 0.036909
60500 -- (-736.261) (-740.817) (-736.917) [-744.928] * (-737.672) (-743.951) (-736.944) [-737.007] -- 0:00:46
61000 -- (-736.229) (-737.777) (-736.802) [-742.772] * (-739.156) (-745.862) [-736.996] (-741.443) -- 0:00:46
61500 -- [-736.073] (-739.096) (-737.792) (-748.953) * (-739.734) (-740.003) [-737.025] (-738.172) -- 0:00:45
62000 -- (-738.093) (-739.445) [-740.085] (-744.829) * (-738.750) (-738.814) [-736.746] (-740.120) -- 0:00:45
62500 -- [-735.937] (-739.771) (-737.482) (-751.617) * (-739.704) (-739.315) [-740.213] (-736.834) -- 0:00:45
63000 -- (-737.687) (-739.075) [-739.484] (-748.809) * (-741.924) [-739.371] (-741.379) (-738.732) -- 0:00:44
63500 -- (-739.497) (-738.460) [-740.545] (-750.903) * (-738.579) [-736.985] (-742.805) (-737.944) -- 0:00:58
64000 -- [-739.340] (-737.774) (-738.810) (-750.010) * (-738.351) [-739.353] (-744.357) (-738.350) -- 0:00:58
64500 -- (-739.905) (-736.884) (-736.949) [-744.197] * (-738.140) (-738.560) (-737.699) [-736.227] -- 0:00:58
65000 -- (-736.536) (-739.092) (-739.342) [-752.257] * [-739.718] (-739.693) (-737.237) (-737.555) -- 0:00:57
Average standard deviation of split frequencies: 0.036784
65500 -- (-738.785) (-738.183) (-738.578) [-751.561] * (-738.042) (-738.478) [-739.294] (-737.858) -- 0:00:57
66000 -- (-740.294) (-738.036) (-739.419) [-744.657] * (-737.799) (-736.662) (-738.222) [-738.274] -- 0:00:56
66500 -- (-736.282) (-739.209) [-738.020] (-749.730) * (-736.938) [-736.464] (-739.789) (-738.348) -- 0:00:56
67000 -- (-737.704) [-737.611] (-735.937) (-749.345) * [-736.776] (-735.893) (-738.974) (-736.498) -- 0:00:55
67500 -- (-738.873) (-737.075) (-739.544) [-754.007] * (-736.141) (-736.269) (-738.971) [-736.260] -- 0:00:55
68000 -- (-737.253) (-739.521) [-736.479] (-750.481) * (-740.305) [-740.256] (-739.572) (-740.760) -- 0:00:54
68500 -- [-736.938] (-739.776) (-738.530) (-745.589) * (-737.081) [-738.727] (-736.188) (-738.715) -- 0:00:54
69000 -- (-736.493) [-738.320] (-740.068) (-737.542) * [-736.973] (-736.772) (-738.538) (-742.549) -- 0:00:53
69500 -- [-737.265] (-737.442) (-737.161) (-737.330) * [-738.579] (-736.579) (-737.470) (-736.966) -- 0:00:53
70000 -- [-735.950] (-737.900) (-739.960) (-737.182) * (-740.789) (-740.546) [-736.833] (-739.063) -- 0:00:53
Average standard deviation of split frequencies: 0.036213
70500 -- (-743.744) [-737.854] (-739.071) (-738.017) * [-738.340] (-739.766) (-737.576) (-738.679) -- 0:00:52
71000 -- (-740.545) [-738.439] (-738.512) (-736.070) * (-741.003) (-740.280) (-741.923) [-739.786] -- 0:00:52
71500 -- (-738.172) (-738.842) [-742.243] (-736.797) * [-737.933] (-744.404) (-739.616) (-741.126) -- 0:00:51
72000 -- [-738.739] (-738.053) (-741.114) (-740.563) * [-738.394] (-739.260) (-744.618) (-742.574) -- 0:00:51
72500 -- (-736.537) (-739.237) [-737.719] (-741.087) * [-738.993] (-738.344) (-737.937) (-741.564) -- 0:00:51
73000 -- (-737.088) [-735.879] (-739.798) (-738.439) * (-737.752) (-738.348) [-738.897] (-739.260) -- 0:00:50
73500 -- [-736.862] (-738.685) (-736.900) (-739.389) * (-737.517) (-738.679) (-738.396) [-736.403] -- 0:00:50
74000 -- (-738.426) (-737.279) (-737.717) [-738.166] * (-737.283) (-736.312) (-736.973) [-737.987] -- 0:00:50
74500 -- (-737.032) (-736.305) (-738.000) [-737.198] * [-739.457] (-736.824) (-737.429) (-737.175) -- 0:00:49
75000 -- (-736.940) (-737.258) (-737.733) [-737.044] * (-739.405) [-738.134] (-739.906) (-739.906) -- 0:00:49
Average standard deviation of split frequencies: 0.032646
75500 -- (-739.032) (-737.395) (-739.422) [-736.202] * (-737.365) (-736.374) (-736.891) [-740.348] -- 0:00:48
76000 -- [-738.725] (-739.804) (-738.645) (-737.985) * (-735.840) (-737.820) (-738.866) [-738.505] -- 0:00:48
76500 -- (-738.893) (-736.747) [-740.440] (-737.039) * [-736.030] (-738.169) (-736.445) (-738.149) -- 0:00:48
77000 -- (-736.666) [-736.788] (-737.927) (-736.934) * (-736.003) [-739.992] (-738.669) (-737.263) -- 0:00:47
77500 -- (-736.015) (-739.317) (-740.404) [-737.649] * (-737.260) [-737.378] (-738.160) (-738.666) -- 0:00:47
78000 -- [-736.690] (-738.292) (-739.862) (-736.533) * (-736.699) (-737.364) [-737.129] (-744.978) -- 0:00:47
78500 -- [-736.650] (-739.258) (-737.080) (-735.945) * (-740.766) (-739.258) (-737.808) [-738.501] -- 0:00:46
79000 -- (-737.168) [-738.059] (-737.234) (-738.402) * [-737.896] (-740.432) (-737.493) (-739.714) -- 0:00:46
79500 -- (-738.437) (-737.644) [-738.053] (-738.554) * [-737.325] (-740.701) (-740.251) (-737.575) -- 0:00:46
80000 -- (-738.013) [-744.618] (-739.835) (-738.779) * (-738.005) [-739.467] (-740.244) (-743.087) -- 0:00:46
Average standard deviation of split frequencies: 0.032295
80500 -- [-737.170] (-736.767) (-738.503) (-738.113) * (-738.365) (-740.080) (-739.409) [-736.641] -- 0:00:57
81000 -- (-739.322) (-737.011) (-739.401) [-738.657] * (-736.670) (-739.824) [-739.383] (-742.386) -- 0:00:56
81500 -- (-738.556) (-738.769) [-739.474] (-737.336) * (-742.875) [-738.221] (-741.631) (-739.489) -- 0:00:56
82000 -- (-740.206) (-737.947) [-740.775] (-739.574) * (-740.119) (-738.684) (-740.810) [-739.216] -- 0:00:55
82500 -- (-738.719) (-739.227) [-737.498] (-736.680) * (-735.776) (-738.105) (-738.683) [-736.180] -- 0:00:55
83000 -- (-736.932) (-737.278) (-737.739) [-737.903] * (-735.891) [-736.469] (-738.258) (-735.982) -- 0:00:55
83500 -- (-736.736) (-745.660) (-740.922) [-736.331] * (-736.611) [-738.185] (-738.625) (-736.196) -- 0:00:54
84000 -- (-737.110) [-737.442] (-736.287) (-736.297) * [-736.042] (-739.373) (-740.452) (-738.408) -- 0:00:54
84500 -- (-736.123) (-736.314) [-739.708] (-736.149) * [-736.337] (-739.733) (-739.133) (-737.540) -- 0:00:54
85000 -- (-735.833) (-739.478) (-736.239) [-737.430] * [-735.817] (-737.559) (-736.878) (-738.145) -- 0:00:53
Average standard deviation of split frequencies: 0.024941
85500 -- (-737.643) (-737.253) [-737.303] (-739.691) * (-735.849) (-738.138) (-735.921) [-737.294] -- 0:00:53
86000 -- [-741.996] (-739.382) (-740.004) (-737.787) * [-737.048] (-741.101) (-737.806) (-737.634) -- 0:00:53
86500 -- (-738.440) (-741.707) [-736.625] (-737.075) * [-737.903] (-737.735) (-739.485) (-737.394) -- 0:00:52
87000 -- (-738.170) [-736.966] (-736.634) (-737.062) * [-738.397] (-738.292) (-737.202) (-736.632) -- 0:00:52
87500 -- (-735.976) [-736.151] (-738.262) (-738.048) * (-740.288) [-738.939] (-739.358) (-736.828) -- 0:00:52
88000 -- (-737.606) (-739.096) [-739.688] (-737.006) * (-738.855) (-737.822) [-738.342] (-736.428) -- 0:00:51
88500 -- (-736.857) (-738.578) (-736.582) [-737.669] * (-743.156) [-736.161] (-737.642) (-736.209) -- 0:00:51
89000 -- (-736.513) (-737.372) (-735.689) [-736.551] * (-738.235) (-738.240) [-736.525] (-737.680) -- 0:00:51
89500 -- [-737.726] (-736.604) (-737.282) (-736.103) * (-737.418) (-736.774) (-738.859) [-736.711] -- 0:00:50
90000 -- (-737.894) (-735.930) (-737.725) [-736.751] * (-736.912) (-738.610) [-737.429] (-744.339) -- 0:00:50
Average standard deviation of split frequencies: 0.021071
90500 -- [-739.395] (-737.339) (-739.807) (-738.221) * [-737.423] (-737.577) (-736.992) (-739.824) -- 0:00:50
91000 -- (-737.733) (-737.419) (-736.109) [-737.549] * (-736.269) (-736.780) (-737.065) [-739.976] -- 0:00:49
91500 -- (-737.620) [-737.045] (-738.118) (-742.587) * [-736.692] (-738.215) (-741.350) (-740.476) -- 0:00:49
92000 -- (-738.068) (-737.683) [-736.158] (-736.742) * (-742.764) (-739.190) (-736.437) [-738.158] -- 0:00:49
92500 -- [-738.384] (-739.358) (-738.699) (-736.993) * (-741.724) (-743.293) (-738.519) [-736.958] -- 0:00:49
93000 -- (-737.792) [-736.612] (-737.732) (-738.632) * (-737.049) [-737.078] (-735.916) (-737.358) -- 0:00:48
93500 -- [-738.978] (-736.964) (-736.783) (-736.185) * (-739.108) (-738.689) [-737.676] (-736.525) -- 0:00:48
94000 -- (-737.919) (-740.636) [-737.165] (-736.303) * (-738.969) (-739.289) (-735.789) [-739.545] -- 0:00:48
94500 -- [-736.595] (-742.362) (-736.950) (-737.434) * (-736.574) (-740.268) [-737.664] (-741.985) -- 0:00:47
95000 -- [-736.827] (-739.951) (-736.531) (-735.958) * (-736.846) (-738.982) [-738.505] (-740.570) -- 0:00:47
Average standard deviation of split frequencies: 0.023325
95500 -- (-736.916) (-739.822) (-736.718) [-736.050] * (-737.780) [-737.790] (-736.624) (-735.808) -- 0:00:47
96000 -- [-736.074] (-737.304) (-738.210) (-741.598) * (-741.465) (-738.333) (-739.184) [-736.179] -- 0:00:47
96500 -- [-738.500] (-737.848) (-739.485) (-743.018) * (-738.050) [-740.198] (-739.563) (-735.873) -- 0:00:46
97000 -- (-741.315) [-736.924] (-742.643) (-741.464) * (-741.672) [-740.413] (-736.699) (-735.742) -- 0:00:55
97500 -- (-743.218) (-737.182) (-737.898) [-737.548] * [-739.255] (-747.863) (-738.510) (-737.272) -- 0:00:55
98000 -- (-742.856) (-737.483) (-737.169) [-741.108] * (-737.653) (-739.302) [-738.242] (-741.642) -- 0:00:55
98500 -- (-741.343) (-736.048) (-736.544) [-742.735] * (-739.174) [-742.064] (-738.940) (-736.208) -- 0:00:54
99000 -- (-737.099) (-741.170) (-736.803) [-741.748] * (-738.618) (-736.299) [-736.276] (-736.764) -- 0:00:54
99500 -- (-738.833) (-739.005) [-738.656] (-739.340) * (-737.396) (-736.127) [-738.653] (-735.946) -- 0:00:54
100000 -- (-740.936) (-740.696) [-737.735] (-737.686) * (-741.925) (-736.279) [-738.169] (-736.231) -- 0:00:54
Average standard deviation of split frequencies: 0.023168
100500 -- [-738.855] (-739.421) (-741.272) (-738.429) * (-736.985) (-736.591) [-737.641] (-739.874) -- 0:00:53
101000 -- (-737.905) [-739.861] (-740.082) (-737.491) * (-737.776) (-737.670) (-738.200) [-738.551] -- 0:00:53
101500 -- (-742.160) (-736.310) [-738.241] (-736.655) * (-737.930) [-737.240] (-741.533) (-739.422) -- 0:00:53
102000 -- (-737.336) (-736.047) [-736.172] (-737.206) * (-737.511) [-736.845] (-737.419) (-737.813) -- 0:00:52
102500 -- [-740.376] (-736.555) (-737.626) (-736.203) * (-737.381) (-736.095) (-737.857) [-738.550] -- 0:00:52
103000 -- [-738.860] (-737.178) (-735.671) (-736.080) * (-738.033) (-735.838) (-737.810) [-737.426] -- 0:00:52
103500 -- (-738.846) (-741.099) (-738.856) [-740.595] * (-735.983) [-737.283] (-736.360) (-736.568) -- 0:00:51
104000 -- (-738.783) (-737.956) [-739.556] (-737.565) * (-739.386) (-738.479) [-739.386] (-736.101) -- 0:00:51
104500 -- (-737.453) (-738.095) (-741.148) [-737.435] * (-736.577) (-744.063) [-737.662] (-737.558) -- 0:00:51
105000 -- (-737.524) [-736.334] (-737.208) (-735.678) * [-736.733] (-738.758) (-740.495) (-741.346) -- 0:00:51
Average standard deviation of split frequencies: 0.023126
105500 -- (-738.742) [-738.457] (-736.043) (-738.212) * (-736.298) (-736.406) (-738.890) [-736.164] -- 0:00:50
106000 -- (-740.836) (-735.718) [-741.749] (-737.748) * (-736.760) [-738.144] (-738.715) (-737.985) -- 0:00:50
106500 -- [-736.563] (-735.872) (-737.062) (-737.833) * (-736.027) (-736.749) [-739.082] (-738.149) -- 0:00:50
107000 -- (-737.000) [-738.852] (-745.324) (-738.410) * [-735.834] (-740.476) (-740.227) (-738.815) -- 0:00:50
107500 -- (-736.582) (-740.240) (-739.507) [-736.370] * (-739.260) [-740.166] (-738.544) (-737.219) -- 0:00:49
108000 -- (-737.163) (-741.361) [-737.115] (-737.560) * (-739.920) [-740.602] (-738.252) (-738.237) -- 0:00:49
108500 -- (-737.097) (-739.536) (-736.284) [-739.534] * (-737.269) (-741.485) [-738.522] (-740.862) -- 0:00:49
109000 -- (-736.681) (-738.131) (-737.909) [-735.887] * (-738.189) (-739.046) [-738.485] (-740.115) -- 0:00:49
109500 -- (-741.678) (-742.335) [-736.234] (-736.274) * (-736.083) (-737.309) (-738.428) [-738.259] -- 0:00:48
110000 -- (-737.150) [-737.198] (-738.726) (-738.388) * [-738.698] (-736.837) (-737.050) (-740.585) -- 0:00:48
Average standard deviation of split frequencies: 0.022644
110500 -- (-736.515) [-735.867] (-739.868) (-738.423) * (-737.101) [-737.538] (-744.223) (-736.542) -- 0:00:48
111000 -- (-737.370) (-737.875) [-736.996] (-737.963) * (-737.581) [-738.774] (-736.863) (-737.132) -- 0:00:48
111500 -- (-741.501) (-735.857) (-735.746) [-737.432] * [-737.623] (-742.240) (-736.617) (-736.831) -- 0:00:47
112000 -- (-738.856) [-736.003] (-736.010) (-737.409) * (-738.251) (-737.792) (-738.212) [-735.791] -- 0:00:47
112500 -- [-738.661] (-738.695) (-737.301) (-738.681) * (-738.204) (-738.938) (-740.568) [-739.242] -- 0:00:47
113000 -- [-736.115] (-739.012) (-737.445) (-740.160) * (-736.740) [-736.617] (-740.799) (-736.853) -- 0:00:47
113500 -- (-736.718) (-741.384) (-737.984) [-739.556] * (-739.579) (-736.603) [-738.918] (-738.457) -- 0:00:46
114000 -- (-735.905) (-739.129) [-736.680] (-738.946) * [-737.434] (-737.102) (-738.645) (-738.113) -- 0:00:54
114500 -- (-740.377) (-737.038) [-736.605] (-737.705) * (-739.558) (-737.217) [-736.865] (-739.113) -- 0:00:54
115000 -- [-739.419] (-738.772) (-737.477) (-738.266) * (-738.773) (-739.418) [-739.124] (-740.367) -- 0:00:53
Average standard deviation of split frequencies: 0.019891
115500 -- (-737.261) (-738.938) (-737.015) [-741.811] * (-737.349) (-740.078) (-737.013) [-737.221] -- 0:00:53
116000 -- [-741.059] (-738.443) (-737.958) (-737.968) * (-739.550) [-738.386] (-738.996) (-739.242) -- 0:00:53
116500 -- [-738.972] (-736.694) (-741.127) (-738.014) * (-736.352) (-739.048) [-735.818] (-738.728) -- 0:00:53
117000 -- (-741.271) (-739.288) [-736.817] (-737.034) * [-738.476] (-738.762) (-736.096) (-737.431) -- 0:00:52
117500 -- (-740.407) (-743.315) (-740.080) [-740.090] * (-741.314) (-744.166) (-738.564) [-738.983] -- 0:00:52
118000 -- (-738.894) (-741.482) [-739.296] (-738.922) * [-741.080] (-742.167) (-736.406) (-737.762) -- 0:00:52
118500 -- (-738.682) (-738.050) (-736.661) [-739.260] * (-738.250) (-738.598) (-738.459) [-739.530] -- 0:00:52
119000 -- (-738.547) (-739.887) (-737.166) [-738.929] * [-739.924] (-737.491) (-738.775) (-736.935) -- 0:00:51
119500 -- (-739.319) (-738.487) (-739.014) [-735.621] * (-739.726) (-737.045) (-738.116) [-738.422] -- 0:00:51
120000 -- [-736.520] (-736.492) (-739.300) (-736.502) * (-737.469) [-736.437] (-737.739) (-741.038) -- 0:00:51
Average standard deviation of split frequencies: 0.016061
120500 -- (-741.310) (-736.803) (-743.304) [-736.893] * (-736.888) (-736.979) [-738.463] (-736.623) -- 0:00:51
121000 -- [-735.630] (-737.625) (-738.561) (-739.025) * (-737.795) (-736.660) (-735.801) [-737.744] -- 0:00:50
121500 -- (-737.171) (-739.775) (-738.898) [-736.228] * (-737.588) (-736.801) (-736.519) [-737.911] -- 0:00:50
122000 -- (-741.380) (-738.029) (-737.709) [-735.694] * (-736.315) (-736.163) [-736.394] (-738.258) -- 0:00:50
122500 -- (-743.456) (-738.072) (-738.214) [-736.457] * (-736.446) [-736.605] (-740.058) (-739.407) -- 0:00:50
123000 -- [-741.290] (-739.419) (-737.774) (-737.779) * (-735.870) (-744.369) (-741.110) [-739.051] -- 0:00:49
123500 -- (-738.726) (-737.551) (-737.717) [-741.456] * (-738.633) (-740.866) (-740.852) [-738.778] -- 0:00:49
124000 -- (-736.998) (-737.873) (-742.052) [-738.617] * [-736.074] (-737.530) (-738.945) (-736.369) -- 0:00:49
124500 -- (-736.770) (-739.257) (-740.997) [-737.393] * [-736.050] (-743.167) (-739.368) (-737.329) -- 0:00:49
125000 -- (-737.292) [-737.993] (-740.295) (-737.056) * (-738.992) [-738.668] (-739.878) (-738.194) -- 0:00:49
Average standard deviation of split frequencies: 0.015526
125500 -- (-736.385) [-738.858] (-737.631) (-738.576) * [-741.020] (-736.220) (-740.184) (-738.273) -- 0:00:48
126000 -- (-736.940) (-737.245) [-737.705] (-741.815) * (-740.915) (-736.180) [-739.715] (-745.346) -- 0:00:48
126500 -- [-738.199] (-736.615) (-737.277) (-737.677) * (-740.844) (-738.667) [-740.617] (-738.199) -- 0:00:48
127000 -- (-738.429) [-736.506] (-737.618) (-739.227) * (-738.128) (-739.287) (-737.416) [-737.485] -- 0:00:48
127500 -- (-736.212) (-737.143) [-736.812] (-738.167) * [-743.664] (-739.811) (-737.179) (-739.923) -- 0:00:47
128000 -- (-737.452) [-737.378] (-737.050) (-737.712) * (-736.933) (-737.249) (-736.809) [-736.622] -- 0:00:47
128500 -- (-736.738) (-737.151) [-737.817] (-743.085) * (-738.101) [-737.321] (-737.475) (-739.081) -- 0:00:47
129000 -- (-739.161) (-736.976) [-741.307] (-738.736) * (-737.100) (-737.673) (-739.042) [-739.996] -- 0:00:47
129500 -- (-739.422) [-737.496] (-737.475) (-738.069) * (-736.115) (-737.548) (-743.521) [-739.544] -- 0:00:47
130000 -- [-737.008] (-740.864) (-737.867) (-740.050) * (-739.606) (-737.035) [-741.659] (-741.371) -- 0:00:46
Average standard deviation of split frequencies: 0.015380
130500 -- (-736.992) (-739.509) (-737.154) [-738.195] * (-740.862) (-737.801) (-743.961) [-737.863] -- 0:00:46
131000 -- (-736.293) (-738.324) [-737.896] (-739.234) * (-737.077) (-738.359) (-742.333) [-737.524] -- 0:00:53
131500 -- (-736.830) (-739.797) (-741.303) [-739.659] * (-738.173) [-737.413] (-736.626) (-737.030) -- 0:00:52
132000 -- [-740.018] (-738.907) (-738.006) (-738.054) * [-738.233] (-736.685) (-738.006) (-737.571) -- 0:00:52
132500 -- (-738.713) [-738.477] (-738.264) (-737.607) * [-738.415] (-737.291) (-736.795) (-739.352) -- 0:00:52
133000 -- [-738.586] (-741.451) (-737.529) (-737.150) * (-737.622) [-735.924] (-738.599) (-736.084) -- 0:00:52
133500 -- (-739.856) (-739.911) [-741.330] (-738.226) * (-737.028) (-737.520) (-742.487) [-736.383] -- 0:00:51
134000 -- (-738.192) (-740.750) (-737.481) [-741.600] * (-738.957) (-741.614) (-741.475) [-737.929] -- 0:00:51
134500 -- (-740.463) (-738.168) (-737.962) [-736.903] * (-738.678) (-737.992) (-736.249) [-736.982] -- 0:00:51
135000 -- (-741.070) (-738.823) (-739.549) [-737.003] * (-739.576) (-738.743) [-740.115] (-739.270) -- 0:00:51
Average standard deviation of split frequencies: 0.014412
135500 -- (-737.272) (-738.533) [-736.574] (-737.269) * [-740.176] (-735.609) (-738.393) (-740.278) -- 0:00:51
136000 -- (-737.204) (-737.341) [-736.116] (-738.926) * (-737.687) [-736.703] (-736.971) (-739.990) -- 0:00:50
136500 -- (-736.629) (-739.570) (-737.110) [-737.464] * (-736.760) (-738.503) [-737.186] (-738.276) -- 0:00:50
137000 -- [-735.850] (-738.529) (-738.374) (-737.853) * (-738.213) (-738.673) (-738.544) [-736.479] -- 0:00:50
137500 -- (-736.444) [-736.715] (-740.179) (-739.910) * (-738.344) (-737.015) [-741.935] (-736.544) -- 0:00:50
138000 -- (-739.555) (-738.097) (-738.314) [-738.211] * (-739.431) (-736.494) (-741.504) [-736.580] -- 0:00:49
138500 -- (-739.235) (-738.219) (-740.931) [-738.332] * (-737.762) (-739.017) [-741.531] (-737.599) -- 0:00:49
139000 -- [-739.549] (-737.317) (-736.911) (-736.618) * (-736.653) [-737.212] (-737.377) (-737.193) -- 0:00:49
139500 -- [-737.188] (-738.290) (-737.292) (-736.535) * (-736.629) (-740.547) (-736.695) [-736.588] -- 0:00:49
140000 -- [-736.458] (-737.447) (-741.310) (-736.819) * (-737.689) (-736.920) (-737.319) [-737.943] -- 0:00:49
Average standard deviation of split frequencies: 0.013237
140500 -- (-737.068) [-739.019] (-736.414) (-736.748) * [-739.325] (-736.028) (-738.086) (-737.451) -- 0:00:48
141000 -- (-739.453) [-737.475] (-735.628) (-736.024) * (-738.276) (-738.563) [-736.685] (-737.165) -- 0:00:48
141500 -- (-737.396) [-737.858] (-740.298) (-736.770) * [-736.772] (-736.193) (-736.684) (-738.665) -- 0:00:48
142000 -- (-736.752) [-738.242] (-741.094) (-736.802) * (-738.578) [-736.876] (-737.557) (-736.229) -- 0:00:48
142500 -- (-736.417) (-737.963) [-736.011] (-737.730) * [-739.126] (-738.088) (-737.302) (-736.090) -- 0:00:48
143000 -- (-735.630) [-736.680] (-735.608) (-740.867) * [-740.787] (-736.048) (-737.246) (-736.700) -- 0:00:47
143500 -- (-736.555) (-737.051) [-738.296] (-738.119) * (-739.340) [-736.615] (-737.216) (-738.248) -- 0:00:47
144000 -- [-736.184] (-737.743) (-742.044) (-736.578) * (-742.195) (-738.046) [-737.061] (-737.152) -- 0:00:47
144500 -- [-737.390] (-739.817) (-736.359) (-738.253) * (-741.357) [-737.153] (-737.630) (-737.061) -- 0:00:47
145000 -- (-737.650) (-737.485) [-737.238] (-736.506) * [-741.703] (-739.350) (-736.721) (-736.757) -- 0:00:47
Average standard deviation of split frequencies: 0.011624
145500 -- [-737.181] (-737.345) (-736.174) (-739.932) * (-738.040) [-737.538] (-737.453) (-736.825) -- 0:00:46
146000 -- (-736.326) [-737.334] (-735.916) (-738.335) * (-738.956) (-737.834) [-737.467] (-739.837) -- 0:00:46
146500 -- (-739.050) (-738.328) (-735.854) [-740.146] * (-741.185) (-736.526) (-737.873) [-736.343] -- 0:00:46
147000 -- (-739.661) (-737.962) [-736.080] (-742.375) * (-739.325) (-737.887) [-738.742] (-738.701) -- 0:00:46
147500 -- (-737.031) (-740.169) (-737.147) [-736.386] * [-737.568] (-737.208) (-738.597) (-737.103) -- 0:00:46
148000 -- (-736.551) [-740.296] (-739.517) (-736.267) * (-744.026) (-736.087) (-739.892) [-737.225] -- 0:00:51
148500 -- (-736.574) [-738.175] (-737.344) (-736.507) * [-736.866] (-736.648) (-740.820) (-743.925) -- 0:00:51
149000 -- (-738.025) [-738.447] (-737.838) (-736.972) * (-737.265) (-737.696) (-738.238) [-738.326] -- 0:00:51
149500 -- (-740.259) [-739.717] (-738.717) (-742.689) * (-739.450) (-736.368) [-735.861] (-744.191) -- 0:00:51
150000 -- (-740.722) (-736.674) (-737.218) [-735.642] * [-739.072] (-739.263) (-736.399) (-741.013) -- 0:00:51
Average standard deviation of split frequencies: 0.014236
150500 -- (-741.012) (-736.147) (-738.772) [-738.158] * (-742.018) [-736.940] (-739.307) (-736.066) -- 0:00:50
151000 -- (-738.761) (-742.164) (-738.717) [-737.170] * [-739.619] (-738.918) (-740.133) (-739.329) -- 0:00:50
151500 -- (-739.020) (-738.109) [-736.713] (-739.455) * [-738.870] (-736.765) (-738.664) (-738.005) -- 0:00:50
152000 -- [-737.834] (-740.617) (-736.877) (-740.168) * (-737.927) (-737.689) [-737.517] (-738.090) -- 0:00:50
152500 -- (-739.109) (-738.462) (-739.931) [-737.466] * (-739.042) (-737.217) (-737.458) [-736.990] -- 0:00:50
153000 -- (-744.180) (-736.772) (-740.970) [-738.253] * (-737.215) (-737.893) [-738.527] (-739.437) -- 0:00:49
153500 -- (-741.469) (-740.440) [-737.047] (-735.934) * [-735.926] (-737.330) (-739.385) (-740.830) -- 0:00:49
154000 -- (-737.613) (-739.807) [-739.336] (-736.209) * (-737.188) (-738.619) (-737.969) [-742.925] -- 0:00:49
154500 -- (-738.874) (-738.131) [-737.793] (-739.781) * (-738.770) (-738.011) (-736.770) [-736.693] -- 0:00:49
155000 -- (-736.487) [-737.392] (-737.097) (-739.713) * (-735.940) (-736.525) [-737.271] (-738.001) -- 0:00:49
Average standard deviation of split frequencies: 0.013996
155500 -- (-739.217) (-737.025) [-736.672] (-737.778) * [-740.604] (-736.514) (-738.688) (-740.988) -- 0:00:48
156000 -- (-741.904) [-736.988] (-737.180) (-737.413) * (-738.268) [-738.081] (-743.161) (-738.131) -- 0:00:48
156500 -- [-736.662] (-736.356) (-738.430) (-737.088) * (-736.733) [-737.441] (-744.206) (-737.785) -- 0:00:48
157000 -- [-736.941] (-737.291) (-740.677) (-738.168) * [-738.792] (-743.352) (-737.369) (-738.180) -- 0:00:48
157500 -- (-740.493) [-739.242] (-739.596) (-740.141) * (-736.742) (-737.926) (-739.719) [-736.982] -- 0:00:48
158000 -- (-737.274) (-739.905) [-743.881] (-739.440) * (-739.735) [-738.147] (-740.165) (-736.521) -- 0:00:47
158500 -- (-737.530) (-737.559) [-736.491] (-736.443) * [-745.974] (-737.410) (-744.200) (-736.187) -- 0:00:47
159000 -- (-736.342) (-737.304) [-736.542] (-738.399) * [-740.946] (-738.819) (-741.328) (-737.629) -- 0:00:47
159500 -- (-735.945) [-738.264] (-736.989) (-739.120) * (-740.355) (-736.543) (-737.984) [-737.661] -- 0:00:47
160000 -- (-736.977) (-735.877) (-736.977) [-737.201] * (-738.670) (-736.976) [-739.378] (-742.363) -- 0:00:47
Average standard deviation of split frequencies: 0.015811
160500 -- (-736.561) (-737.879) [-738.630] (-737.677) * (-738.029) [-738.284] (-740.206) (-742.282) -- 0:00:47
161000 -- [-736.593] (-742.290) (-737.390) (-738.263) * [-739.064] (-739.142) (-739.932) (-736.192) -- 0:00:46
161500 -- (-736.649) (-738.290) [-735.705] (-738.109) * (-736.522) (-739.588) (-738.704) [-739.293] -- 0:00:46
162000 -- [-740.501] (-739.540) (-737.601) (-738.502) * (-736.987) [-739.270] (-737.857) (-736.882) -- 0:00:46
162500 -- (-741.733) (-736.441) (-737.416) [-736.186] * (-737.602) [-736.593] (-736.954) (-738.918) -- 0:00:46
163000 -- [-738.641] (-737.546) (-739.884) (-736.871) * [-736.145] (-738.285) (-738.011) (-740.529) -- 0:00:46
163500 -- (-737.138) (-736.158) (-739.160) [-736.320] * [-738.799] (-739.490) (-738.218) (-738.177) -- 0:00:46
164000 -- (-737.124) (-737.520) [-737.177] (-739.195) * (-737.567) (-743.585) [-737.262] (-737.961) -- 0:00:45
164500 -- (-741.301) [-735.767] (-737.246) (-738.920) * (-737.012) (-738.024) [-741.325] (-742.750) -- 0:00:45
165000 -- (-736.020) (-741.719) [-737.325] (-735.977) * (-736.149) (-736.497) [-740.171] (-739.134) -- 0:00:50
Average standard deviation of split frequencies: 0.014199
165500 -- (-736.662) (-737.859) (-742.840) [-739.156] * (-742.008) (-736.430) (-742.229) [-738.235] -- 0:00:50
166000 -- (-744.759) [-737.395] (-740.236) (-738.935) * (-737.572) (-737.993) [-737.804] (-739.478) -- 0:00:50
166500 -- (-740.347) [-739.498] (-739.609) (-739.472) * (-736.782) (-741.434) [-736.610] (-736.997) -- 0:00:50
167000 -- (-740.271) [-739.869] (-740.167) (-736.723) * [-739.050] (-738.700) (-736.613) (-738.203) -- 0:00:49
167500 -- [-738.920] (-737.762) (-738.082) (-739.809) * [-741.086] (-738.843) (-738.364) (-739.653) -- 0:00:49
168000 -- (-741.324) [-737.998] (-736.752) (-737.912) * (-743.340) (-740.044) (-738.938) [-738.381] -- 0:00:49
168500 -- [-741.902] (-740.009) (-738.861) (-737.541) * [-738.326] (-737.043) (-741.468) (-739.502) -- 0:00:49
169000 -- [-737.474] (-738.608) (-739.510) (-736.774) * (-737.044) (-742.110) (-739.470) [-737.491] -- 0:00:49
169500 -- [-738.712] (-740.385) (-735.793) (-737.245) * (-739.308) [-737.686] (-738.807) (-736.522) -- 0:00:48
170000 -- (-737.872) (-740.094) [-737.364] (-738.396) * (-741.635) [-737.355] (-739.606) (-736.425) -- 0:00:48
Average standard deviation of split frequencies: 0.017590
170500 -- (-738.589) [-738.420] (-736.676) (-738.593) * (-740.330) (-739.004) [-736.629] (-736.860) -- 0:00:48
171000 -- (-737.979) (-737.550) [-737.423] (-736.686) * (-736.704) (-737.275) [-739.988] (-738.130) -- 0:00:48
171500 -- (-737.830) (-738.530) (-739.579) [-736.926] * (-736.880) [-738.809] (-738.198) (-737.984) -- 0:00:48
172000 -- (-738.631) (-736.438) (-743.396) [-744.916] * [-736.788] (-737.889) (-739.830) (-738.686) -- 0:00:48
172500 -- (-738.040) [-736.178] (-739.305) (-737.073) * (-737.611) (-742.446) [-742.044] (-743.415) -- 0:00:47
173000 -- [-737.832] (-736.418) (-736.876) (-737.858) * [-735.833] (-739.518) (-735.813) (-739.051) -- 0:00:47
173500 -- [-739.755] (-737.163) (-736.353) (-737.970) * (-737.165) [-737.538] (-736.995) (-738.624) -- 0:00:47
174000 -- (-738.716) [-738.011] (-738.338) (-738.256) * (-737.184) [-737.646] (-736.906) (-736.639) -- 0:00:47
174500 -- (-737.895) [-736.794] (-737.229) (-738.769) * (-740.120) (-736.870) [-736.241] (-737.326) -- 0:00:47
175000 -- (-737.439) (-736.497) [-739.707] (-739.074) * [-740.756] (-738.101) (-736.421) (-735.922) -- 0:00:47
Average standard deviation of split frequencies: 0.016071
175500 -- (-741.254) (-737.981) [-735.851] (-736.387) * [-738.048] (-739.490) (-737.788) (-736.944) -- 0:00:46
176000 -- [-739.085] (-737.594) (-736.212) (-740.251) * (-736.476) [-739.365] (-737.237) (-740.583) -- 0:00:46
176500 -- (-737.843) (-738.403) [-737.241] (-738.147) * (-737.448) [-737.097] (-737.079) (-739.132) -- 0:00:46
177000 -- [-738.912] (-738.744) (-739.113) (-738.052) * (-737.131) (-739.678) (-737.034) [-737.558] -- 0:00:46
177500 -- (-742.158) (-739.213) (-738.567) [-735.961] * (-746.580) (-736.362) [-738.717] (-738.929) -- 0:00:46
178000 -- [-742.138] (-740.134) (-740.406) (-741.457) * (-739.942) [-736.509] (-736.093) (-737.046) -- 0:00:46
178500 -- (-737.984) [-740.931] (-739.125) (-736.556) * [-739.791] (-735.746) (-739.263) (-744.187) -- 0:00:46
179000 -- (-737.990) (-736.444) [-736.829] (-737.536) * [-737.150] (-736.669) (-735.938) (-741.404) -- 0:00:45
179500 -- (-739.199) [-737.695] (-741.525) (-738.509) * [-736.508] (-736.170) (-737.721) (-738.200) -- 0:00:45
180000 -- (-744.036) [-736.855] (-740.732) (-736.440) * (-736.229) [-739.584] (-736.478) (-738.451) -- 0:00:45
Average standard deviation of split frequencies: 0.013870
180500 -- [-739.711] (-737.383) (-735.631) (-736.688) * (-736.068) (-738.701) [-736.801] (-736.938) -- 0:00:45
181000 -- (-739.371) (-738.033) [-737.432] (-739.186) * (-737.415) (-737.273) [-737.337] (-735.952) -- 0:00:45
181500 -- (-739.250) (-738.014) [-739.153] (-738.108) * [-740.541] (-738.939) (-736.457) (-737.073) -- 0:00:49
182000 -- (-746.720) (-736.394) [-738.812] (-737.699) * (-738.244) (-739.688) [-740.210] (-736.617) -- 0:00:49
182500 -- (-747.018) (-737.422) [-737.593] (-740.091) * (-736.680) (-741.398) (-739.169) [-736.455] -- 0:00:49
183000 -- (-744.328) [-738.847] (-738.527) (-738.573) * (-739.149) (-738.437) (-738.112) [-737.247] -- 0:00:49
183500 -- (-740.956) [-738.880] (-737.976) (-737.198) * (-739.011) (-738.990) [-741.507] (-737.088) -- 0:00:48
184000 -- (-741.205) [-736.815] (-738.676) (-736.741) * (-739.885) (-736.344) (-737.159) [-739.077] -- 0:00:48
184500 -- (-738.492) (-736.862) (-738.147) [-737.740] * (-738.577) (-737.355) [-736.985] (-739.118) -- 0:00:48
185000 -- (-741.921) (-737.929) [-737.573] (-737.758) * (-736.165) [-737.465] (-739.069) (-736.818) -- 0:00:48
Average standard deviation of split frequencies: 0.013559
185500 -- (-737.890) (-737.389) (-736.295) [-739.821] * [-736.228] (-739.448) (-737.998) (-735.911) -- 0:00:48
186000 -- (-737.564) (-737.430) (-736.597) [-738.665] * (-738.864) (-740.006) [-740.158] (-735.791) -- 0:00:48
186500 -- [-736.360] (-737.531) (-735.745) (-738.889) * [-736.308] (-738.451) (-737.130) (-736.435) -- 0:00:47
187000 -- (-736.174) (-737.598) (-737.861) [-740.438] * (-737.831) (-741.700) (-738.576) [-737.345] -- 0:00:47
187500 -- (-737.982) (-737.133) (-740.422) [-741.560] * (-737.772) (-739.389) (-737.539) [-736.917] -- 0:00:47
188000 -- (-736.852) (-739.742) (-739.820) [-738.097] * [-737.650] (-738.809) (-738.381) (-736.138) -- 0:00:47
188500 -- [-736.320] (-739.474) (-737.149) (-740.012) * (-735.843) (-738.234) [-736.599] (-736.721) -- 0:00:47
189000 -- (-738.728) [-736.482] (-736.316) (-737.257) * (-736.666) (-740.001) (-736.907) [-736.517] -- 0:00:47
189500 -- (-738.693) (-736.689) [-735.868] (-736.431) * (-740.483) (-737.992) [-737.307] (-737.310) -- 0:00:47
190000 -- (-738.514) (-739.529) [-738.409] (-738.693) * (-738.988) (-736.164) (-739.995) [-740.000] -- 0:00:46
Average standard deviation of split frequencies: 0.012232
190500 -- (-741.117) (-737.866) (-739.282) [-740.823] * (-737.630) (-735.607) [-737.159] (-742.827) -- 0:00:46
191000 -- [-739.326] (-747.427) (-739.106) (-739.582) * [-737.094] (-737.716) (-736.637) (-739.941) -- 0:00:46
191500 -- (-742.882) [-740.582] (-740.300) (-741.851) * (-737.260) [-736.985] (-736.756) (-738.521) -- 0:00:46
192000 -- [-737.724] (-739.633) (-737.290) (-736.964) * [-736.094] (-736.319) (-736.883) (-737.018) -- 0:00:46
192500 -- (-736.188) [-738.615] (-736.579) (-737.053) * [-738.794] (-736.497) (-735.834) (-741.263) -- 0:00:46
193000 -- (-737.607) (-737.685) (-737.981) [-735.642] * (-737.329) (-736.822) [-739.419] (-742.062) -- 0:00:45
193500 -- (-739.322) (-741.241) [-738.578] (-735.845) * (-737.501) [-740.242] (-740.320) (-739.402) -- 0:00:45
194000 -- (-739.523) [-738.437] (-737.985) (-736.104) * (-735.560) (-740.280) [-736.203] (-740.875) -- 0:00:45
194500 -- (-739.340) [-738.659] (-738.096) (-738.397) * (-738.332) (-738.663) [-743.594] (-737.916) -- 0:00:45
195000 -- (-738.400) (-738.565) [-736.430] (-737.625) * [-735.723] (-738.691) (-738.872) (-740.426) -- 0:00:45
Average standard deviation of split frequencies: 0.014431
195500 -- [-737.883] (-740.738) (-737.773) (-737.194) * (-736.861) [-737.884] (-738.541) (-737.826) -- 0:00:45
196000 -- [-737.992] (-748.840) (-740.611) (-740.767) * (-740.023) (-737.914) [-738.111] (-736.895) -- 0:00:45
196500 -- (-737.458) (-737.396) (-736.857) [-741.101] * (-739.560) [-736.853] (-736.170) (-738.057) -- 0:00:44
197000 -- (-736.182) (-739.386) (-736.186) [-736.404] * [-740.977] (-738.133) (-736.285) (-741.931) -- 0:00:44
197500 -- (-737.480) [-739.274] (-735.865) (-736.488) * (-740.377) (-740.741) (-738.563) [-736.884] -- 0:00:44
198000 -- (-738.098) [-736.417] (-737.342) (-737.221) * [-736.236] (-739.485) (-739.195) (-738.121) -- 0:00:48
198500 -- (-737.686) (-737.988) (-737.153) [-737.259] * [-736.084] (-737.858) (-742.524) (-737.272) -- 0:00:48
199000 -- [-738.197] (-737.585) (-737.545) (-743.372) * (-735.744) (-738.226) (-738.836) [-738.046] -- 0:00:48
199500 -- (-737.078) (-738.894) [-736.527] (-737.552) * (-737.006) [-739.752] (-737.234) (-736.245) -- 0:00:48
200000 -- (-737.716) (-740.005) [-735.874] (-741.043) * (-736.002) [-739.738] (-736.622) (-735.994) -- 0:00:48
Average standard deviation of split frequencies: 0.017063
200500 -- (-737.908) (-736.851) [-738.908] (-738.768) * [-740.126] (-739.371) (-736.222) (-735.945) -- 0:00:47
201000 -- [-736.396] (-736.493) (-737.170) (-736.494) * (-740.395) (-739.365) (-736.107) [-738.116] -- 0:00:47
201500 -- [-736.732] (-737.537) (-737.053) (-739.107) * (-738.908) (-739.516) (-737.706) [-737.374] -- 0:00:47
202000 -- (-736.255) [-736.976] (-742.526) (-738.491) * (-736.578) (-737.377) [-736.916] (-739.756) -- 0:00:47
202500 -- (-737.441) (-736.140) (-737.896) [-738.790] * (-737.551) (-736.727) (-738.841) [-738.344] -- 0:00:47
203000 -- (-739.130) (-737.172) [-739.398] (-741.658) * (-737.076) (-735.949) (-738.828) [-738.587] -- 0:00:47
203500 -- (-740.278) (-738.909) [-740.420] (-741.196) * [-736.516] (-738.986) (-739.077) (-737.821) -- 0:00:46
204000 -- [-741.140] (-737.789) (-738.866) (-736.157) * (-738.512) [-739.427] (-738.808) (-737.998) -- 0:00:46
204500 -- (-739.200) [-735.945] (-738.345) (-736.757) * (-739.616) (-736.877) (-739.716) [-742.746] -- 0:00:46
205000 -- (-736.083) [-736.051] (-737.268) (-738.016) * [-744.590] (-740.171) (-738.451) (-738.214) -- 0:00:46
Average standard deviation of split frequencies: 0.016139
205500 -- (-737.780) (-738.767) [-739.097] (-737.128) * (-740.526) [-739.751] (-736.577) (-737.029) -- 0:00:46
206000 -- [-738.583] (-740.835) (-735.886) (-736.765) * (-740.492) (-736.228) (-736.332) [-737.284] -- 0:00:46
206500 -- (-737.805) (-738.306) (-739.814) [-742.982] * (-740.367) (-737.352) (-736.509) [-736.609] -- 0:00:46
207000 -- (-737.592) (-739.022) [-740.432] (-739.448) * (-740.359) (-737.387) (-736.385) [-737.796] -- 0:00:45
207500 -- (-737.355) [-740.187] (-736.208) (-741.465) * (-739.488) (-736.468) (-736.639) [-737.010] -- 0:00:45
208000 -- [-736.189] (-736.090) (-740.572) (-736.494) * (-738.751) (-741.371) (-737.488) [-737.962] -- 0:00:45
208500 -- (-738.561) (-737.515) (-742.492) [-735.936] * [-737.482] (-738.617) (-736.245) (-738.677) -- 0:00:45
209000 -- (-740.582) (-739.196) (-736.872) [-737.693] * (-737.552) (-736.358) (-736.762) [-738.025] -- 0:00:45
209500 -- (-737.389) (-738.416) (-736.486) [-740.180] * [-737.618] (-737.979) (-738.723) (-737.988) -- 0:00:45
210000 -- (-739.680) (-742.287) (-737.244) [-738.749] * [-737.466] (-741.288) (-740.604) (-740.474) -- 0:00:45
Average standard deviation of split frequencies: 0.014722
210500 -- [-738.814] (-738.457) (-737.401) (-737.577) * (-737.775) [-737.470] (-736.196) (-738.167) -- 0:00:45
211000 -- (-738.188) (-736.835) (-737.954) [-737.637] * (-739.779) (-741.916) [-742.370] (-741.779) -- 0:00:44
211500 -- (-739.409) (-739.863) (-737.727) [-736.008] * (-738.120) (-737.115) [-737.072] (-738.644) -- 0:00:44
212000 -- [-739.838] (-737.927) (-737.079) (-737.411) * (-736.382) [-737.520] (-736.649) (-744.031) -- 0:00:44
212500 -- (-736.503) [-738.957] (-739.148) (-739.239) * (-736.925) (-737.585) [-736.929] (-738.603) -- 0:00:44
213000 -- (-739.493) [-738.565] (-736.532) (-740.157) * (-737.653) [-740.266] (-738.346) (-737.064) -- 0:00:44
213500 -- (-738.972) [-736.813] (-736.663) (-741.531) * (-737.479) (-739.043) (-737.636) [-735.730] -- 0:00:44
214000 -- (-738.254) (-739.604) [-735.811] (-740.056) * (-736.491) (-738.924) [-738.017] (-739.479) -- 0:00:44
214500 -- (-738.151) (-736.265) (-735.931) [-737.919] * (-736.502) [-737.965] (-737.689) (-738.065) -- 0:00:47
215000 -- (-738.328) (-738.444) (-738.106) [-737.752] * (-736.646) (-738.792) (-740.759) [-736.152] -- 0:00:47
Average standard deviation of split frequencies: 0.013439
215500 -- (-742.244) (-736.484) (-739.212) [-737.239] * [-739.175] (-736.268) (-737.279) (-736.111) -- 0:00:47
216000 -- (-741.215) (-739.187) [-737.234] (-738.694) * (-737.184) [-736.540] (-739.069) (-736.858) -- 0:00:47
216500 -- (-737.342) (-738.666) (-741.460) [-736.163] * (-737.183) (-738.290) [-736.581] (-737.489) -- 0:00:47
217000 -- (-738.766) [-738.065] (-740.853) (-737.711) * (-738.962) (-736.725) (-740.455) [-739.127] -- 0:00:46
217500 -- (-740.112) [-739.005] (-740.176) (-740.853) * (-737.529) (-736.135) [-738.293] (-738.566) -- 0:00:46
218000 -- (-739.005) [-739.171] (-737.645) (-736.797) * (-741.612) (-737.820) (-737.604) [-739.029] -- 0:00:46
218500 -- (-744.747) (-736.217) [-735.869] (-736.596) * (-737.080) (-741.703) [-737.764] (-740.388) -- 0:00:46
219000 -- (-737.852) [-736.943] (-737.386) (-738.225) * (-736.825) (-740.756) [-738.478] (-738.530) -- 0:00:46
219500 -- (-737.360) [-742.513] (-740.308) (-737.176) * [-737.068] (-739.080) (-738.430) (-737.079) -- 0:00:46
220000 -- (-739.578) [-737.564] (-742.650) (-738.967) * (-735.700) (-737.335) [-736.976] (-736.421) -- 0:00:46
Average standard deviation of split frequencies: 0.013492
220500 -- [-736.987] (-737.707) (-737.960) (-737.559) * (-737.903) (-736.085) (-739.260) [-737.928] -- 0:00:45
221000 -- [-736.931] (-739.271) (-736.526) (-736.857) * [-736.153] (-736.862) (-737.358) (-738.980) -- 0:00:45
221500 -- (-739.045) (-740.316) [-736.051] (-739.143) * (-739.093) (-737.518) (-741.453) [-738.281] -- 0:00:45
222000 -- (-742.418) (-736.657) [-737.185] (-737.162) * (-738.082) (-738.681) [-739.386] (-741.385) -- 0:00:45
222500 -- (-737.996) (-738.189) (-737.044) [-740.203] * (-738.795) (-738.677) (-740.392) [-736.664] -- 0:00:45
223000 -- (-737.758) (-741.144) [-738.208] (-738.683) * (-739.520) (-736.972) [-741.362] (-740.143) -- 0:00:45
223500 -- [-737.025] (-740.526) (-737.087) (-737.493) * (-740.279) (-737.286) [-739.162] (-740.159) -- 0:00:45
224000 -- (-735.943) (-738.766) [-738.218] (-738.814) * [-738.784] (-738.778) (-747.993) (-739.086) -- 0:00:45
224500 -- (-744.489) [-736.845] (-739.123) (-740.586) * (-737.767) (-739.517) (-740.454) [-737.381] -- 0:00:44
225000 -- (-739.111) [-737.594] (-737.828) (-737.604) * [-738.613] (-738.245) (-737.447) (-738.681) -- 0:00:44
Average standard deviation of split frequencies: 0.014381
225500 -- (-747.852) (-736.979) [-736.207] (-736.877) * [-737.936] (-737.820) (-738.165) (-739.351) -- 0:00:44
226000 -- (-741.349) (-738.134) (-744.034) [-739.481] * (-739.778) (-739.590) (-737.443) [-739.187] -- 0:00:44
226500 -- (-740.525) (-739.208) (-738.895) [-740.446] * (-737.450) [-737.424] (-737.634) (-739.867) -- 0:00:44
227000 -- (-738.151) [-738.468] (-739.590) (-735.693) * (-736.966) (-736.980) (-736.656) [-740.913] -- 0:00:44
227500 -- [-739.412] (-738.484) (-738.548) (-741.016) * [-738.200] (-738.139) (-739.332) (-737.652) -- 0:00:44
228000 -- [-737.937] (-736.467) (-738.537) (-739.655) * (-737.071) (-737.477) [-737.382] (-739.334) -- 0:00:44
228500 -- (-741.555) (-736.769) [-739.281] (-737.444) * (-736.227) (-735.894) (-739.947) [-736.983] -- 0:00:43
229000 -- (-746.798) (-737.141) [-736.001] (-737.244) * (-735.909) (-738.641) (-738.456) [-736.971] -- 0:00:43
229500 -- (-740.599) [-736.008] (-736.416) (-737.834) * [-741.115] (-737.400) (-741.572) (-735.685) -- 0:00:43
230000 -- (-738.244) (-736.340) [-736.413] (-739.025) * (-738.248) (-736.120) [-737.682] (-737.951) -- 0:00:43
Average standard deviation of split frequencies: 0.014951
230500 -- (-738.241) (-737.487) [-738.131] (-738.305) * [-743.334] (-736.284) (-739.594) (-736.988) -- 0:00:43
231000 -- (-737.705) (-739.453) [-736.086] (-737.847) * [-735.843] (-737.635) (-740.386) (-739.973) -- 0:00:43
231500 -- (-737.321) [-739.050] (-735.958) (-736.491) * (-738.046) (-736.627) [-737.628] (-737.261) -- 0:00:46
232000 -- [-737.024] (-739.688) (-737.071) (-736.565) * (-736.608) (-736.789) [-739.745] (-737.076) -- 0:00:46
232500 -- (-736.205) [-738.606] (-735.968) (-738.158) * (-738.099) (-735.574) [-736.742] (-737.264) -- 0:00:46
233000 -- (-737.107) (-735.844) (-743.213) [-736.998] * (-738.115) (-736.339) (-735.945) [-737.054] -- 0:00:46
233500 -- (-739.261) [-735.895] (-742.357) (-737.515) * (-736.311) (-738.435) (-738.636) [-737.787] -- 0:00:45
234000 -- (-737.974) (-741.650) (-736.765) [-739.636] * (-736.810) (-737.630) [-737.524] (-736.446) -- 0:00:45
234500 -- (-739.489) (-741.568) (-738.641) [-737.464] * (-735.737) (-738.318) [-736.110] (-739.112) -- 0:00:45
235000 -- (-736.240) (-740.664) (-741.024) [-739.887] * (-737.495) [-736.674] (-743.738) (-738.167) -- 0:00:45
Average standard deviation of split frequencies: 0.015203
235500 -- (-735.886) (-737.403) [-736.932] (-739.983) * [-737.471] (-737.802) (-736.637) (-736.756) -- 0:00:45
236000 -- (-737.263) [-737.336] (-736.714) (-737.764) * (-736.954) (-740.729) (-740.255) [-738.452] -- 0:00:45
236500 -- (-737.736) (-740.806) [-738.432] (-736.793) * [-736.044] (-740.524) (-737.578) (-740.820) -- 0:00:45
237000 -- [-736.178] (-738.855) (-744.382) (-736.327) * (-737.994) (-737.851) (-738.993) [-737.067] -- 0:00:45
237500 -- (-738.045) (-737.869) (-739.170) [-739.755] * (-739.822) (-741.267) [-736.037] (-737.714) -- 0:00:44
238000 -- (-737.091) (-739.622) (-738.744) [-740.250] * (-736.813) (-742.684) [-736.467] (-737.148) -- 0:00:44
238500 -- (-736.739) (-737.756) [-736.896] (-740.441) * (-738.141) (-739.890) (-736.321) [-736.431] -- 0:00:44
239000 -- (-738.380) (-738.703) [-736.757] (-736.117) * [-737.154] (-737.114) (-736.108) (-736.817) -- 0:00:44
239500 -- (-736.776) (-736.978) [-739.440] (-740.526) * (-739.778) [-736.574] (-736.114) (-736.118) -- 0:00:44
240000 -- [-735.950] (-739.282) (-737.856) (-738.222) * (-738.385) [-737.765] (-738.251) (-740.131) -- 0:00:44
Average standard deviation of split frequencies: 0.014433
240500 -- (-736.292) (-740.046) [-736.141] (-737.817) * (-738.070) [-739.057] (-736.833) (-741.688) -- 0:00:44
241000 -- (-741.106) [-736.752] (-735.494) (-737.929) * (-743.873) (-737.555) [-736.303] (-744.182) -- 0:00:44
241500 -- (-741.275) (-736.400) [-737.168] (-737.356) * [-738.561] (-738.876) (-736.535) (-739.594) -- 0:00:43
242000 -- (-747.368) [-735.519] (-736.894) (-736.718) * [-738.762] (-739.234) (-736.557) (-746.282) -- 0:00:43
242500 -- (-737.260) (-737.683) [-739.677] (-738.349) * (-736.942) [-738.621] (-736.141) (-738.408) -- 0:00:43
243000 -- (-743.017) (-736.591) (-740.469) [-738.926] * (-736.107) (-738.662) (-735.871) [-737.397] -- 0:00:43
243500 -- (-739.749) (-739.506) [-737.288] (-739.056) * (-736.038) (-740.149) [-735.796] (-735.987) -- 0:00:43
244000 -- (-738.416) [-738.025] (-739.418) (-738.250) * (-736.216) (-738.627) (-739.075) [-736.205] -- 0:00:43
244500 -- (-739.978) (-738.573) (-739.880) [-737.689] * (-739.231) [-738.493] (-738.140) (-738.016) -- 0:00:43
245000 -- (-738.597) [-738.410] (-737.271) (-737.779) * (-737.518) (-738.057) (-737.573) [-737.998] -- 0:00:43
Average standard deviation of split frequencies: 0.013918
245500 -- (-741.039) (-736.795) (-737.605) [-740.562] * (-737.197) (-737.749) (-738.353) [-738.588] -- 0:00:43
246000 -- [-738.238] (-735.949) (-738.097) (-739.324) * [-738.962] (-736.264) (-741.562) (-738.806) -- 0:00:42
246500 -- (-736.815) (-743.248) (-739.323) [-737.207] * (-743.017) [-736.248] (-739.072) (-739.510) -- 0:00:42
247000 -- (-737.317) [-738.970] (-738.405) (-737.106) * (-744.906) (-737.097) [-738.055] (-736.198) -- 0:00:42
247500 -- (-737.709) (-740.262) (-737.999) [-737.016] * [-738.023] (-736.321) (-738.683) (-738.612) -- 0:00:45
248000 -- (-737.829) [-737.182] (-741.306) (-736.341) * (-736.963) [-736.562] (-738.606) (-739.536) -- 0:00:45
248500 -- (-736.762) (-738.574) [-736.613] (-737.505) * (-736.738) (-736.589) [-739.723] (-737.954) -- 0:00:45
249000 -- (-737.951) (-738.387) [-736.435] (-741.684) * (-737.652) (-741.863) (-738.323) [-737.905] -- 0:00:45
249500 -- (-736.369) (-736.478) (-739.094) [-737.346] * (-739.389) [-739.637] (-738.839) (-738.174) -- 0:00:45
250000 -- [-737.505] (-736.210) (-739.007) (-736.847) * [-737.111] (-740.097) (-741.574) (-737.226) -- 0:00:45
Average standard deviation of split frequencies: 0.013758
250500 -- [-739.665] (-736.907) (-738.902) (-738.107) * (-736.998) (-735.604) (-737.977) [-736.806] -- 0:00:44
251000 -- (-737.971) [-737.581] (-740.300) (-738.717) * (-738.585) (-740.039) (-741.596) [-736.087] -- 0:00:44
251500 -- (-740.414) [-739.100] (-738.777) (-737.396) * (-741.888) [-737.740] (-743.104) (-737.442) -- 0:00:44
252000 -- (-742.758) (-739.293) [-738.683] (-739.060) * (-738.175) (-738.405) [-738.298] (-736.535) -- 0:00:44
252500 -- [-736.749] (-738.480) (-739.292) (-739.768) * [-735.654] (-740.196) (-738.118) (-738.309) -- 0:00:44
253000 -- [-736.493] (-738.654) (-738.821) (-741.092) * (-738.079) [-736.355] (-740.147) (-742.601) -- 0:00:44
253500 -- [-737.633] (-742.168) (-738.762) (-737.377) * [-739.793] (-736.905) (-744.013) (-738.650) -- 0:00:44
254000 -- (-742.914) (-739.382) (-737.377) [-739.708] * (-739.966) (-743.417) (-739.071) [-742.439] -- 0:00:44
254500 -- (-741.002) (-741.793) (-736.387) [-737.971] * (-738.663) [-738.412] (-736.341) (-739.607) -- 0:00:43
255000 -- (-738.938) (-742.191) (-736.376) [-740.689] * (-738.320) [-737.544] (-737.243) (-739.087) -- 0:00:43
Average standard deviation of split frequencies: 0.014828
255500 -- (-738.540) (-739.195) [-737.956] (-738.066) * (-736.601) (-739.186) [-738.014] (-737.200) -- 0:00:43
256000 -- (-738.036) [-737.628] (-737.460) (-736.618) * (-741.039) (-737.246) [-739.898] (-737.773) -- 0:00:43
256500 -- (-736.756) (-739.063) [-738.444] (-736.051) * (-739.277) (-737.494) (-745.504) [-737.502] -- 0:00:43
257000 -- (-736.697) (-737.404) (-737.891) [-736.493] * (-737.358) (-736.690) (-740.654) [-737.091] -- 0:00:43
257500 -- (-739.175) (-739.067) (-738.832) [-738.857] * (-739.918) [-738.452] (-742.428) (-737.504) -- 0:00:43
258000 -- (-740.306) (-737.759) [-736.572] (-736.371) * (-736.311) [-738.563] (-740.715) (-740.160) -- 0:00:43
258500 -- [-743.595] (-738.064) (-738.530) (-736.763) * [-736.425] (-736.979) (-738.605) (-741.048) -- 0:00:43
259000 -- (-738.799) [-737.688] (-736.502) (-738.215) * (-736.571) (-740.347) [-737.317] (-740.831) -- 0:00:42
259500 -- (-737.252) (-738.703) [-739.147] (-738.595) * [-737.926] (-740.731) (-738.809) (-740.917) -- 0:00:42
260000 -- (-737.446) (-738.845) [-735.982] (-739.978) * [-738.345] (-742.564) (-740.282) (-745.894) -- 0:00:42
Average standard deviation of split frequencies: 0.015271
260500 -- (-739.935) [-740.931] (-735.976) (-738.832) * [-737.746] (-739.900) (-738.097) (-737.619) -- 0:00:42
261000 -- (-735.948) (-744.583) [-737.093] (-739.180) * (-737.650) [-736.137] (-736.447) (-738.911) -- 0:00:42
261500 -- (-742.799) (-739.233) [-737.391] (-738.861) * [-736.352] (-737.006) (-739.806) (-738.167) -- 0:00:42
262000 -- (-738.492) (-738.007) [-740.682] (-739.655) * [-738.746] (-740.166) (-740.316) (-739.448) -- 0:00:42
262500 -- (-739.799) (-737.504) [-740.858] (-740.413) * (-738.416) (-738.102) (-739.226) [-739.888] -- 0:00:44
263000 -- (-736.209) (-737.428) [-736.667] (-739.089) * (-737.804) (-742.958) [-736.772] (-738.793) -- 0:00:44
263500 -- (-739.733) [-736.010] (-736.147) (-741.505) * [-737.891] (-740.912) (-737.483) (-741.796) -- 0:00:44
264000 -- (-737.192) [-735.819] (-739.279) (-738.832) * (-736.849) (-736.832) [-737.314] (-738.718) -- 0:00:44
264500 -- (-738.520) [-738.590] (-737.192) (-739.352) * (-737.658) (-738.559) [-742.185] (-737.370) -- 0:00:44
265000 -- (-739.047) (-740.007) (-736.276) [-737.894] * (-737.696) [-737.826] (-736.662) (-736.179) -- 0:00:44
Average standard deviation of split frequencies: 0.015950
265500 -- [-737.692] (-739.602) (-737.351) (-738.975) * (-739.423) [-740.032] (-736.745) (-739.277) -- 0:00:44
266000 -- (-738.086) (-736.440) (-741.793) [-738.845] * (-741.713) (-736.730) (-736.357) [-736.808] -- 0:00:44
266500 -- [-737.513] (-738.908) (-737.642) (-738.630) * (-737.325) [-738.038] (-737.452) (-737.149) -- 0:00:44
267000 -- [-741.423] (-736.935) (-738.586) (-741.167) * (-738.040) (-736.296) [-740.017] (-736.622) -- 0:00:43
267500 -- [-740.110] (-737.461) (-738.042) (-738.804) * (-738.285) (-738.547) [-738.099] (-737.762) -- 0:00:43
268000 -- (-740.621) (-736.519) (-737.122) [-736.558] * (-738.502) [-739.919] (-738.065) (-745.217) -- 0:00:43
268500 -- [-738.789] (-736.498) (-740.895) (-741.528) * (-744.200) [-737.347] (-737.132) (-739.736) -- 0:00:43
269000 -- [-737.119] (-738.475) (-737.578) (-741.612) * (-739.357) [-737.127] (-735.806) (-742.843) -- 0:00:43
269500 -- [-738.132] (-742.045) (-739.261) (-737.058) * (-736.650) (-735.572) [-737.182] (-737.488) -- 0:00:43
270000 -- (-739.693) (-739.762) (-738.775) [-738.912] * [-737.297] (-739.218) (-738.580) (-736.455) -- 0:00:43
Average standard deviation of split frequencies: 0.017504
270500 -- [-738.786] (-740.508) (-740.621) (-738.098) * (-738.615) [-737.549] (-742.309) (-736.779) -- 0:00:43
271000 -- (-738.448) (-738.773) (-740.081) [-740.214] * (-740.353) (-737.787) (-739.602) [-737.456] -- 0:00:43
271500 -- [-736.196] (-746.980) (-740.127) (-737.439) * (-737.204) (-739.999) (-736.870) [-736.637] -- 0:00:42
272000 -- [-737.523] (-743.227) (-740.380) (-736.715) * (-736.391) [-735.812] (-736.929) (-736.261) -- 0:00:42
272500 -- (-738.265) (-741.494) (-739.286) [-736.135] * [-736.309] (-736.316) (-739.553) (-736.815) -- 0:00:42
273000 -- (-740.348) [-739.043] (-742.377) (-737.461) * (-741.226) [-735.982] (-738.386) (-739.638) -- 0:00:42
273500 -- (-738.270) [-737.810] (-739.490) (-737.621) * [-740.536] (-736.847) (-737.860) (-738.600) -- 0:00:42
274000 -- [-737.465] (-738.584) (-735.900) (-736.456) * (-739.224) (-736.311) (-736.764) [-741.563] -- 0:00:42
274500 -- (-736.205) (-739.038) (-737.755) [-737.840] * (-740.543) [-737.975] (-737.057) (-738.008) -- 0:00:42
275000 -- (-736.956) (-737.107) (-737.050) [-737.945] * (-735.761) (-737.097) (-736.757) [-736.919] -- 0:00:42
Average standard deviation of split frequencies: 0.018019
275500 -- [-736.970] (-736.233) (-738.195) (-738.660) * [-736.396] (-738.715) (-737.426) (-738.272) -- 0:00:42
276000 -- (-738.587) [-737.203] (-736.427) (-737.443) * [-737.808] (-737.666) (-738.240) (-740.688) -- 0:00:41
276500 -- [-736.886] (-737.177) (-741.458) (-738.269) * [-739.722] (-744.301) (-737.457) (-735.794) -- 0:00:41
277000 -- (-738.493) (-739.743) [-737.392] (-737.027) * [-740.874] (-736.802) (-737.334) (-736.955) -- 0:00:41
277500 -- (-735.870) (-739.091) (-739.830) [-738.870] * (-739.784) [-735.878] (-736.905) (-736.849) -- 0:00:41
278000 -- (-735.697) (-738.805) (-736.741) [-740.798] * (-738.326) (-736.957) [-738.869] (-739.292) -- 0:00:44
278500 -- [-739.615] (-739.981) (-737.367) (-736.251) * (-737.096) (-737.058) (-740.120) [-739.024] -- 0:00:44
279000 -- [-736.666] (-740.901) (-740.567) (-736.697) * (-736.049) (-737.309) (-736.039) [-736.834] -- 0:00:43
279500 -- [-739.525] (-736.921) (-737.855) (-739.883) * (-740.997) (-737.397) (-737.460) [-738.497] -- 0:00:43
280000 -- (-743.961) (-737.784) (-741.853) [-736.574] * (-738.822) (-735.875) (-737.337) [-739.849] -- 0:00:43
Average standard deviation of split frequencies: 0.016880
280500 -- [-740.161] (-742.120) (-741.083) (-739.422) * (-740.074) (-737.886) [-737.681] (-737.344) -- 0:00:43
281000 -- (-741.251) (-738.646) [-739.729] (-736.331) * (-739.764) (-738.804) [-736.496] (-739.942) -- 0:00:43
281500 -- [-737.255] (-738.036) (-738.239) (-736.692) * (-737.790) (-742.151) [-737.964] (-741.037) -- 0:00:43
282000 -- (-741.849) (-737.266) (-740.724) [-735.970] * (-738.135) [-738.294] (-737.139) (-740.763) -- 0:00:43
282500 -- (-737.414) (-737.470) [-736.711] (-736.513) * (-738.362) [-735.784] (-737.005) (-740.526) -- 0:00:43
283000 -- (-736.058) (-740.911) (-737.940) [-737.882] * [-736.860] (-737.334) (-736.836) (-737.754) -- 0:00:43
283500 -- (-737.377) (-737.874) [-736.408] (-741.998) * (-737.439) [-736.710] (-737.224) (-736.503) -- 0:00:42
284000 -- (-738.661) (-736.952) [-738.770] (-740.716) * (-736.046) [-736.201] (-743.866) (-736.548) -- 0:00:42
284500 -- (-741.814) (-737.414) (-738.193) [-737.192] * [-738.340] (-739.159) (-741.072) (-737.255) -- 0:00:42
285000 -- (-735.730) [-737.918] (-736.521) (-737.406) * [-736.656] (-739.234) (-737.765) (-737.707) -- 0:00:42
Average standard deviation of split frequencies: 0.016136
285500 -- [-736.281] (-741.759) (-738.845) (-737.786) * (-737.735) [-736.314] (-739.397) (-741.032) -- 0:00:42
286000 -- [-735.823] (-743.446) (-737.766) (-737.750) * (-737.038) (-738.577) [-738.233] (-738.661) -- 0:00:42
286500 -- (-736.990) [-740.015] (-737.902) (-737.788) * (-747.263) (-742.259) [-735.699] (-744.780) -- 0:00:42
287000 -- (-740.846) (-740.097) [-737.186] (-738.520) * (-747.532) (-745.093) [-739.024] (-735.779) -- 0:00:42
287500 -- (-738.085) [-737.921] (-737.298) (-736.562) * (-740.391) (-743.980) (-738.430) [-736.566] -- 0:00:42
288000 -- [-737.261] (-742.004) (-737.283) (-736.273) * [-736.996] (-737.130) (-737.813) (-736.772) -- 0:00:42
288500 -- (-740.558) (-737.889) [-738.623] (-736.150) * (-741.833) (-739.893) (-740.247) [-736.456] -- 0:00:41
289000 -- (-738.012) (-738.812) [-736.330] (-740.020) * (-740.010) (-738.906) [-737.967] (-736.918) -- 0:00:41
289500 -- (-737.438) (-741.034) [-737.178] (-739.814) * (-738.709) [-739.339] (-736.450) (-738.501) -- 0:00:41
290000 -- (-736.220) (-739.594) [-736.597] (-740.873) * (-738.318) (-736.423) (-741.462) [-738.638] -- 0:00:41
Average standard deviation of split frequencies: 0.016218
290500 -- (-739.004) (-739.323) (-739.775) [-738.203] * (-738.127) [-735.913] (-740.802) (-737.196) -- 0:00:41
291000 -- (-740.905) [-737.074] (-739.315) (-738.261) * (-739.158) [-736.925] (-737.230) (-739.625) -- 0:00:41
291500 -- (-738.679) (-736.877) [-740.701] (-736.154) * (-736.746) (-738.452) [-737.741] (-744.843) -- 0:00:41
292000 -- (-736.513) (-736.496) [-738.900] (-739.152) * (-739.987) (-739.588) [-739.841] (-742.095) -- 0:00:41
292500 -- (-736.506) (-736.660) (-738.843) [-736.480] * (-737.283) [-737.458] (-739.039) (-739.553) -- 0:00:41
293000 -- (-739.656) (-735.685) (-738.354) [-737.546] * (-740.310) (-736.679) (-735.902) [-738.717] -- 0:00:41
293500 -- [-737.217] (-736.113) (-746.585) (-735.861) * (-737.074) (-737.107) [-739.080] (-739.772) -- 0:00:43
294000 -- (-735.762) (-736.286) [-740.814] (-736.156) * (-739.929) [-736.946] (-740.153) (-737.138) -- 0:00:43
294500 -- (-735.754) (-736.134) (-741.869) [-738.485] * [-745.777] (-737.873) (-739.178) (-737.645) -- 0:00:43
295000 -- (-737.318) [-736.511] (-742.731) (-736.245) * [-739.156] (-738.012) (-737.406) (-738.236) -- 0:00:43
Average standard deviation of split frequencies: 0.015507
295500 -- [-737.848] (-737.732) (-736.050) (-736.156) * [-736.953] (-741.764) (-740.112) (-739.242) -- 0:00:42
296000 -- [-736.294] (-738.833) (-737.494) (-738.367) * (-735.962) (-739.370) (-736.577) [-738.607] -- 0:00:42
296500 -- [-741.923] (-738.366) (-739.115) (-736.945) * (-737.065) [-736.569] (-738.048) (-738.418) -- 0:00:42
297000 -- [-738.706] (-737.407) (-738.531) (-737.476) * (-736.933) [-736.485] (-739.698) (-738.883) -- 0:00:42
297500 -- (-737.513) (-738.970) [-737.173] (-737.543) * [-736.916] (-737.125) (-737.329) (-737.077) -- 0:00:42
298000 -- (-736.705) (-736.718) [-737.881] (-738.186) * (-738.287) (-740.097) [-738.716] (-736.103) -- 0:00:42
298500 -- [-740.460] (-738.948) (-738.085) (-737.328) * [-737.444] (-738.031) (-736.817) (-737.955) -- 0:00:42
299000 -- [-742.102] (-741.632) (-738.854) (-737.422) * (-737.759) [-739.458] (-738.700) (-740.136) -- 0:00:42
299500 -- (-737.467) (-738.830) [-735.911] (-739.056) * [-739.706] (-738.823) (-738.787) (-738.175) -- 0:00:42
300000 -- (-736.190) (-737.397) [-736.320] (-738.154) * (-744.744) (-737.512) (-737.201) [-737.389] -- 0:00:42
Average standard deviation of split frequencies: 0.014808
300500 -- (-736.865) (-740.698) (-735.696) [-737.570] * (-740.170) [-739.308] (-740.280) (-741.229) -- 0:00:41
301000 -- [-736.063] (-736.878) (-737.608) (-736.726) * [-737.427] (-742.456) (-737.764) (-740.303) -- 0:00:41
301500 -- (-742.962) [-738.256] (-737.232) (-736.178) * (-737.427) (-737.635) [-737.926] (-739.454) -- 0:00:41
302000 -- (-746.118) [-740.551] (-740.950) (-736.652) * (-736.557) (-738.068) [-737.043] (-739.777) -- 0:00:41
302500 -- (-739.425) [-736.544] (-735.877) (-737.750) * [-736.456] (-737.031) (-736.590) (-739.841) -- 0:00:41
303000 -- [-739.276] (-742.914) (-736.685) (-735.968) * [-737.994] (-738.960) (-736.818) (-739.842) -- 0:00:41
303500 -- (-741.105) [-737.932] (-736.726) (-736.442) * (-736.631) (-737.044) [-736.217] (-737.017) -- 0:00:41
304000 -- (-738.034) [-741.239] (-737.204) (-737.854) * (-737.687) (-738.683) (-737.842) [-739.128] -- 0:00:41
304500 -- (-736.485) [-741.750] (-736.604) (-737.659) * (-738.839) [-739.384] (-738.230) (-742.924) -- 0:00:41
305000 -- [-736.663] (-740.615) (-739.345) (-736.520) * (-737.132) (-738.765) [-740.154] (-740.238) -- 0:00:41
Average standard deviation of split frequencies: 0.015405
305500 -- (-737.042) (-741.861) [-743.556] (-736.631) * (-739.654) (-739.907) [-735.779] (-740.189) -- 0:00:40
306000 -- (-736.709) (-739.845) (-743.300) [-737.268] * (-738.004) (-742.574) [-743.666] (-736.415) -- 0:00:40
306500 -- (-740.042) (-737.038) [-735.776] (-738.079) * [-737.683] (-740.277) (-741.840) (-738.743) -- 0:00:40
307000 -- (-739.469) [-736.172] (-737.784) (-737.816) * (-738.925) [-740.651] (-738.934) (-738.830) -- 0:00:40
307500 -- (-738.689) (-736.847) (-735.878) [-739.708] * (-738.443) (-737.929) [-738.087] (-737.549) -- 0:00:40
308000 -- (-736.905) (-738.525) (-740.967) [-738.082] * (-738.216) [-737.693] (-737.676) (-736.139) -- 0:00:40
308500 -- (-736.595) (-741.265) [-738.096] (-739.233) * (-740.131) [-739.136] (-740.177) (-736.997) -- 0:00:40
309000 -- (-739.463) [-737.834] (-737.195) (-737.421) * (-737.458) [-736.736] (-738.611) (-736.624) -- 0:00:40
309500 -- (-741.159) (-739.396) (-741.725) [-737.638] * (-736.663) (-738.124) (-738.457) [-736.006] -- 0:00:40
310000 -- [-741.486] (-738.403) (-738.301) (-738.505) * (-737.205) [-739.385] (-738.982) (-739.436) -- 0:00:40
Average standard deviation of split frequencies: 0.014192
310500 -- (-741.297) (-743.633) [-738.171] (-737.490) * (-736.576) [-743.494] (-739.719) (-739.401) -- 0:00:42
311000 -- (-738.394) (-740.027) (-736.567) [-737.117] * (-741.391) (-738.801) [-736.779] (-740.420) -- 0:00:42
311500 -- (-738.571) (-740.800) (-745.187) [-736.912] * [-737.376] (-740.613) (-737.301) (-737.339) -- 0:00:41
312000 -- [-737.821] (-740.669) (-738.382) (-737.042) * (-737.287) [-738.801] (-736.104) (-740.385) -- 0:00:41
312500 -- (-737.745) (-737.448) (-738.123) [-737.730] * (-736.196) (-738.559) [-736.156] (-743.370) -- 0:00:41
313000 -- (-740.807) (-738.490) [-738.982] (-739.208) * (-735.788) (-737.215) (-737.397) [-737.377] -- 0:00:41
313500 -- (-739.756) [-737.786] (-737.822) (-740.940) * (-738.573) [-735.973] (-739.006) (-742.144) -- 0:00:41
314000 -- (-735.697) (-738.667) [-738.144] (-737.160) * (-736.955) (-738.959) (-741.255) [-737.099] -- 0:00:41
314500 -- [-738.946] (-740.336) (-737.830) (-739.924) * (-738.041) (-740.547) [-738.557] (-736.407) -- 0:00:41
315000 -- (-739.848) (-738.637) [-736.768] (-736.308) * (-736.534) [-736.771] (-735.824) (-736.372) -- 0:00:41
Average standard deviation of split frequencies: 0.014255
315500 -- (-741.333) (-738.670) [-735.909] (-737.922) * (-737.616) [-739.814] (-737.087) (-738.533) -- 0:00:41
316000 -- (-736.382) (-737.323) [-738.042] (-738.285) * [-736.886] (-736.947) (-741.111) (-737.028) -- 0:00:41
316500 -- (-743.704) (-738.794) [-736.657] (-735.969) * (-736.873) [-738.786] (-740.105) (-739.566) -- 0:00:41
317000 -- (-740.007) (-739.799) (-737.134) [-736.242] * (-739.417) (-736.542) [-738.693] (-741.219) -- 0:00:40
317500 -- (-740.519) [-740.333] (-746.275) (-737.716) * (-740.060) [-738.154] (-740.605) (-738.210) -- 0:00:40
318000 -- (-742.444) [-738.315] (-737.099) (-737.933) * [-740.459] (-736.911) (-739.778) (-737.624) -- 0:00:40
318500 -- [-740.306] (-738.316) (-738.364) (-737.287) * [-737.966] (-742.325) (-738.933) (-737.304) -- 0:00:40
319000 -- (-736.930) [-738.080] (-737.996) (-739.068) * (-736.919) (-739.395) (-742.622) [-736.533] -- 0:00:40
319500 -- (-736.293) (-740.577) (-736.583) [-738.541] * [-736.942] (-736.826) (-740.895) (-737.298) -- 0:00:40
320000 -- (-735.657) (-736.621) (-737.548) [-739.891] * (-736.732) [-737.020] (-739.320) (-740.948) -- 0:00:40
Average standard deviation of split frequencies: 0.014623
320500 -- [-737.154] (-739.150) (-736.986) (-740.065) * (-738.977) [-737.232] (-737.203) (-740.025) -- 0:00:40
321000 -- [-737.447] (-737.454) (-737.366) (-739.777) * (-738.012) (-737.482) (-737.357) [-737.656] -- 0:00:40
321500 -- [-736.816] (-737.236) (-738.080) (-740.751) * (-737.202) (-745.586) [-736.621] (-736.530) -- 0:00:40
322000 -- [-736.918] (-737.819) (-736.138) (-739.261) * (-738.885) [-737.398] (-739.636) (-737.563) -- 0:00:40
322500 -- [-736.830] (-737.516) (-736.923) (-737.464) * (-737.167) [-736.976] (-738.044) (-739.631) -- 0:00:39
323000 -- [-738.452] (-739.199) (-739.988) (-736.742) * [-737.824] (-741.262) (-739.967) (-742.284) -- 0:00:39
323500 -- [-736.128] (-738.032) (-737.307) (-738.334) * (-736.588) [-740.934] (-738.988) (-743.537) -- 0:00:39
324000 -- (-736.262) (-739.534) (-742.378) [-737.310] * (-736.101) [-739.215] (-740.165) (-737.927) -- 0:00:39
324500 -- (-735.897) [-739.559] (-738.814) (-747.025) * (-739.284) [-739.971] (-736.551) (-741.975) -- 0:00:39
325000 -- [-736.125] (-741.487) (-738.426) (-738.202) * (-739.015) (-738.875) [-739.892] (-740.917) -- 0:00:39
Average standard deviation of split frequencies: 0.014605
325500 -- (-736.155) (-739.497) [-737.421] (-739.761) * [-736.641] (-737.131) (-737.960) (-737.231) -- 0:00:39
326000 -- [-739.564] (-742.882) (-748.202) (-737.301) * (-736.560) (-740.392) (-737.725) [-737.503] -- 0:00:39
326500 -- (-738.139) [-735.806] (-742.063) (-738.749) * (-738.448) [-736.867] (-739.271) (-738.260) -- 0:00:39
327000 -- [-738.727] (-738.448) (-739.593) (-736.401) * (-737.122) (-741.085) (-738.136) [-736.021] -- 0:00:41
327500 -- (-737.839) (-738.852) (-736.719) [-736.866] * (-737.386) (-736.260) [-736.362] (-736.278) -- 0:00:41
328000 -- (-737.840) (-739.536) (-738.869) [-737.725] * [-736.180] (-737.586) (-737.264) (-737.631) -- 0:00:40
328500 -- (-740.277) (-737.485) [-738.625] (-738.813) * [-736.655] (-745.029) (-737.661) (-737.869) -- 0:00:40
329000 -- [-738.149] (-739.116) (-738.336) (-742.049) * (-737.936) [-743.341] (-741.591) (-737.583) -- 0:00:40
329500 -- (-737.323) (-740.335) [-735.724] (-736.451) * (-737.838) (-739.075) (-742.847) [-739.195] -- 0:00:40
330000 -- (-737.349) (-737.524) [-736.572] (-737.469) * [-738.843] (-738.548) (-742.451) (-739.105) -- 0:00:40
Average standard deviation of split frequencies: 0.014031
330500 -- (-738.021) [-739.014] (-735.475) (-737.005) * (-738.970) (-738.483) (-739.745) [-737.725] -- 0:00:40
331000 -- [-737.717] (-739.967) (-735.650) (-737.692) * (-740.183) [-739.700] (-737.840) (-737.886) -- 0:00:40
331500 -- (-739.938) (-745.827) (-736.582) [-736.619] * (-737.103) (-738.712) (-740.881) [-736.412] -- 0:00:40
332000 -- (-736.628) [-738.132] (-743.002) (-737.535) * (-739.307) (-738.486) [-740.109] (-741.926) -- 0:00:40
332500 -- (-741.768) (-740.903) (-737.080) [-739.564] * (-736.768) [-737.295] (-740.734) (-742.935) -- 0:00:40
333000 -- (-736.501) (-736.386) [-737.529] (-739.149) * (-736.439) [-738.130] (-736.915) (-742.590) -- 0:00:40
333500 -- (-736.829) [-737.092] (-736.989) (-736.947) * (-737.620) (-736.594) [-736.625] (-737.086) -- 0:00:39
334000 -- (-737.835) (-736.920) (-738.001) [-740.348] * (-737.795) [-736.744] (-736.765) (-736.165) -- 0:00:39
334500 -- [-736.433] (-737.166) (-739.954) (-738.032) * (-738.389) [-738.030] (-736.161) (-735.599) -- 0:00:39
335000 -- [-736.687] (-741.447) (-738.416) (-736.642) * (-738.349) (-737.164) [-735.482] (-740.419) -- 0:00:39
Average standard deviation of split frequencies: 0.014842
335500 -- (-740.273) (-737.881) (-737.430) [-738.051] * (-738.495) (-736.782) (-737.091) [-738.963] -- 0:00:39
336000 -- (-737.326) (-738.296) (-739.900) [-738.865] * (-741.508) [-737.226] (-737.093) (-740.066) -- 0:00:39
336500 -- [-739.819] (-736.267) (-736.806) (-737.602) * [-737.303] (-738.122) (-737.793) (-739.145) -- 0:00:39
337000 -- (-739.401) [-742.473] (-736.407) (-738.557) * [-741.754] (-738.751) (-736.581) (-739.890) -- 0:00:39
337500 -- (-736.040) [-737.525] (-735.963) (-739.158) * (-737.969) [-737.229] (-736.479) (-737.370) -- 0:00:39
338000 -- [-737.266] (-738.220) (-736.118) (-735.822) * (-741.219) (-739.670) [-737.477] (-739.353) -- 0:00:39
338500 -- (-736.816) (-737.508) [-740.500] (-739.552) * (-738.939) (-739.739) (-738.743) [-738.322] -- 0:00:39
339000 -- (-737.589) (-736.976) [-739.924] (-737.274) * (-736.162) [-739.982] (-743.301) (-736.427) -- 0:00:38
339500 -- [-736.777] (-740.430) (-740.202) (-736.722) * (-738.358) [-738.954] (-739.506) (-738.159) -- 0:00:38
340000 -- (-737.073) (-736.246) (-740.725) [-739.196] * (-738.361) (-737.571) [-737.700] (-736.875) -- 0:00:38
Average standard deviation of split frequencies: 0.014001
340500 -- (-738.040) (-739.537) [-738.017] (-740.481) * (-741.414) [-735.772] (-738.792) (-742.226) -- 0:00:38
341000 -- (-738.158) (-738.079) (-737.875) [-737.646] * (-741.477) (-736.656) [-738.545] (-737.302) -- 0:00:38
341500 -- [-736.117] (-738.555) (-737.447) (-746.542) * (-744.121) (-738.692) (-742.253) [-739.026] -- 0:00:38
342000 -- (-737.630) [-738.794] (-736.690) (-738.106) * (-742.862) [-737.866] (-739.685) (-737.832) -- 0:00:38
342500 -- (-736.394) [-740.168] (-737.109) (-737.951) * [-737.887] (-736.992) (-738.771) (-738.299) -- 0:00:38
343000 -- (-738.490) (-740.065) [-740.036] (-738.326) * (-737.616) (-737.238) (-739.033) [-738.299] -- 0:00:38
343500 -- (-735.925) [-736.825] (-736.677) (-739.125) * [-737.734] (-738.334) (-738.658) (-741.230) -- 0:00:40
344000 -- [-736.528] (-738.820) (-737.052) (-741.287) * [-736.292] (-742.897) (-737.541) (-736.627) -- 0:00:40
344500 -- [-742.094] (-735.600) (-740.038) (-739.885) * (-736.290) [-742.573] (-742.364) (-736.357) -- 0:00:39
345000 -- (-738.142) (-735.803) (-736.416) [-736.785] * (-737.201) (-739.562) [-739.259] (-737.117) -- 0:00:39
Average standard deviation of split frequencies: 0.014055
345500 -- (-737.304) [-737.336] (-737.529) (-735.917) * [-739.350] (-735.728) (-739.583) (-737.310) -- 0:00:39
346000 -- (-742.192) [-737.339] (-737.135) (-736.157) * (-740.337) [-736.493] (-739.841) (-737.369) -- 0:00:39
346500 -- (-736.471) [-737.161] (-740.070) (-737.027) * (-742.202) (-737.831) (-742.974) [-737.325] -- 0:00:39
347000 -- (-736.172) [-736.598] (-737.837) (-736.822) * (-741.002) (-737.386) (-739.628) [-739.162] -- 0:00:39
347500 -- [-735.790] (-736.198) (-740.098) (-738.021) * [-746.311] (-738.624) (-739.012) (-739.122) -- 0:00:39
348000 -- (-736.665) [-737.159] (-744.306) (-737.007) * (-740.742) (-737.452) [-736.907] (-736.478) -- 0:00:39
348500 -- (-736.699) [-737.217] (-739.818) (-736.683) * (-740.903) [-737.743] (-737.980) (-741.472) -- 0:00:39
349000 -- [-737.422] (-737.017) (-739.374) (-737.443) * (-737.742) [-742.754] (-739.817) (-742.450) -- 0:00:39
349500 -- (-740.693) [-736.171] (-739.001) (-736.975) * (-736.100) [-742.650] (-737.409) (-739.151) -- 0:00:39
350000 -- [-737.205] (-736.135) (-737.747) (-739.853) * (-737.109) (-737.251) (-739.773) [-738.236] -- 0:00:39
Average standard deviation of split frequencies: 0.013514
350500 -- (-736.014) [-737.978] (-735.946) (-738.203) * (-748.593) (-739.573) [-741.143] (-737.925) -- 0:00:38
351000 -- (-740.533) (-739.638) (-737.076) [-737.966] * (-742.854) [-738.651] (-737.644) (-735.745) -- 0:00:38
351500 -- (-744.849) [-737.168] (-738.460) (-738.711) * (-736.593) (-737.743) (-739.536) [-737.118] -- 0:00:38
352000 -- (-740.180) (-737.034) [-738.022] (-737.234) * (-739.865) [-737.748] (-737.102) (-738.424) -- 0:00:38
352500 -- (-741.178) (-737.094) [-736.165] (-738.870) * [-737.998] (-737.315) (-736.253) (-737.701) -- 0:00:38
353000 -- (-737.477) (-738.465) (-736.322) [-738.492] * (-737.818) (-741.764) [-738.269] (-738.169) -- 0:00:38
353500 -- (-742.276) (-737.685) [-739.029] (-739.690) * (-737.580) (-736.702) (-740.684) [-740.497] -- 0:00:38
354000 -- (-742.968) (-738.806) [-739.656] (-737.271) * (-739.220) (-736.240) (-740.350) [-740.989] -- 0:00:38
354500 -- [-737.930] (-741.414) (-745.202) (-736.898) * (-735.856) [-736.314] (-742.508) (-736.927) -- 0:00:38
355000 -- (-737.903) [-739.416] (-743.401) (-740.658) * (-736.663) (-737.205) [-738.428] (-738.753) -- 0:00:38
Average standard deviation of split frequencies: 0.013102
355500 -- (-737.365) [-737.873] (-740.249) (-742.062) * (-736.559) (-736.159) (-740.906) [-735.770] -- 0:00:38
356000 -- (-737.639) (-735.976) [-738.726] (-741.165) * (-735.901) (-736.910) (-739.327) [-738.991] -- 0:00:37
356500 -- (-737.898) (-736.123) (-738.924) [-739.773] * (-736.354) (-743.013) [-736.501] (-736.806) -- 0:00:37
357000 -- (-738.149) [-737.516] (-740.911) (-744.972) * [-736.258] (-738.193) (-737.147) (-736.504) -- 0:00:37
357500 -- (-740.408) (-738.044) [-736.289] (-739.840) * (-738.765) (-738.221) (-738.581) [-736.432] -- 0:00:37
358000 -- (-738.036) (-737.574) [-738.025] (-737.980) * (-739.659) (-737.098) (-737.381) [-737.326] -- 0:00:37
358500 -- (-737.538) [-736.258] (-738.099) (-738.063) * (-737.096) (-743.334) (-740.594) [-737.310] -- 0:00:37
359000 -- (-737.264) (-738.541) (-738.723) [-739.256] * (-737.646) (-743.575) [-738.953] (-741.749) -- 0:00:37
359500 -- [-736.400] (-736.683) (-737.641) (-738.152) * (-736.596) (-738.894) [-739.882] (-735.808) -- 0:00:37
360000 -- (-737.327) (-743.049) (-737.356) [-736.724] * (-742.938) (-740.653) (-738.992) [-740.916] -- 0:00:37
Average standard deviation of split frequencies: 0.013277
360500 -- (-738.187) [-737.050] (-736.610) (-737.817) * (-738.258) (-741.467) (-738.282) [-737.341] -- 0:00:39
361000 -- [-737.262] (-736.302) (-740.669) (-739.345) * (-736.919) (-737.939) [-737.811] (-737.025) -- 0:00:38
361500 -- (-737.773) [-738.659] (-735.926) (-738.152) * (-736.150) (-737.403) (-738.062) [-736.187] -- 0:00:38
362000 -- [-741.354] (-740.362) (-740.284) (-737.726) * (-738.994) [-737.753] (-738.737) (-738.100) -- 0:00:38
362500 -- [-737.686] (-737.590) (-738.581) (-738.670) * (-739.510) (-735.623) [-738.955] (-737.793) -- 0:00:38
363000 -- (-738.238) (-736.915) [-739.328] (-738.332) * [-736.151] (-739.382) (-742.594) (-738.381) -- 0:00:38
363500 -- (-742.624) (-737.034) (-739.849) [-737.821] * (-737.397) [-742.944] (-741.057) (-735.907) -- 0:00:38
364000 -- [-737.576] (-739.378) (-737.084) (-736.734) * [-737.810] (-742.188) (-737.493) (-735.958) -- 0:00:38
364500 -- (-739.832) (-737.368) [-738.373] (-737.849) * (-737.070) (-738.154) [-737.286] (-738.417) -- 0:00:38
365000 -- [-738.750] (-739.346) (-737.112) (-736.418) * [-736.631] (-738.690) (-737.856) (-736.169) -- 0:00:38
Average standard deviation of split frequencies: 0.013897
365500 -- (-738.033) (-736.874) [-739.906] (-736.953) * (-736.601) (-736.972) [-738.871] (-738.650) -- 0:00:38
366000 -- (-739.049) [-737.182] (-736.210) (-735.718) * (-736.521) (-736.241) [-737.101] (-738.296) -- 0:00:38
366500 -- (-738.810) (-738.894) [-737.318] (-736.801) * (-737.383) (-735.996) [-742.477] (-737.627) -- 0:00:38
367000 -- (-741.774) (-736.711) (-739.972) [-737.104] * (-736.328) [-736.515] (-744.254) (-737.957) -- 0:00:37
367500 -- (-736.406) (-736.134) (-738.350) [-739.336] * (-738.294) (-736.560) [-736.531] (-736.910) -- 0:00:37
368000 -- (-738.011) [-736.802] (-740.577) (-736.754) * [-738.461] (-741.633) (-739.736) (-739.442) -- 0:00:37
368500 -- (-738.876) (-737.207) [-738.846] (-740.233) * (-736.545) (-738.856) (-742.206) [-740.524] -- 0:00:37
369000 -- [-737.392] (-738.754) (-736.533) (-736.664) * (-736.415) (-740.201) [-736.125] (-737.122) -- 0:00:37
369500 -- (-736.978) (-737.283) (-739.460) [-737.037] * (-738.464) (-738.019) [-743.521] (-736.313) -- 0:00:37
370000 -- (-739.204) (-737.830) [-736.267] (-737.654) * (-738.021) (-736.130) [-736.528] (-738.283) -- 0:00:37
Average standard deviation of split frequencies: 0.014793
370500 -- (-737.304) [-740.972] (-739.343) (-737.346) * (-739.880) [-737.095] (-739.057) (-738.648) -- 0:00:37
371000 -- (-736.972) [-736.903] (-738.902) (-735.742) * (-739.007) [-736.307] (-739.167) (-739.145) -- 0:00:37
371500 -- (-735.741) (-740.404) [-738.933] (-738.817) * [-742.748] (-737.489) (-741.086) (-738.235) -- 0:00:37
372000 -- (-738.422) [-740.116] (-738.687) (-737.944) * (-741.178) (-738.244) [-735.958] (-743.441) -- 0:00:37
372500 -- (-737.816) (-736.675) (-736.746) [-738.291] * [-739.967] (-736.757) (-737.763) (-738.719) -- 0:00:37
373000 -- (-739.435) [-736.723] (-738.226) (-736.156) * [-737.573] (-737.946) (-737.589) (-739.541) -- 0:00:36
373500 -- (-736.887) (-739.644) [-738.017] (-739.719) * (-741.478) (-741.507) [-737.424] (-738.929) -- 0:00:36
374000 -- (-736.050) (-740.312) [-738.028] (-743.170) * (-737.641) (-737.179) [-738.154] (-739.698) -- 0:00:36
374500 -- (-736.587) [-738.995] (-738.211) (-737.614) * [-738.291] (-740.298) (-737.653) (-736.258) -- 0:00:36
375000 -- (-737.387) [-736.586] (-739.222) (-739.278) * (-737.622) (-741.736) (-738.813) [-737.742] -- 0:00:36
Average standard deviation of split frequencies: 0.016229
375500 -- (-737.199) [-736.457] (-741.332) (-736.035) * (-739.322) (-739.823) (-741.348) [-737.543] -- 0:00:36
376000 -- (-738.875) (-737.717) (-738.816) [-737.434] * (-735.889) (-738.952) [-737.346] (-735.541) -- 0:00:36
376500 -- (-738.404) (-738.270) (-737.015) [-739.140] * (-736.556) (-740.001) [-736.408] (-735.631) -- 0:00:36
377000 -- (-736.711) (-738.142) [-737.763] (-742.763) * (-736.768) (-740.038) [-737.325] (-738.375) -- 0:00:38
377500 -- (-738.131) (-736.166) [-740.046] (-737.465) * (-737.164) [-738.635] (-744.317) (-737.205) -- 0:00:37
378000 -- (-738.372) (-738.024) (-738.837) [-737.596] * (-739.177) (-737.780) [-739.447] (-736.390) -- 0:00:37
378500 -- (-739.081) [-737.915] (-739.547) (-736.603) * (-738.231) (-738.541) (-739.073) [-736.580] -- 0:00:37
379000 -- (-736.283) [-736.129] (-746.506) (-739.477) * (-735.923) (-741.874) [-736.530] (-743.114) -- 0:00:37
379500 -- (-736.340) [-736.625] (-741.129) (-742.230) * [-736.445] (-737.305) (-738.367) (-737.302) -- 0:00:37
380000 -- [-735.884] (-740.674) (-737.728) (-737.324) * (-737.272) (-737.474) [-738.623] (-736.274) -- 0:00:37
Average standard deviation of split frequencies: 0.017131
380500 -- (-736.780) [-736.473] (-739.060) (-738.475) * (-737.391) (-737.265) (-736.231) [-738.041] -- 0:00:37
381000 -- [-737.200] (-736.129) (-737.459) (-736.933) * (-737.383) (-735.851) (-737.235) [-736.187] -- 0:00:37
381500 -- (-737.302) [-738.913] (-735.854) (-737.108) * (-738.466) (-735.705) [-737.006] (-741.761) -- 0:00:37
382000 -- [-737.208] (-737.177) (-738.771) (-737.599) * (-736.821) (-740.626) [-742.508] (-738.418) -- 0:00:37
382500 -- (-740.025) [-736.314] (-736.603) (-739.137) * (-737.492) [-739.317] (-740.234) (-738.759) -- 0:00:37
383000 -- (-737.701) (-738.745) (-738.602) [-737.598] * (-737.487) (-735.801) (-736.951) [-736.091] -- 0:00:37
383500 -- [-736.560] (-742.023) (-737.445) (-737.300) * (-738.734) (-738.803) (-738.946) [-737.905] -- 0:00:36
384000 -- [-739.115] (-738.273) (-737.075) (-737.422) * [-738.376] (-739.959) (-738.441) (-739.541) -- 0:00:36
384500 -- (-738.584) (-738.839) [-736.664] (-739.378) * (-740.022) (-737.679) [-737.658] (-742.416) -- 0:00:36
385000 -- [-739.255] (-739.209) (-736.396) (-739.606) * (-739.969) (-736.508) (-736.793) [-736.623] -- 0:00:36
Average standard deviation of split frequencies: 0.017165
385500 -- (-737.156) (-736.465) (-736.403) [-736.170] * [-740.730] (-737.109) (-737.382) (-739.824) -- 0:00:36
386000 -- (-738.199) (-737.134) (-736.891) [-736.006] * [-738.817] (-736.966) (-737.850) (-739.550) -- 0:00:36
386500 -- [-741.183] (-736.930) (-738.390) (-738.306) * (-737.330) (-736.879) (-735.889) [-737.614] -- 0:00:36
387000 -- (-737.179) [-736.723] (-737.173) (-738.750) * (-738.407) (-737.326) [-739.784] (-736.564) -- 0:00:36
387500 -- (-737.050) [-736.678] (-740.298) (-737.750) * [-739.053] (-740.381) (-739.767) (-736.795) -- 0:00:36
388000 -- (-738.200) (-741.279) (-737.305) [-741.162] * (-741.047) [-740.542] (-738.366) (-739.989) -- 0:00:36
388500 -- (-737.125) [-737.999] (-739.745) (-738.330) * [-740.301] (-737.624) (-737.950) (-738.554) -- 0:00:36
389000 -- (-736.268) (-743.609) [-737.231] (-736.477) * (-739.405) (-740.892) [-738.950] (-745.093) -- 0:00:36
389500 -- (-737.697) (-738.549) (-738.659) [-738.167] * (-741.440) [-737.785] (-737.267) (-741.448) -- 0:00:36
390000 -- (-736.857) [-736.020] (-738.904) (-737.248) * (-736.697) [-736.698] (-739.593) (-741.254) -- 0:00:35
Average standard deviation of split frequencies: 0.016759
390500 -- [-737.919] (-736.561) (-736.035) (-736.024) * (-736.665) (-736.306) (-742.854) [-740.707] -- 0:00:35
391000 -- [-738.604] (-736.519) (-736.542) (-741.609) * [-736.040] (-737.835) (-742.476) (-738.113) -- 0:00:35
391500 -- (-739.603) [-738.368] (-741.560) (-739.130) * (-739.455) (-739.512) (-736.971) [-738.366] -- 0:00:35
392000 -- (-739.815) (-736.179) (-740.886) [-736.167] * (-738.450) (-738.700) [-736.938] (-741.339) -- 0:00:35
392500 -- [-737.636] (-736.786) (-741.365) (-736.922) * (-738.209) (-736.222) (-741.625) [-740.958] -- 0:00:35
393000 -- (-736.688) (-736.381) (-737.041) [-739.375] * (-739.729) (-737.515) (-737.935) [-737.851] -- 0:00:35
393500 -- (-738.098) [-736.397] (-738.870) (-739.242) * [-739.757] (-736.180) (-737.194) (-745.662) -- 0:00:35
394000 -- (-737.266) [-736.440] (-740.051) (-736.058) * (-738.732) (-739.360) (-737.544) [-739.575] -- 0:00:36
394500 -- (-737.041) [-738.592] (-741.862) (-735.851) * (-737.806) (-739.660) [-736.934] (-739.361) -- 0:00:36
395000 -- [-736.322] (-737.366) (-739.296) (-741.732) * (-738.016) [-736.160] (-738.371) (-737.861) -- 0:00:36
Average standard deviation of split frequencies: 0.017506
395500 -- (-736.015) (-737.596) [-737.134] (-738.020) * (-737.119) (-737.317) [-736.350] (-743.487) -- 0:00:36
396000 -- (-737.623) [-740.975] (-741.676) (-739.075) * (-736.380) (-736.109) [-740.454] (-737.680) -- 0:00:36
396500 -- (-736.195) (-738.152) [-739.631] (-738.103) * (-737.714) (-736.815) [-737.317] (-739.616) -- 0:00:36
397000 -- (-737.627) (-737.790) (-738.222) [-736.194] * [-737.459] (-738.464) (-737.531) (-738.534) -- 0:00:36
397500 -- [-736.687] (-740.760) (-737.664) (-736.345) * (-736.271) [-739.326] (-737.742) (-736.987) -- 0:00:36
398000 -- (-737.264) (-740.595) (-739.660) [-737.754] * (-741.059) (-737.839) (-741.177) [-736.679] -- 0:00:36
398500 -- (-737.715) [-738.102] (-735.646) (-740.785) * (-738.562) (-740.234) (-738.406) [-736.311] -- 0:00:36
399000 -- [-737.961] (-737.172) (-739.769) (-741.150) * [-738.608] (-743.900) (-738.633) (-735.600) -- 0:00:36
399500 -- [-738.198] (-738.124) (-738.538) (-737.813) * (-738.263) (-741.428) (-736.941) [-735.712] -- 0:00:36
400000 -- (-735.868) (-737.019) [-737.807] (-739.687) * (-737.581) [-740.767] (-738.745) (-736.984) -- 0:00:36
Average standard deviation of split frequencies: 0.017717
400500 -- (-737.778) (-740.184) (-736.732) [-740.281] * (-743.073) (-744.261) (-736.825) [-735.635] -- 0:00:35
401000 -- (-738.419) [-736.540] (-736.665) (-737.145) * (-736.051) (-736.962) [-737.543] (-739.496) -- 0:00:35
401500 -- (-736.427) [-736.599] (-738.104) (-738.020) * (-736.224) (-737.259) [-737.203] (-737.416) -- 0:00:35
402000 -- (-736.876) [-738.281] (-738.096) (-740.358) * [-737.904] (-735.991) (-738.320) (-736.096) -- 0:00:35
402500 -- (-738.333) (-737.139) [-737.323] (-738.151) * (-737.976) (-737.084) (-739.199) [-738.327] -- 0:00:35
403000 -- (-737.532) [-736.971] (-736.787) (-738.498) * [-741.873] (-737.464) (-737.691) (-739.970) -- 0:00:35
403500 -- (-738.606) (-736.485) (-739.272) [-735.845] * (-737.741) [-735.952] (-739.756) (-739.638) -- 0:00:35
404000 -- (-738.484) (-736.331) [-739.245] (-736.607) * [-737.824] (-736.860) (-736.346) (-741.543) -- 0:00:35
404500 -- (-738.491) [-739.040] (-736.429) (-737.192) * [-737.195] (-737.971) (-737.650) (-737.358) -- 0:00:35
405000 -- [-736.726] (-736.466) (-737.461) (-738.197) * (-735.874) [-739.878] (-737.621) (-741.513) -- 0:00:35
Average standard deviation of split frequencies: 0.017348
405500 -- (-738.491) (-741.223) [-735.855] (-740.203) * (-736.328) [-736.187] (-739.526) (-746.415) -- 0:00:35
406000 -- [-739.523] (-741.650) (-737.177) (-736.394) * (-737.848) [-736.493] (-737.281) (-740.133) -- 0:00:35
406500 -- (-739.050) [-738.012] (-735.601) (-736.238) * [-741.015] (-738.434) (-736.978) (-738.553) -- 0:00:35
407000 -- (-743.283) (-736.887) [-735.645] (-736.003) * (-741.996) (-738.890) (-736.689) [-738.474] -- 0:00:34
407500 -- (-742.679) (-738.708) (-737.495) [-736.378] * (-741.488) (-738.369) [-740.878] (-738.452) -- 0:00:34
408000 -- (-742.209) (-736.287) [-736.830] (-737.857) * (-741.225) (-738.382) (-738.426) [-738.203] -- 0:00:34
408500 -- (-736.168) (-736.744) (-736.194) [-736.212] * (-741.862) (-737.830) [-736.194] (-737.590) -- 0:00:34
409000 -- (-737.138) (-736.748) (-736.200) [-736.253] * (-738.610) [-739.101] (-740.158) (-738.075) -- 0:00:34
409500 -- (-738.268) (-737.960) (-738.800) [-736.129] * [-736.816] (-736.234) (-736.412) (-738.404) -- 0:00:34
410000 -- [-737.348] (-736.929) (-746.865) (-737.263) * [-737.168] (-737.682) (-736.304) (-737.083) -- 0:00:34
Average standard deviation of split frequencies: 0.017421
410500 -- (-738.958) [-743.213] (-737.640) (-737.735) * (-737.280) [-738.868] (-738.028) (-736.004) -- 0:00:35
411000 -- (-741.408) (-736.339) (-737.008) [-738.005] * (-738.219) (-738.579) [-737.453] (-738.253) -- 0:00:35
411500 -- (-741.893) (-739.058) (-736.811) [-736.195] * (-740.028) (-738.538) [-739.212] (-740.732) -- 0:00:35
412000 -- (-742.645) (-742.899) [-737.314] (-736.182) * [-738.022] (-737.191) (-737.555) (-736.574) -- 0:00:35
412500 -- [-738.624] (-739.101) (-736.797) (-736.182) * (-737.763) [-736.497] (-736.419) (-736.733) -- 0:00:35
413000 -- (-740.963) [-739.763] (-736.648) (-737.917) * (-738.811) [-735.986] (-736.560) (-737.122) -- 0:00:35
413500 -- (-742.000) (-737.764) (-738.926) [-735.680] * [-737.250] (-737.509) (-736.578) (-740.319) -- 0:00:35
414000 -- (-737.807) (-741.429) [-737.971] (-738.418) * (-738.835) (-740.542) [-737.017] (-739.085) -- 0:00:35
414500 -- (-736.848) (-739.375) (-736.565) [-738.109] * (-736.272) (-736.559) (-738.965) [-746.661] -- 0:00:35
415000 -- (-737.682) (-740.659) [-736.638] (-738.996) * [-736.284] (-737.712) (-738.800) (-738.217) -- 0:00:35
Average standard deviation of split frequencies: 0.017264
415500 -- [-739.642] (-736.822) (-737.813) (-736.227) * (-735.908) [-736.585] (-739.553) (-736.949) -- 0:00:35
416000 -- (-739.456) (-736.912) (-742.077) [-737.847] * [-737.475] (-738.574) (-736.350) (-738.059) -- 0:00:35
416500 -- [-737.479] (-736.373) (-738.875) (-735.715) * (-735.883) (-736.588) (-736.327) [-738.350] -- 0:00:35
417000 -- [-742.066] (-736.998) (-737.934) (-735.719) * (-737.461) (-738.125) (-737.465) [-737.354] -- 0:00:34
417500 -- (-738.496) (-737.437) (-736.413) [-736.223] * (-736.758) [-738.134] (-738.009) (-739.802) -- 0:00:34
418000 -- (-737.346) [-737.709] (-737.631) (-737.223) * (-736.897) (-737.438) [-737.729] (-735.989) -- 0:00:34
418500 -- (-739.643) [-735.923] (-737.294) (-736.663) * (-738.510) [-737.223] (-738.971) (-737.016) -- 0:00:34
419000 -- (-736.465) [-738.124] (-736.197) (-736.401) * [-737.508] (-738.945) (-742.748) (-739.996) -- 0:00:34
419500 -- (-740.566) (-743.855) (-736.430) [-736.927] * (-738.537) [-736.168] (-744.570) (-740.986) -- 0:00:34
420000 -- (-737.640) (-736.658) [-736.852] (-739.801) * [-735.687] (-738.629) (-741.562) (-737.016) -- 0:00:34
Average standard deviation of split frequencies: 0.017370
420500 -- (-736.792) [-736.795] (-737.812) (-743.480) * (-742.022) (-740.121) (-738.519) [-738.067] -- 0:00:34
421000 -- (-741.786) (-737.543) [-739.918] (-736.425) * (-741.546) (-742.060) [-737.059] (-746.001) -- 0:00:34
421500 -- (-737.857) (-737.655) [-739.141] (-737.566) * (-739.336) (-737.302) [-737.279] (-739.529) -- 0:00:34
422000 -- [-738.186] (-739.986) (-737.426) (-735.778) * (-741.491) [-735.623] (-737.399) (-740.998) -- 0:00:34
422500 -- (-738.438) (-737.711) (-737.176) [-738.741] * [-740.548] (-739.437) (-736.732) (-738.463) -- 0:00:34
423000 -- (-740.341) (-736.679) [-736.715] (-736.894) * [-737.535] (-738.315) (-737.187) (-737.212) -- 0:00:34
423500 -- (-737.230) (-737.463) [-741.411] (-739.579) * (-736.900) (-736.320) (-737.123) [-738.832] -- 0:00:34
424000 -- (-741.663) (-738.032) [-739.037] (-737.829) * [-737.177] (-738.103) (-735.806) (-736.808) -- 0:00:33
424500 -- (-738.075) (-736.671) (-738.108) [-737.279] * [-736.793] (-738.288) (-738.928) (-736.886) -- 0:00:33
425000 -- [-737.150] (-736.676) (-737.933) (-742.972) * [-735.669] (-738.815) (-739.954) (-743.894) -- 0:00:33
Average standard deviation of split frequencies: 0.017705
425500 -- (-736.527) (-736.259) [-737.137] (-736.898) * [-740.735] (-743.711) (-743.032) (-739.519) -- 0:00:33
426000 -- (-736.239) (-740.832) (-736.569) [-738.143] * (-737.455) (-738.159) (-744.890) [-737.470] -- 0:00:33
426500 -- (-737.585) (-739.128) (-740.614) [-735.887] * (-737.110) [-738.657] (-737.109) (-737.403) -- 0:00:33
427000 -- (-739.307) (-738.229) [-740.750] (-736.734) * [-737.860] (-739.648) (-739.141) (-737.763) -- 0:00:33
427500 -- (-738.332) (-738.839) [-737.738] (-739.368) * (-736.740) (-737.027) [-739.148] (-736.942) -- 0:00:34
428000 -- (-739.274) (-745.154) [-738.366] (-741.289) * (-738.681) (-737.011) [-736.433] (-739.094) -- 0:00:34
428500 -- (-738.187) [-739.071] (-737.502) (-737.457) * (-739.576) (-740.444) (-737.184) [-739.323] -- 0:00:34
429000 -- (-742.098) (-739.407) [-740.071] (-739.088) * (-737.340) [-736.319] (-738.042) (-737.050) -- 0:00:34
429500 -- (-740.784) [-738.768] (-740.131) (-738.317) * (-737.271) (-737.785) [-736.814] (-736.162) -- 0:00:34
430000 -- (-739.792) [-736.937] (-736.118) (-736.711) * (-738.194) (-737.367) (-736.659) [-736.908] -- 0:00:34
Average standard deviation of split frequencies: 0.017642
430500 -- (-737.247) (-736.319) (-741.562) [-741.110] * (-736.345) (-737.166) (-740.483) [-735.897] -- 0:00:34
431000 -- (-738.306) (-736.265) [-736.871] (-739.976) * (-740.105) (-739.689) (-737.078) [-735.607] -- 0:00:34
431500 -- (-738.171) (-737.108) (-737.273) [-739.050] * [-737.427] (-743.806) (-738.360) (-736.049) -- 0:00:34
432000 -- (-736.339) [-735.989] (-737.915) (-741.588) * (-736.686) (-737.393) [-739.495] (-735.972) -- 0:00:34
432500 -- [-738.184] (-740.119) (-739.787) (-737.227) * (-736.497) (-741.100) (-741.673) [-738.447] -- 0:00:34
433000 -- [-738.162] (-740.910) (-746.057) (-739.159) * (-736.168) [-737.139] (-736.485) (-739.240) -- 0:00:34
433500 -- (-738.964) (-739.140) [-739.490] (-738.040) * (-742.032) [-739.805] (-737.057) (-738.308) -- 0:00:33
434000 -- [-739.681] (-739.282) (-737.656) (-739.293) * (-738.929) (-737.809) [-736.341] (-737.306) -- 0:00:33
434500 -- (-737.880) (-737.410) [-736.819] (-738.307) * [-736.438] (-738.297) (-736.446) (-736.930) -- 0:00:33
435000 -- (-736.037) [-736.540] (-736.639) (-739.050) * [-737.758] (-740.196) (-739.181) (-738.152) -- 0:00:33
Average standard deviation of split frequencies: 0.016790
435500 -- (-737.334) [-738.272] (-739.330) (-740.523) * (-736.705) [-737.815] (-738.733) (-736.998) -- 0:00:33
436000 -- (-739.219) (-738.462) (-737.289) [-738.285] * [-737.341] (-738.628) (-746.893) (-741.239) -- 0:00:33
436500 -- (-735.969) (-739.521) (-737.860) [-736.356] * (-737.739) (-737.921) [-738.934] (-736.877) -- 0:00:33
437000 -- (-738.411) (-737.992) (-736.517) [-738.337] * (-737.298) [-737.590] (-740.426) (-736.933) -- 0:00:33
437500 -- (-738.073) [-736.674] (-737.034) (-736.691) * (-737.411) (-738.925) [-737.275] (-736.774) -- 0:00:33
438000 -- (-737.143) [-738.213] (-738.277) (-739.187) * (-738.318) (-738.541) (-736.097) [-739.647] -- 0:00:33
438500 -- [-737.773] (-742.815) (-736.817) (-740.450) * (-739.056) [-739.493] (-737.223) (-738.065) -- 0:00:33
439000 -- (-736.250) (-738.293) [-736.211] (-740.034) * (-737.702) [-737.442] (-737.456) (-738.155) -- 0:00:33
439500 -- (-739.429) (-737.720) [-736.281] (-739.383) * (-738.736) [-736.930] (-736.596) (-740.877) -- 0:00:33
440000 -- (-744.730) (-736.285) (-737.576) [-738.564] * (-735.954) (-739.078) [-738.905] (-737.188) -- 0:00:33
Average standard deviation of split frequencies: 0.016424
440500 -- (-743.949) [-740.023] (-736.558) (-741.326) * (-737.508) (-744.219) (-738.799) [-737.530] -- 0:00:33
441000 -- (-744.032) (-742.817) (-736.160) [-738.252] * (-739.865) [-738.270] (-737.485) (-738.379) -- 0:00:32
441500 -- (-739.770) [-737.811] (-736.446) (-740.145) * (-737.039) [-738.853] (-739.365) (-740.663) -- 0:00:32
442000 -- (-737.157) (-737.165) [-738.659] (-740.222) * (-736.647) (-740.189) (-739.034) [-736.370] -- 0:00:32
442500 -- (-736.463) [-735.555] (-742.046) (-740.102) * (-738.702) [-737.191] (-736.166) (-738.085) -- 0:00:32
443000 -- (-736.516) (-741.019) (-744.514) [-739.048] * (-738.571) (-736.213) (-739.537) [-736.216] -- 0:00:32
443500 -- [-736.992] (-741.004) (-735.876) (-741.384) * [-735.741] (-737.296) (-740.093) (-737.720) -- 0:00:32
444000 -- (-743.473) (-741.315) [-740.400] (-741.420) * [-735.808] (-737.494) (-738.533) (-737.957) -- 0:00:32
444500 -- (-739.115) (-739.162) (-736.732) [-740.930] * (-736.319) (-740.914) (-739.348) [-736.714] -- 0:00:33
445000 -- (-738.751) [-737.501] (-738.944) (-738.672) * [-737.358] (-739.633) (-736.297) (-736.300) -- 0:00:33
Average standard deviation of split frequencies: 0.015326
445500 -- (-737.962) [-737.909] (-737.880) (-738.565) * (-739.440) (-736.263) (-740.112) [-736.178] -- 0:00:33
446000 -- (-740.260) [-743.682] (-736.955) (-736.087) * (-738.439) [-736.910] (-736.785) (-736.280) -- 0:00:33
446500 -- (-740.636) (-738.862) [-738.059] (-736.720) * (-742.180) [-739.009] (-736.795) (-736.371) -- 0:00:33
447000 -- [-738.421] (-740.396) (-739.644) (-736.689) * [-736.645] (-738.509) (-737.141) (-737.498) -- 0:00:33
447500 -- (-736.919) [-737.848] (-737.184) (-737.946) * (-739.690) (-738.878) (-738.479) [-736.480] -- 0:00:33
448000 -- (-737.633) [-736.952] (-736.007) (-739.903) * (-737.463) (-741.731) (-738.277) [-740.152] -- 0:00:33
448500 -- (-739.037) (-738.189) (-737.014) [-737.692] * (-737.141) (-740.360) [-738.421] (-738.491) -- 0:00:33
449000 -- [-737.665] (-736.750) (-738.268) (-739.935) * (-738.661) (-742.261) (-739.047) [-739.485] -- 0:00:33
449500 -- (-741.352) [-740.033] (-738.365) (-738.506) * [-737.841] (-737.763) (-737.515) (-738.833) -- 0:00:33
450000 -- (-737.888) (-739.369) [-737.874] (-737.671) * [-737.908] (-737.464) (-738.136) (-738.619) -- 0:00:33
Average standard deviation of split frequencies: 0.015051
450500 -- (-740.847) (-740.746) (-739.259) [-736.788] * (-738.319) (-737.303) [-735.854] (-739.852) -- 0:00:32
451000 -- (-739.577) (-744.436) [-740.367] (-735.787) * (-741.748) (-736.087) (-738.236) [-736.043] -- 0:00:32
451500 -- (-737.761) (-738.611) [-736.831] (-735.785) * (-741.915) [-740.537] (-739.830) (-736.090) -- 0:00:32
452000 -- (-736.354) [-736.708] (-739.707) (-737.963) * (-737.537) (-746.790) (-738.442) [-738.016] -- 0:00:32
452500 -- [-737.493] (-736.933) (-743.993) (-736.896) * (-735.962) [-738.078] (-738.716) (-737.028) -- 0:00:32
453000 -- [-737.496] (-741.150) (-739.033) (-735.917) * (-735.829) (-738.660) (-740.332) [-737.164] -- 0:00:32
453500 -- [-737.538] (-738.706) (-739.887) (-738.728) * [-735.489] (-737.970) (-738.498) (-738.045) -- 0:00:32
454000 -- (-739.219) [-739.014] (-739.348) (-739.950) * (-736.746) [-739.144] (-745.252) (-740.158) -- 0:00:32
454500 -- [-740.880] (-739.687) (-739.067) (-738.949) * (-738.789) [-737.090] (-737.213) (-736.835) -- 0:00:32
455000 -- (-737.056) (-741.632) [-737.468] (-740.988) * [-739.965] (-738.510) (-738.720) (-742.071) -- 0:00:32
Average standard deviation of split frequencies: 0.015794
455500 -- (-736.676) (-736.066) (-740.448) [-739.093] * (-735.992) [-736.988] (-739.421) (-736.155) -- 0:00:32
456000 -- (-742.041) (-737.046) (-736.344) [-738.067] * [-740.223] (-741.728) (-738.071) (-737.485) -- 0:00:32
456500 -- [-738.656] (-736.817) (-740.285) (-739.265) * [-739.583] (-740.823) (-739.792) (-737.829) -- 0:00:32
457000 -- [-737.401] (-736.420) (-736.727) (-740.832) * (-738.080) (-738.992) [-737.204] (-739.709) -- 0:00:32
457500 -- (-737.118) (-738.495) [-737.699] (-740.912) * (-737.182) (-737.243) [-736.387] (-739.318) -- 0:00:32
458000 -- (-738.523) (-740.700) [-738.760] (-738.202) * (-736.584) (-737.709) (-738.147) [-737.539] -- 0:00:31
458500 -- [-740.620] (-737.411) (-737.292) (-737.623) * (-737.192) [-737.576] (-737.809) (-737.806) -- 0:00:31
459000 -- (-738.865) [-739.375] (-738.894) (-736.240) * (-736.975) (-740.013) [-738.039] (-741.626) -- 0:00:31
459500 -- [-736.635] (-736.184) (-739.108) (-737.589) * (-736.187) [-738.862] (-740.348) (-739.163) -- 0:00:31
460000 -- (-736.484) [-736.373] (-737.178) (-737.334) * (-738.249) [-739.119] (-738.617) (-739.865) -- 0:00:31
Average standard deviation of split frequencies: 0.016313
460500 -- (-736.392) [-738.601] (-743.725) (-737.199) * (-737.009) (-735.808) (-740.035) [-739.216] -- 0:00:31
461000 -- [-736.164] (-739.641) (-739.038) (-735.946) * [-738.479] (-735.738) (-741.343) (-741.374) -- 0:00:32
461500 -- (-736.381) [-738.461] (-736.895) (-737.330) * (-738.484) [-737.389] (-736.949) (-741.843) -- 0:00:32
462000 -- (-739.582) (-738.094) (-737.137) [-739.135] * (-738.994) [-737.388] (-738.981) (-740.871) -- 0:00:32
462500 -- (-737.205) (-740.517) [-738.679] (-738.445) * (-737.546) (-736.612) (-736.935) [-737.199] -- 0:00:32
463000 -- (-736.837) (-736.600) (-739.468) [-735.549] * (-738.543) [-738.295] (-739.094) (-740.151) -- 0:00:32
463500 -- (-736.177) (-737.257) [-738.320] (-737.842) * (-742.613) (-739.622) [-736.376] (-740.418) -- 0:00:32
464000 -- (-738.829) [-738.636] (-737.877) (-740.090) * (-737.071) [-736.018] (-737.835) (-743.708) -- 0:00:32
464500 -- (-736.431) [-737.640] (-736.269) (-740.687) * (-737.856) (-737.847) [-741.748] (-737.209) -- 0:00:32
465000 -- [-738.462] (-738.367) (-736.553) (-743.627) * (-736.362) (-736.125) (-739.153) [-737.575] -- 0:00:32
Average standard deviation of split frequencies: 0.015769
465500 -- (-738.931) (-737.665) (-736.568) [-738.794] * (-737.717) (-738.421) (-738.078) [-744.624] -- 0:00:32
466000 -- (-738.280) (-738.913) (-738.143) [-737.790] * (-738.915) (-737.523) (-735.952) [-740.261] -- 0:00:32
466500 -- (-737.772) (-738.022) [-740.267] (-736.965) * [-738.396] (-738.701) (-738.545) (-737.483) -- 0:00:32
467000 -- [-736.623] (-744.293) (-737.691) (-736.610) * [-737.608] (-737.006) (-737.055) (-738.715) -- 0:00:31
467500 -- (-737.014) [-739.277] (-738.079) (-741.905) * (-737.325) (-737.430) (-745.349) [-736.595] -- 0:00:31
468000 -- (-740.710) [-738.180] (-737.117) (-737.639) * (-739.860) [-737.417] (-737.250) (-735.531) -- 0:00:31
468500 -- (-737.067) [-736.848] (-735.744) (-742.927) * [-736.096] (-740.690) (-737.983) (-739.428) -- 0:00:31
469000 -- (-739.403) (-737.881) (-736.304) [-737.123] * [-736.775] (-738.003) (-741.987) (-737.709) -- 0:00:31
469500 -- [-738.319] (-738.755) (-736.704) (-739.880) * [-739.453] (-737.552) (-738.766) (-742.242) -- 0:00:31
470000 -- [-738.269] (-737.221) (-739.227) (-736.499) * (-738.216) (-740.737) (-737.460) [-736.981] -- 0:00:31
Average standard deviation of split frequencies: 0.016202
470500 -- [-743.830] (-736.238) (-739.562) (-736.997) * (-736.024) (-738.525) [-740.126] (-736.096) -- 0:00:31
471000 -- (-737.777) (-738.546) [-740.693] (-739.355) * (-740.371) (-736.644) (-740.901) [-736.977] -- 0:00:31
471500 -- (-738.344) (-737.382) (-736.060) [-738.037] * [-736.549] (-736.635) (-739.892) (-736.894) -- 0:00:31
472000 -- [-739.223] (-737.046) (-740.363) (-741.648) * (-736.657) (-737.759) (-738.505) [-742.301] -- 0:00:31
472500 -- (-738.045) (-737.056) (-738.879) [-737.254] * [-737.251] (-735.563) (-735.900) (-736.527) -- 0:00:31
473000 -- (-738.955) [-736.164] (-742.048) (-737.444) * (-736.490) (-735.649) [-735.853] (-736.743) -- 0:00:31
473500 -- (-745.142) (-738.935) (-735.944) [-738.363] * [-736.879] (-736.014) (-736.243) (-736.391) -- 0:00:31
474000 -- [-737.001] (-737.859) (-738.486) (-736.133) * [-737.159] (-735.761) (-740.288) (-736.465) -- 0:00:31
474500 -- (-737.381) [-737.535] (-746.110) (-737.623) * (-738.635) [-736.346] (-737.425) (-737.495) -- 0:00:31
475000 -- [-737.331] (-740.411) (-738.755) (-736.705) * (-739.415) [-738.960] (-739.016) (-740.592) -- 0:00:30
Average standard deviation of split frequencies: 0.015787
475500 -- (-736.315) (-738.049) (-737.021) [-736.390] * (-735.682) (-737.861) (-739.197) [-739.793] -- 0:00:30
476000 -- (-738.821) (-737.627) [-736.303] (-739.898) * (-737.032) (-738.158) [-738.539] (-740.767) -- 0:00:30
476500 -- (-738.031) [-737.610] (-737.257) (-736.018) * (-736.843) (-737.706) (-737.690) [-740.048] -- 0:00:30
477000 -- (-736.387) (-741.491) [-736.328] (-737.578) * (-738.460) (-739.243) (-739.282) [-738.031] -- 0:00:30
477500 -- (-737.514) (-736.133) [-736.770] (-739.045) * (-738.295) (-738.755) (-738.352) [-736.818] -- 0:00:31
478000 -- (-739.829) (-737.522) [-737.649] (-735.989) * [-739.459] (-737.876) (-739.607) (-737.807) -- 0:00:31
478500 -- (-737.410) (-735.533) [-737.599] (-736.338) * [-738.171] (-737.506) (-737.237) (-737.580) -- 0:00:31
479000 -- (-740.643) (-736.374) (-749.107) [-736.634] * (-738.684) (-737.920) (-741.727) [-736.289] -- 0:00:31
479500 -- (-739.504) (-741.076) (-739.582) [-739.148] * (-740.414) (-737.496) (-745.076) [-736.036] -- 0:00:31
480000 -- (-737.147) (-738.492) (-742.077) [-737.700] * (-736.647) [-737.194] (-737.599) (-737.823) -- 0:00:31
Average standard deviation of split frequencies: 0.015519
480500 -- (-740.407) [-739.309] (-737.687) (-736.699) * (-737.885) [-735.898] (-737.708) (-738.456) -- 0:00:31
481000 -- (-738.813) (-740.227) [-739.028] (-737.320) * (-737.267) (-738.545) [-736.829] (-735.721) -- 0:00:31
481500 -- (-738.519) [-736.705] (-737.769) (-736.745) * (-737.903) [-737.598] (-735.979) (-738.316) -- 0:00:31
482000 -- (-738.164) (-741.091) (-739.780) [-736.641] * [-738.441] (-736.653) (-738.388) (-738.914) -- 0:00:31
482500 -- (-738.234) (-736.585) [-737.536] (-742.695) * (-738.139) (-740.957) [-736.180] (-738.882) -- 0:00:31
483000 -- [-740.527] (-735.937) (-736.158) (-735.939) * (-735.824) (-741.312) [-736.295] (-736.608) -- 0:00:31
483500 -- [-736.778] (-735.630) (-737.920) (-736.103) * [-737.543] (-738.244) (-740.119) (-736.925) -- 0:00:30
484000 -- (-737.086) [-738.941] (-741.787) (-736.037) * (-740.810) (-740.549) (-740.514) [-736.782] -- 0:00:30
484500 -- (-740.659) (-737.117) (-738.380) [-736.933] * (-739.012) (-737.502) (-739.784) [-736.048] -- 0:00:30
485000 -- (-738.321) [-735.933] (-737.461) (-742.621) * (-740.610) [-738.270] (-737.361) (-736.974) -- 0:00:30
Average standard deviation of split frequencies: 0.015862
485500 -- [-737.095] (-736.651) (-738.393) (-738.916) * [-738.295] (-741.365) (-736.511) (-737.280) -- 0:00:30
486000 -- (-736.449) [-738.046] (-736.240) (-738.498) * (-743.038) (-740.384) (-737.795) [-739.679] -- 0:00:30
486500 -- (-736.309) [-736.366] (-735.764) (-738.548) * (-739.208) (-741.652) (-735.642) [-737.053] -- 0:00:30
487000 -- (-738.646) [-738.577] (-736.700) (-738.776) * (-739.803) (-736.351) [-735.760] (-737.983) -- 0:00:30
487500 -- (-739.053) [-737.717] (-737.414) (-738.005) * (-739.827) (-736.868) (-738.378) [-738.683] -- 0:00:30
488000 -- (-737.745) (-740.285) [-742.429] (-736.720) * (-739.210) (-740.402) (-738.358) [-740.396] -- 0:00:30
488500 -- (-738.372) (-736.838) [-737.350] (-737.979) * [-736.051] (-736.034) (-743.319) (-736.020) -- 0:00:30
489000 -- (-737.510) (-737.415) [-736.363] (-737.222) * [-739.489] (-736.672) (-739.225) (-736.020) -- 0:00:30
489500 -- [-741.372] (-737.096) (-738.167) (-737.740) * [-736.614] (-738.179) (-745.602) (-736.299) -- 0:00:30
490000 -- (-737.599) (-738.097) (-736.727) [-737.450] * [-736.935] (-738.543) (-740.709) (-738.464) -- 0:00:30
Average standard deviation of split frequencies: 0.015937
490500 -- (-739.107) (-738.653) (-736.623) [-736.419] * [-737.678] (-738.246) (-736.705) (-739.027) -- 0:00:30
491000 -- [-738.275] (-739.421) (-739.551) (-738.528) * (-736.844) (-738.728) [-738.429] (-740.531) -- 0:00:30
491500 -- (-739.911) [-739.296] (-738.091) (-736.727) * (-735.820) (-737.987) [-735.895] (-738.678) -- 0:00:30
492000 -- (-744.063) [-737.758] (-738.973) (-739.155) * [-742.139] (-743.435) (-737.887) (-738.930) -- 0:00:29
492500 -- (-737.861) [-738.094] (-743.096) (-738.700) * (-737.668) [-738.887] (-736.483) (-738.070) -- 0:00:29
493000 -- (-737.958) (-741.091) (-743.939) [-741.006] * (-736.897) (-738.883) (-740.022) [-735.862] -- 0:00:29
493500 -- [-739.467] (-737.438) (-737.297) (-740.398) * (-737.045) (-737.410) (-738.859) [-736.840] -- 0:00:29
494000 -- [-737.728] (-738.441) (-737.104) (-737.326) * (-736.971) (-738.626) [-735.659] (-737.048) -- 0:00:29
494500 -- (-744.565) [-737.901] (-739.212) (-738.293) * (-740.368) (-738.644) [-737.411] (-738.282) -- 0:00:30
495000 -- (-740.797) [-738.610] (-738.108) (-738.388) * [-739.392] (-737.645) (-737.144) (-738.108) -- 0:00:30
Average standard deviation of split frequencies: 0.015877
495500 -- (-739.431) [-737.025] (-738.978) (-741.731) * (-736.873) [-736.765] (-737.071) (-741.031) -- 0:00:30
496000 -- (-737.052) (-736.004) (-737.556) [-738.995] * (-738.188) (-738.323) [-736.252] (-736.926) -- 0:00:30
496500 -- (-740.249) (-737.912) (-737.216) [-737.971] * (-740.279) (-739.769) [-735.799] (-741.390) -- 0:00:30
497000 -- (-737.760) [-738.982] (-739.307) (-735.635) * (-739.601) [-739.147] (-736.371) (-738.886) -- 0:00:30
497500 -- (-737.050) [-737.432] (-737.255) (-735.899) * (-735.677) (-738.181) (-736.430) [-736.602] -- 0:00:30
498000 -- (-739.640) (-740.474) [-735.954] (-738.077) * (-739.944) [-740.916] (-738.692) (-738.003) -- 0:00:30
498500 -- (-737.776) (-737.749) (-738.149) [-736.001] * (-737.561) (-738.052) [-737.658] (-735.993) -- 0:00:30
499000 -- (-743.112) (-736.340) [-737.788] (-737.017) * (-736.040) (-737.423) [-737.929] (-737.257) -- 0:00:30
499500 -- [-740.674] (-737.355) (-737.174) (-738.535) * (-738.379) [-737.692] (-738.647) (-736.812) -- 0:00:30
500000 -- (-741.199) [-737.241] (-736.240) (-738.854) * (-737.538) (-740.511) [-740.498] (-737.310) -- 0:00:30
Average standard deviation of split frequencies: 0.015065
500500 -- (-736.645) [-736.301] (-737.033) (-735.997) * [-737.538] (-736.933) (-737.178) (-737.974) -- 0:00:29
501000 -- (-736.333) (-737.493) (-737.795) [-736.360] * (-737.576) (-739.693) [-737.481] (-737.319) -- 0:00:29
501500 -- (-737.579) (-737.750) [-737.135] (-736.861) * (-738.055) [-737.303] (-737.797) (-736.521) -- 0:00:29
502000 -- (-739.274) (-738.134) (-737.055) [-737.232] * (-738.541) [-736.282] (-736.711) (-736.671) -- 0:00:29
502500 -- [-737.129] (-737.638) (-737.791) (-736.713) * [-737.936] (-736.828) (-744.529) (-737.102) -- 0:00:29
503000 -- (-736.410) [-738.568] (-745.327) (-737.009) * (-739.027) [-739.447] (-743.349) (-739.802) -- 0:00:29
503500 -- (-736.964) [-738.568] (-740.410) (-736.119) * (-741.358) (-740.324) (-738.179) [-736.958] -- 0:00:29
504000 -- (-738.221) [-738.568] (-739.509) (-737.413) * (-738.519) (-738.754) [-739.304] (-741.977) -- 0:00:29
504500 -- (-738.667) [-736.412] (-738.206) (-743.092) * (-739.603) (-741.209) [-736.200] (-736.129) -- 0:00:29
505000 -- (-736.563) [-736.662] (-736.867) (-743.038) * (-738.715) (-737.414) [-736.927] (-738.262) -- 0:00:29
Average standard deviation of split frequencies: 0.015673
505500 -- (-740.915) (-738.774) [-736.027] (-737.070) * (-736.117) (-740.010) [-736.543] (-738.800) -- 0:00:29
506000 -- (-736.334) (-736.821) [-736.945] (-735.701) * (-737.651) (-739.286) (-736.555) [-738.568] -- 0:00:29
506500 -- (-736.338) [-737.417] (-740.036) (-736.925) * (-737.289) [-736.651] (-737.070) (-742.455) -- 0:00:29
507000 -- [-736.510] (-737.516) (-739.094) (-736.313) * (-737.270) [-736.803] (-744.598) (-738.699) -- 0:00:29
507500 -- (-736.735) (-738.839) [-736.026] (-736.798) * (-740.619) [-736.583] (-741.513) (-744.923) -- 0:00:29
508000 -- (-739.608) (-738.041) [-736.056] (-737.757) * (-743.660) [-736.332] (-743.849) (-738.566) -- 0:00:29
508500 -- [-738.865] (-745.287) (-735.602) (-738.392) * (-739.192) (-738.063) [-737.682] (-737.988) -- 0:00:28
509000 -- [-737.446] (-743.298) (-736.441) (-738.790) * (-736.978) [-738.123] (-741.838) (-739.509) -- 0:00:28
509500 -- (-737.170) [-740.352] (-738.590) (-736.955) * (-738.441) (-740.342) (-736.034) [-735.864] -- 0:00:28
510000 -- (-736.138) (-736.825) [-737.969] (-737.153) * (-740.976) (-737.170) (-737.619) [-737.971] -- 0:00:28
Average standard deviation of split frequencies: 0.015476
510500 -- [-736.454] (-736.690) (-736.451) (-739.516) * (-740.341) [-740.596] (-738.495) (-739.508) -- 0:00:28
511000 -- (-737.886) [-740.673] (-736.448) (-737.682) * [-736.759] (-739.948) (-741.210) (-738.762) -- 0:00:29
511500 -- (-736.946) (-736.716) (-737.454) [-737.066] * (-738.525) (-737.150) [-737.329] (-737.850) -- 0:00:29
512000 -- [-736.233] (-736.385) (-736.115) (-736.750) * (-741.207) (-738.093) (-737.275) [-737.557] -- 0:00:29
512500 -- (-736.222) (-737.194) (-735.800) [-737.738] * [-742.982] (-738.707) (-741.526) (-735.751) -- 0:00:29
513000 -- (-736.873) [-737.363] (-737.047) (-735.746) * (-739.103) (-741.489) [-736.062] (-736.952) -- 0:00:29
513500 -- (-737.022) (-735.738) [-736.240] (-737.734) * (-737.994) [-737.140] (-739.089) (-737.781) -- 0:00:29
514000 -- (-737.190) (-737.245) [-737.352] (-736.759) * [-736.400] (-740.598) (-738.750) (-741.565) -- 0:00:29
514500 -- (-736.743) (-742.341) [-736.461] (-737.144) * (-740.347) (-744.374) [-738.439] (-741.646) -- 0:00:29
515000 -- (-739.428) (-740.486) (-736.069) [-737.283] * [-738.429] (-741.074) (-743.972) (-737.971) -- 0:00:29
Average standard deviation of split frequencies: 0.016122
515500 -- (-738.449) (-738.537) [-737.483] (-736.612) * (-739.799) (-741.050) [-744.239] (-740.213) -- 0:00:29
516000 -- (-738.632) [-736.125] (-738.107) (-736.109) * [-736.399] (-737.373) (-739.026) (-739.889) -- 0:00:29
516500 -- (-740.821) (-738.021) (-738.511) [-736.378] * (-737.744) [-737.494] (-740.654) (-738.082) -- 0:00:29
517000 -- (-738.035) [-737.129] (-738.550) (-736.580) * [-739.314] (-739.627) (-741.359) (-738.928) -- 0:00:28
517500 -- (-740.681) (-738.811) (-736.626) [-736.428] * (-740.003) [-738.925] (-738.520) (-739.993) -- 0:00:28
518000 -- (-738.583) [-740.886] (-737.335) (-737.008) * (-737.695) (-740.556) (-740.401) [-736.766] -- 0:00:28
518500 -- [-738.629] (-739.721) (-738.355) (-736.268) * (-737.715) (-738.307) (-743.444) [-738.076] -- 0:00:28
519000 -- (-741.654) (-737.160) (-741.199) [-736.664] * (-737.651) (-740.884) (-737.743) [-736.240] -- 0:00:28
519500 -- (-738.895) (-739.760) [-738.942] (-738.114) * [-739.579] (-736.555) (-740.594) (-737.303) -- 0:00:28
520000 -- (-738.984) (-738.482) [-742.397] (-737.251) * (-737.223) (-736.312) (-740.338) [-738.444] -- 0:00:28
Average standard deviation of split frequencies: 0.015764
520500 -- [-737.536] (-741.594) (-739.235) (-735.754) * [-738.076] (-738.893) (-738.560) (-739.643) -- 0:00:28
521000 -- (-737.401) (-737.189) [-740.383] (-737.190) * [-737.206] (-739.785) (-738.180) (-738.990) -- 0:00:28
521500 -- (-736.025) [-736.366] (-741.961) (-736.232) * (-738.701) (-741.047) (-738.625) [-736.057] -- 0:00:28
522000 -- [-736.578] (-736.724) (-738.472) (-741.924) * (-741.627) [-738.224] (-743.679) (-737.525) -- 0:00:28
522500 -- (-736.059) (-736.948) [-736.037] (-736.731) * (-740.489) (-737.801) (-738.577) [-741.249] -- 0:00:28
523000 -- (-736.802) [-736.627] (-738.659) (-737.244) * [-737.995] (-739.795) (-742.514) (-740.136) -- 0:00:28
523500 -- (-737.617) [-735.725] (-738.777) (-736.119) * [-738.563] (-737.315) (-738.642) (-741.108) -- 0:00:28
524000 -- [-737.156] (-739.111) (-739.416) (-736.286) * [-737.995] (-737.899) (-738.459) (-738.148) -- 0:00:28
524500 -- (-740.103) [-736.174] (-736.229) (-736.303) * [-736.507] (-738.533) (-738.386) (-737.992) -- 0:00:28
525000 -- (-736.512) (-737.933) (-737.677) [-737.175] * (-735.945) (-739.591) (-737.796) [-737.245] -- 0:00:28
Average standard deviation of split frequencies: 0.015833
525500 -- (-739.168) [-738.778] (-739.941) (-736.798) * (-743.882) (-739.596) (-738.135) [-736.928] -- 0:00:27
526000 -- (-737.024) [-737.669] (-738.140) (-736.877) * (-743.852) [-736.310] (-743.083) (-736.839) -- 0:00:27
526500 -- [-739.024] (-737.267) (-741.143) (-736.997) * (-739.326) [-737.642] (-739.037) (-737.362) -- 0:00:27
527000 -- [-736.543] (-739.613) (-737.483) (-738.210) * (-741.380) (-741.421) (-736.962) [-736.650] -- 0:00:27
527500 -- (-736.886) (-738.004) [-740.727] (-743.333) * (-740.146) (-739.172) (-736.403) [-739.653] -- 0:00:27
528000 -- (-738.840) (-741.477) [-736.441] (-737.499) * (-740.540) (-737.886) [-738.113] (-739.652) -- 0:00:28
528500 -- (-737.467) (-739.175) (-738.118) [-737.596] * (-739.689) [-735.964] (-736.734) (-740.207) -- 0:00:28
529000 -- (-739.347) (-738.861) (-737.574) [-738.691] * [-736.086] (-736.612) (-736.215) (-738.205) -- 0:00:28
529500 -- (-736.796) (-740.222) (-737.014) [-736.915] * [-736.670] (-737.056) (-739.725) (-738.514) -- 0:00:28
530000 -- (-738.095) (-737.260) (-739.382) [-740.308] * [-738.963] (-738.475) (-740.371) (-738.020) -- 0:00:28
Average standard deviation of split frequencies: 0.015663
530500 -- (-736.962) (-736.275) (-740.045) [-738.672] * (-740.647) (-737.604) [-736.586] (-739.158) -- 0:00:28
531000 -- (-736.207) [-738.875] (-738.284) (-739.396) * (-738.541) (-737.824) (-736.269) [-736.944] -- 0:00:28
531500 -- (-736.634) (-736.178) (-737.376) [-738.020] * (-742.729) (-741.607) (-737.974) [-737.511] -- 0:00:28
532000 -- (-737.193) (-737.066) (-736.772) [-736.578] * (-737.216) (-737.920) (-737.153) [-737.249] -- 0:00:28
532500 -- (-737.921) (-736.097) (-737.502) [-736.294] * (-739.012) (-736.337) (-739.608) [-736.617] -- 0:00:28
533000 -- [-738.309] (-737.768) (-739.243) (-736.527) * (-740.360) (-740.260) (-741.451) [-739.283] -- 0:00:28
533500 -- (-739.089) (-736.787) [-740.018] (-737.628) * [-738.082] (-739.371) (-737.066) (-738.829) -- 0:00:27
534000 -- (-737.265) (-736.596) (-736.458) [-738.510] * (-741.145) (-740.729) (-736.804) [-736.950] -- 0:00:27
534500 -- (-739.423) (-738.737) (-737.586) [-738.717] * [-742.006] (-737.837) (-737.899) (-736.866) -- 0:00:27
535000 -- [-737.711] (-740.285) (-738.490) (-736.995) * (-737.452) (-739.333) [-739.998] (-739.195) -- 0:00:27
Average standard deviation of split frequencies: 0.016247
535500 -- (-739.064) [-740.646] (-741.516) (-738.328) * (-736.741) (-738.180) (-739.147) [-737.256] -- 0:00:27
536000 -- [-737.581] (-737.487) (-739.229) (-738.523) * (-736.895) [-737.741] (-737.767) (-741.935) -- 0:00:27
536500 -- (-738.777) (-737.602) [-739.283] (-740.980) * (-736.669) (-738.962) [-739.016] (-738.524) -- 0:00:27
537000 -- (-737.922) [-736.724] (-739.517) (-737.316) * [-737.964] (-738.402) (-736.628) (-735.980) -- 0:00:27
537500 -- (-740.751) (-736.663) [-738.737] (-740.222) * (-739.376) (-735.701) (-740.914) [-737.445] -- 0:00:27
538000 -- [-737.721] (-735.775) (-741.515) (-738.344) * (-737.309) (-735.646) (-737.114) [-741.059] -- 0:00:27
538500 -- (-737.153) (-737.034) (-739.126) [-736.849] * [-739.353] (-736.755) (-738.692) (-738.430) -- 0:00:27
539000 -- (-737.791) (-737.462) (-736.635) [-736.303] * (-739.884) (-737.658) (-737.313) [-738.188] -- 0:00:27
539500 -- [-737.504] (-736.715) (-739.153) (-737.214) * (-736.436) (-736.208) [-740.149] (-741.155) -- 0:00:27
540000 -- (-738.946) (-736.820) (-737.913) [-739.709] * (-737.310) [-736.134] (-737.343) (-745.178) -- 0:00:27
Average standard deviation of split frequencies: 0.016178
540500 -- (-738.386) [-735.694] (-742.627) (-738.123) * (-737.884) [-736.831] (-736.382) (-739.124) -- 0:00:27
541000 -- (-739.288) (-737.048) (-738.312) [-739.043] * (-736.513) (-740.189) (-737.101) [-736.908] -- 0:00:27
541500 -- [-736.731] (-738.840) (-740.684) (-745.018) * (-737.486) [-738.162] (-738.444) (-739.144) -- 0:00:27
542000 -- (-736.923) (-737.024) [-738.199] (-743.138) * (-738.184) (-738.085) [-735.570] (-737.250) -- 0:00:27
542500 -- (-737.301) (-743.129) (-737.114) [-738.766] * (-737.255) [-738.877] (-736.969) (-737.250) -- 0:00:26
543000 -- (-739.268) [-737.076] (-740.848) (-736.697) * (-737.087) [-736.123] (-739.538) (-737.495) -- 0:00:26
543500 -- (-737.950) [-738.620] (-745.435) (-736.469) * (-740.597) (-735.809) [-737.865] (-736.187) -- 0:00:26
544000 -- (-737.287) (-736.877) (-742.101) [-737.866] * (-736.250) (-738.818) (-737.549) [-736.972] -- 0:00:26
544500 -- (-735.777) (-738.331) (-740.744) [-737.776] * (-736.653) (-737.062) (-738.129) [-737.720] -- 0:00:27
545000 -- [-739.270] (-739.858) (-738.598) (-736.690) * (-735.982) (-737.922) (-738.448) [-736.271] -- 0:00:27
Average standard deviation of split frequencies: 0.016404
545500 -- (-737.158) [-738.205] (-740.245) (-738.730) * [-740.235] (-736.502) (-737.034) (-737.745) -- 0:00:27
546000 -- (-737.938) (-736.803) (-739.087) [-739.134] * [-739.620] (-739.026) (-741.001) (-738.962) -- 0:00:27
546500 -- (-740.946) (-738.210) [-736.532] (-735.982) * (-736.438) (-736.287) [-738.087] (-739.061) -- 0:00:27
547000 -- (-740.229) (-743.684) [-736.412] (-738.974) * (-736.562) [-736.590] (-745.429) (-739.644) -- 0:00:27
547500 -- (-737.256) (-738.417) (-737.056) [-740.077] * [-737.463] (-735.898) (-741.079) (-736.733) -- 0:00:27
548000 -- [-738.809] (-736.287) (-739.530) (-739.843) * (-735.873) [-737.182] (-738.148) (-743.774) -- 0:00:27
548500 -- (-739.728) (-735.727) (-737.076) [-740.702] * (-737.699) [-738.045] (-739.028) (-739.466) -- 0:00:27
549000 -- (-738.009) (-736.330) [-737.936] (-743.378) * (-736.517) [-736.507] (-738.088) (-739.924) -- 0:00:27
549500 -- (-736.808) (-738.059) (-737.451) [-736.007] * (-739.825) (-739.781) [-737.977] (-737.579) -- 0:00:27
550000 -- (-736.804) (-739.959) (-736.203) [-736.295] * (-738.159) [-737.324] (-739.625) (-738.671) -- 0:00:27
Average standard deviation of split frequencies: 0.015409
550500 -- (-736.994) [-738.606] (-737.939) (-738.541) * (-737.009) (-746.362) (-738.676) [-737.598] -- 0:00:26
551000 -- (-736.395) (-736.113) [-736.950] (-739.397) * [-737.070] (-740.678) (-738.803) (-737.311) -- 0:00:26
551500 -- (-737.963) (-736.217) [-736.652] (-735.728) * (-739.023) (-736.855) [-738.612] (-738.493) -- 0:00:26
552000 -- (-737.912) [-737.064] (-738.661) (-737.054) * (-742.172) (-737.376) (-740.664) [-738.387] -- 0:00:26
552500 -- (-738.921) (-740.117) (-738.496) [-739.866] * (-737.732) [-737.615] (-740.431) (-738.456) -- 0:00:26
553000 -- (-737.069) (-736.523) [-738.269] (-739.652) * (-736.478) [-736.991] (-740.409) (-738.511) -- 0:00:26
553500 -- [-738.193] (-736.034) (-739.278) (-737.243) * [-736.586] (-736.153) (-738.296) (-738.111) -- 0:00:26
554000 -- (-736.381) (-736.607) (-736.422) [-736.839] * [-737.286] (-737.264) (-738.122) (-742.652) -- 0:00:26
554500 -- (-736.132) (-736.614) (-736.442) [-738.383] * (-737.883) (-736.638) (-740.319) [-737.144] -- 0:00:26
555000 -- (-737.243) (-737.627) [-738.703] (-737.610) * (-737.980) (-738.090) (-739.519) [-736.612] -- 0:00:26
Average standard deviation of split frequencies: 0.015012
555500 -- (-736.570) [-737.774] (-737.796) (-737.596) * (-738.178) [-739.349] (-739.122) (-736.234) -- 0:00:26
556000 -- (-738.259) (-742.597) [-738.140] (-739.235) * (-736.916) [-735.873] (-737.135) (-740.239) -- 0:00:26
556500 -- [-741.828] (-739.878) (-737.283) (-736.691) * (-738.690) (-741.901) [-740.895] (-736.530) -- 0:00:26
557000 -- (-741.319) (-738.462) (-736.692) [-737.129] * (-736.105) [-735.899] (-737.921) (-738.326) -- 0:00:26
557500 -- (-736.502) (-736.896) [-738.816] (-738.163) * (-740.132) (-741.515) [-736.256] (-742.111) -- 0:00:26
558000 -- (-737.249) [-737.045] (-737.515) (-742.932) * [-743.933] (-736.399) (-736.848) (-736.785) -- 0:00:26
558500 -- (-737.327) (-738.500) (-743.255) [-745.321] * (-737.254) (-736.577) (-737.211) [-737.855] -- 0:00:26
559000 -- (-736.227) (-738.622) [-739.458] (-740.558) * (-737.159) (-738.619) (-739.263) [-736.602] -- 0:00:26
559500 -- (-737.501) [-736.358] (-737.147) (-736.355) * (-739.670) [-738.731] (-738.694) (-739.710) -- 0:00:25
560000 -- (-739.484) [-738.048] (-736.284) (-742.213) * [-738.538] (-737.325) (-737.845) (-740.216) -- 0:00:25
Average standard deviation of split frequencies: 0.015085
560500 -- (-737.398) [-736.547] (-740.939) (-738.920) * (-739.337) [-737.321] (-736.522) (-737.559) -- 0:00:25
561000 -- (-737.793) (-736.470) (-739.020) [-737.027] * (-736.864) (-737.840) [-738.194] (-737.502) -- 0:00:25
561500 -- (-738.845) [-737.140] (-739.501) (-735.687) * [-738.839] (-740.232) (-737.622) (-737.721) -- 0:00:26
562000 -- [-738.061] (-736.801) (-737.976) (-739.244) * (-738.128) [-739.059] (-739.311) (-736.668) -- 0:00:26
562500 -- (-736.434) (-735.791) [-736.326] (-740.553) * (-740.136) [-738.000] (-738.061) (-739.680) -- 0:00:26
563000 -- (-737.422) [-736.303] (-736.334) (-741.517) * (-738.280) [-738.771] (-737.733) (-737.493) -- 0:00:26
563500 -- (-739.165) [-738.042] (-739.365) (-739.231) * (-740.141) (-738.912) [-738.862] (-736.419) -- 0:00:26
564000 -- (-736.225) [-739.165] (-739.814) (-736.220) * (-739.187) [-737.009] (-738.394) (-737.442) -- 0:00:26
564500 -- (-735.739) (-737.226) (-736.472) [-736.898] * [-739.959] (-736.364) (-739.924) (-736.720) -- 0:00:26
565000 -- (-735.773) (-737.514) [-737.567] (-739.400) * (-740.921) (-741.965) (-737.504) [-739.897] -- 0:00:26
Average standard deviation of split frequencies: 0.015041
565500 -- (-740.036) [-736.414] (-736.821) (-738.252) * (-740.716) (-738.846) (-740.134) [-738.158] -- 0:00:26
566000 -- [-738.373] (-739.436) (-736.960) (-736.271) * [-736.754] (-737.668) (-738.660) (-738.945) -- 0:00:26
566500 -- (-737.819) (-738.306) (-737.144) [-739.375] * [-738.560] (-738.241) (-738.177) (-736.966) -- 0:00:26
567000 -- [-736.582] (-739.910) (-736.539) (-736.256) * (-739.509) [-735.668] (-736.910) (-737.087) -- 0:00:25
567500 -- (-738.250) (-739.518) [-742.314] (-738.249) * (-736.420) [-736.435] (-739.221) (-738.996) -- 0:00:25
568000 -- (-736.960) (-736.659) (-741.157) [-737.302] * [-736.885] (-737.566) (-740.916) (-739.551) -- 0:00:25
568500 -- [-737.478] (-736.486) (-737.391) (-739.957) * (-737.062) (-736.604) [-737.538] (-736.697) -- 0:00:25
569000 -- (-738.792) (-736.896) (-736.977) [-735.965] * (-738.442) (-736.616) [-738.212] (-737.814) -- 0:00:25
569500 -- (-740.054) [-738.258] (-737.838) (-738.317) * (-736.429) (-738.495) (-736.704) [-737.926] -- 0:00:25
570000 -- (-739.458) (-740.683) (-737.953) [-736.593] * (-737.615) (-738.620) (-736.731) [-736.577] -- 0:00:25
Average standard deviation of split frequencies: 0.015063
570500 -- [-737.072] (-737.150) (-737.959) (-738.012) * (-736.276) [-735.691] (-740.534) (-741.198) -- 0:00:25
571000 -- (-737.073) (-739.043) (-740.155) [-741.476] * (-737.536) (-737.592) (-739.427) [-737.187] -- 0:00:25
571500 -- (-735.796) (-738.332) [-737.192] (-737.498) * (-738.057) (-737.043) (-738.893) [-736.477] -- 0:00:25
572000 -- (-738.799) (-738.315) [-740.491] (-736.469) * (-740.037) [-738.214] (-737.596) (-737.341) -- 0:00:25
572500 -- [-736.103] (-742.310) (-743.323) (-737.449) * (-737.607) (-736.898) (-739.737) [-737.395] -- 0:00:25
573000 -- (-737.189) (-738.956) [-739.004] (-739.446) * [-739.540] (-736.886) (-738.751) (-742.254) -- 0:00:25
573500 -- [-737.100] (-740.277) (-736.787) (-737.432) * (-740.747) (-736.212) (-739.480) [-741.855] -- 0:00:25
574000 -- (-741.306) (-738.759) [-736.339] (-738.285) * [-739.457] (-736.841) (-735.936) (-736.872) -- 0:00:25
574500 -- (-737.663) [-737.902] (-740.232) (-737.351) * (-738.011) (-737.745) [-736.545] (-738.598) -- 0:00:25
575000 -- (-735.574) (-742.345) (-739.124) [-737.647] * (-738.855) (-740.006) [-737.087] (-736.633) -- 0:00:25
Average standard deviation of split frequencies: 0.014828
575500 -- [-737.233] (-737.801) (-739.389) (-740.832) * (-738.921) (-736.967) (-736.696) [-736.696] -- 0:00:25
576000 -- (-737.411) (-739.810) (-738.432) [-737.752] * (-738.031) (-737.179) [-738.460] (-740.960) -- 0:00:25
576500 -- (-738.970) [-737.539] (-738.689) (-737.433) * [-737.453] (-736.548) (-740.606) (-736.740) -- 0:00:24
577000 -- [-737.842] (-737.116) (-738.954) (-739.133) * [-737.809] (-737.116) (-739.574) (-738.723) -- 0:00:24
577500 -- (-738.354) (-739.910) [-737.372] (-740.482) * [-737.175] (-741.450) (-739.342) (-739.509) -- 0:00:24
578000 -- (-738.208) (-743.316) [-737.593] (-739.630) * (-739.403) [-740.218] (-737.424) (-739.279) -- 0:00:24
578500 -- (-737.542) (-742.825) [-735.962] (-741.244) * (-741.522) (-736.969) (-738.736) [-738.089] -- 0:00:25
579000 -- (-736.266) (-740.015) (-740.181) [-737.259] * (-737.148) (-740.457) [-736.595] (-736.383) -- 0:00:25
579500 -- (-737.326) (-737.081) (-739.918) [-737.202] * (-739.369) [-737.143] (-736.921) (-736.049) -- 0:00:25
580000 -- (-741.371) [-737.260] (-737.293) (-738.998) * (-739.761) (-735.769) (-736.775) [-736.656] -- 0:00:25
Average standard deviation of split frequencies: 0.014804
580500 -- [-737.451] (-736.404) (-737.976) (-740.919) * (-737.690) [-745.443] (-738.695) (-736.132) -- 0:00:25
581000 -- [-737.085] (-736.664) (-739.776) (-737.493) * (-738.333) (-736.855) [-735.729] (-736.372) -- 0:00:25
581500 -- (-736.923) (-738.985) [-739.310] (-738.958) * (-740.776) [-736.991] (-737.467) (-735.936) -- 0:00:25
582000 -- [-737.852] (-739.124) (-740.099) (-738.764) * [-737.772] (-736.417) (-736.635) (-737.040) -- 0:00:25
582500 -- (-739.077) (-739.962) [-738.733] (-737.112) * (-737.611) [-737.327] (-740.194) (-736.468) -- 0:00:25
583000 -- [-740.178] (-738.939) (-738.231) (-737.466) * (-739.146) (-738.305) (-738.929) [-737.000] -- 0:00:25
583500 -- (-740.353) (-738.897) (-736.532) [-737.312] * [-738.529] (-745.363) (-737.802) (-739.341) -- 0:00:24
584000 -- (-736.612) [-738.266] (-736.757) (-737.954) * (-738.337) (-736.489) [-740.029] (-736.155) -- 0:00:24
584500 -- (-740.116) [-736.558] (-742.409) (-737.723) * [-737.123] (-740.750) (-736.203) (-736.396) -- 0:00:24
585000 -- [-737.315] (-736.218) (-743.628) (-737.718) * [-738.620] (-739.022) (-738.575) (-741.668) -- 0:00:24
Average standard deviation of split frequencies: 0.014527
585500 -- (-740.758) (-740.138) [-739.925] (-742.679) * (-737.142) (-740.688) [-737.203] (-738.644) -- 0:00:24
586000 -- (-738.077) (-737.586) [-737.569] (-740.775) * [-738.319] (-738.656) (-736.367) (-735.999) -- 0:00:24
586500 -- [-739.090] (-739.781) (-737.345) (-737.329) * (-736.793) (-741.519) [-737.950] (-737.303) -- 0:00:24
587000 -- (-738.373) (-737.511) [-738.476] (-737.397) * (-736.717) (-741.813) (-737.796) [-737.970] -- 0:00:24
587500 -- (-737.972) (-737.141) [-737.879] (-736.923) * [-736.478] (-740.422) (-741.789) (-736.901) -- 0:00:24
588000 -- (-737.960) (-737.000) [-737.484] (-738.241) * (-737.984) (-739.510) [-737.219] (-738.948) -- 0:00:24
588500 -- (-737.945) [-737.664] (-737.124) (-739.563) * (-736.461) (-737.362) (-736.847) [-740.015] -- 0:00:24
589000 -- (-743.206) (-739.612) (-737.264) [-735.813] * (-738.099) (-740.877) (-738.058) [-737.998] -- 0:00:24
589500 -- (-738.492) (-736.871) [-737.343] (-738.498) * (-737.246) (-739.072) (-737.695) [-739.962] -- 0:00:24
590000 -- (-737.305) (-739.591) [-741.148] (-738.347) * (-737.823) [-737.508] (-738.297) (-738.187) -- 0:00:24
Average standard deviation of split frequencies: 0.014565
590500 -- (-737.452) (-738.239) (-736.955) [-735.768] * (-736.900) (-738.934) [-738.807] (-737.753) -- 0:00:24
591000 -- (-737.419) (-738.885) [-738.609] (-735.783) * [-737.924] (-736.105) (-739.220) (-736.485) -- 0:00:24
591500 -- (-737.924) (-741.189) (-740.826) [-739.808] * (-738.106) (-738.047) (-739.925) [-740.191] -- 0:00:24
592000 -- [-740.953] (-741.194) (-737.286) (-739.806) * (-738.106) (-737.766) [-737.252] (-739.519) -- 0:00:24
592500 -- [-738.837] (-741.410) (-738.477) (-736.778) * (-738.224) (-745.685) [-739.606] (-737.645) -- 0:00:24
593000 -- (-738.970) (-738.026) (-737.345) [-738.266] * (-737.362) (-746.654) [-737.135] (-736.055) -- 0:00:24
593500 -- [-737.268] (-738.232) (-737.731) (-736.955) * [-738.038] (-737.045) (-741.031) (-737.351) -- 0:00:23
594000 -- (-737.781) [-737.386] (-738.365) (-738.880) * (-739.122) [-739.152] (-737.617) (-736.389) -- 0:00:23
594500 -- (-737.528) [-738.455] (-739.056) (-739.605) * [-738.613] (-737.163) (-737.799) (-737.531) -- 0:00:23
595000 -- (-736.813) (-740.843) [-739.407] (-737.280) * (-745.478) (-737.225) (-739.047) [-739.763] -- 0:00:24
Average standard deviation of split frequencies: 0.013868
595500 -- [-737.562] (-736.152) (-737.596) (-736.154) * (-741.561) [-738.440] (-738.367) (-738.673) -- 0:00:24
596000 -- [-743.420] (-739.523) (-738.601) (-736.561) * (-736.633) (-738.614) (-737.658) [-736.925] -- 0:00:24
596500 -- (-737.694) (-738.530) (-740.944) [-738.526] * [-739.835] (-738.184) (-737.727) (-737.131) -- 0:00:24
597000 -- (-737.702) [-740.229] (-737.285) (-737.023) * (-737.105) (-736.525) (-738.828) [-737.418] -- 0:00:24
597500 -- (-738.058) [-739.116] (-736.430) (-738.953) * (-744.115) [-737.264] (-738.437) (-743.292) -- 0:00:24
598000 -- (-737.741) [-736.348] (-736.443) (-737.075) * (-736.875) (-736.513) (-737.844) [-736.407] -- 0:00:24
598500 -- [-736.010] (-737.807) (-739.061) (-738.269) * (-736.757) (-740.239) (-737.674) [-739.844] -- 0:00:24
599000 -- (-738.918) (-736.364) [-739.524] (-736.289) * [-738.714] (-736.381) (-739.422) (-738.156) -- 0:00:24
599500 -- (-738.568) [-743.428] (-739.279) (-739.432) * (-736.330) (-737.292) (-740.648) [-740.962] -- 0:00:24
600000 -- (-740.197) (-738.160) [-738.663] (-739.454) * (-736.716) [-736.230] (-737.170) (-736.660) -- 0:00:24
Average standard deviation of split frequencies: 0.013603
600500 -- (-738.268) (-739.768) (-737.208) [-739.975] * (-736.042) [-738.389] (-736.267) (-736.875) -- 0:00:23
601000 -- [-736.777] (-740.276) (-738.785) (-736.888) * (-736.387) (-738.232) [-737.747] (-744.066) -- 0:00:23
601500 -- (-736.134) (-738.321) (-740.235) [-737.472] * (-737.594) [-737.544] (-736.854) (-736.851) -- 0:00:23
602000 -- (-735.812) [-737.496] (-738.556) (-736.935) * (-738.713) [-739.266] (-737.626) (-736.635) -- 0:00:23
602500 -- (-736.111) (-739.148) (-738.597) [-736.287] * (-738.733) (-736.739) (-741.033) [-736.945] -- 0:00:23
603000 -- (-740.555) (-737.033) [-739.188] (-736.895) * [-739.141] (-737.165) (-740.381) (-737.401) -- 0:00:23
603500 -- [-736.527] (-737.238) (-738.682) (-737.686) * (-738.505) (-736.726) (-738.252) [-739.307] -- 0:00:23
604000 -- (-736.567) (-742.221) [-740.573] (-738.029) * [-739.533] (-737.761) (-737.545) (-737.066) -- 0:00:23
604500 -- [-737.727] (-740.399) (-741.525) (-737.658) * (-739.923) (-736.818) [-736.114] (-737.045) -- 0:00:23
605000 -- (-737.576) (-740.275) (-742.016) [-737.465] * [-737.266] (-737.802) (-742.134) (-738.288) -- 0:00:23
Average standard deviation of split frequencies: 0.014106
605500 -- (-737.346) (-740.197) [-739.682] (-744.925) * (-737.174) [-738.988] (-737.298) (-736.978) -- 0:00:23
606000 -- [-741.519] (-738.482) (-738.784) (-740.466) * [-737.844] (-737.202) (-736.424) (-738.288) -- 0:00:23
606500 -- (-741.156) [-738.676] (-737.370) (-737.333) * (-736.641) [-738.241] (-740.666) (-737.822) -- 0:00:23
607000 -- [-737.589] (-737.369) (-738.372) (-740.060) * [-736.807] (-736.650) (-737.590) (-737.507) -- 0:00:23
607500 -- (-736.365) [-737.780] (-738.057) (-739.340) * [-740.088] (-738.942) (-737.950) (-741.184) -- 0:00:23
608000 -- (-737.115) (-739.035) [-737.898] (-736.692) * (-741.719) [-741.796] (-741.091) (-739.490) -- 0:00:23
608500 -- (-740.395) [-737.097] (-739.872) (-736.389) * (-740.245) (-740.282) (-738.247) [-740.412] -- 0:00:23
609000 -- (-741.984) (-737.557) (-737.501) [-736.348] * (-742.774) (-739.963) [-737.988] (-739.909) -- 0:00:23
609500 -- (-738.900) (-738.633) [-737.671] (-739.084) * [-738.942] (-736.835) (-739.321) (-737.592) -- 0:00:23
610000 -- (-735.914) [-737.755] (-737.253) (-736.672) * (-738.609) (-737.582) (-738.187) [-738.089] -- 0:00:23
Average standard deviation of split frequencies: 0.013844
610500 -- (-739.304) [-737.161] (-735.551) (-738.283) * (-741.735) (-738.287) (-737.541) [-738.435] -- 0:00:22
611000 -- (-741.753) (-737.157) [-736.601] (-736.966) * (-739.789) [-736.859] (-738.149) (-737.244) -- 0:00:22
611500 -- (-740.579) [-735.968] (-736.616) (-737.282) * (-740.392) [-739.463] (-737.379) (-739.541) -- 0:00:22
612000 -- (-736.529) [-738.329] (-741.644) (-736.124) * (-737.556) (-739.253) (-736.334) [-736.227] -- 0:00:23
612500 -- (-736.254) [-739.563] (-739.354) (-737.401) * (-736.783) (-736.920) (-736.055) [-740.718] -- 0:00:23
613000 -- (-739.956) (-742.642) (-736.195) [-738.336] * (-736.629) (-736.924) [-738.728] (-737.794) -- 0:00:23
613500 -- (-741.140) (-737.694) [-738.407] (-738.164) * (-740.352) (-740.627) (-739.335) [-737.584] -- 0:00:23
614000 -- (-739.219) (-739.681) (-738.670) [-739.153] * (-736.652) [-738.065] (-739.791) (-740.438) -- 0:00:23
614500 -- (-736.435) (-738.204) (-737.270) [-735.801] * [-736.627] (-738.963) (-736.559) (-740.230) -- 0:00:23
615000 -- [-736.949] (-737.449) (-737.682) (-737.236) * (-736.346) (-737.119) (-736.528) [-740.313] -- 0:00:23
Average standard deviation of split frequencies: 0.013316
615500 -- (-738.120) (-741.080) [-736.357] (-738.027) * [-736.654] (-736.096) (-741.799) (-739.637) -- 0:00:23
616000 -- (-738.638) (-737.087) (-736.671) [-736.433] * [-737.573] (-736.757) (-736.622) (-738.327) -- 0:00:23
616500 -- [-737.126] (-736.910) (-742.372) (-739.873) * (-736.157) (-738.213) [-736.726] (-740.834) -- 0:00:23
617000 -- (-739.574) [-736.800] (-735.865) (-736.955) * (-736.871) (-739.626) (-736.577) [-737.704] -- 0:00:22
617500 -- [-735.930] (-737.201) (-737.455) (-737.464) * [-737.014] (-739.103) (-737.857) (-740.079) -- 0:00:22
618000 -- (-736.166) (-737.056) (-736.808) [-736.512] * (-736.354) (-742.874) (-738.237) [-737.746] -- 0:00:22
618500 -- (-739.452) (-739.226) (-738.188) [-736.632] * (-738.975) [-737.817] (-737.677) (-738.683) -- 0:00:22
619000 -- (-736.473) (-739.767) (-742.838) [-739.137] * (-736.084) (-736.762) [-738.941] (-738.906) -- 0:00:22
619500 -- [-736.418] (-736.849) (-736.766) (-739.425) * (-736.880) (-740.683) [-738.275] (-736.567) -- 0:00:22
620000 -- (-741.564) (-739.386) (-738.983) [-736.556] * (-739.184) (-736.320) (-736.834) [-737.216] -- 0:00:22
Average standard deviation of split frequencies: 0.012861
620500 -- [-736.827] (-736.929) (-738.371) (-736.513) * (-737.891) [-738.039] (-739.024) (-736.204) -- 0:00:22
621000 -- [-737.004] (-737.414) (-737.022) (-737.595) * [-736.113] (-741.934) (-736.471) (-737.095) -- 0:00:22
621500 -- (-739.733) (-738.514) [-736.174] (-736.173) * (-738.131) (-737.097) [-738.562] (-740.489) -- 0:00:22
622000 -- (-740.750) (-737.921) [-736.272] (-737.787) * (-738.453) (-738.938) [-736.160] (-738.391) -- 0:00:22
622500 -- [-737.786] (-737.617) (-736.663) (-739.708) * [-736.196] (-740.562) (-736.362) (-735.984) -- 0:00:22
623000 -- (-741.014) [-742.481] (-737.032) (-743.220) * (-736.348) (-737.664) (-737.316) [-737.007] -- 0:00:22
623500 -- (-739.015) (-739.598) [-735.765] (-743.517) * (-738.622) (-738.639) [-737.127] (-738.570) -- 0:00:22
624000 -- (-744.591) [-735.936] (-739.015) (-739.392) * (-743.963) (-737.572) (-735.850) [-737.338] -- 0:00:22
624500 -- (-739.528) [-737.013] (-738.766) (-739.958) * (-737.562) (-740.772) (-738.256) [-736.427] -- 0:00:22
625000 -- (-738.389) (-738.492) (-740.441) [-736.315] * [-737.986] (-738.263) (-741.720) (-738.881) -- 0:00:22
Average standard deviation of split frequencies: 0.013461
625500 -- [-739.287] (-737.390) (-743.293) (-737.812) * (-741.821) [-737.859] (-742.148) (-737.930) -- 0:00:22
626000 -- (-737.390) (-736.451) [-739.308] (-736.344) * [-738.625] (-745.760) (-737.795) (-739.641) -- 0:00:22
626500 -- (-741.574) (-735.850) (-737.165) [-736.691] * (-737.874) (-738.689) (-736.596) [-736.992] -- 0:00:22
627000 -- [-737.660] (-736.524) (-738.351) (-735.820) * [-736.234] (-742.556) (-740.408) (-737.913) -- 0:00:22
627500 -- (-738.789) [-739.850] (-742.263) (-737.423) * (-736.671) (-740.580) (-742.535) [-737.005] -- 0:00:21
628000 -- (-740.083) (-742.212) (-739.919) [-737.967] * (-736.414) (-740.119) (-737.634) [-736.546] -- 0:00:21
628500 -- [-738.351] (-738.612) (-737.858) (-737.188) * [-737.324] (-740.239) (-738.795) (-738.041) -- 0:00:22
629000 -- (-737.188) [-738.449] (-737.068) (-738.636) * (-737.587) (-739.029) (-738.278) [-738.760] -- 0:00:22
629500 -- [-739.348] (-743.555) (-737.740) (-738.933) * (-737.548) (-736.810) (-737.993) [-737.418] -- 0:00:22
630000 -- (-737.483) (-739.602) [-736.756] (-738.379) * [-737.727] (-743.148) (-741.802) (-740.198) -- 0:00:22
Average standard deviation of split frequencies: 0.013221
630500 -- [-737.447] (-739.909) (-742.959) (-737.754) * (-740.181) (-743.922) (-740.195) [-741.201] -- 0:00:22
631000 -- (-743.807) (-742.199) [-737.365] (-735.762) * [-740.336] (-741.047) (-739.050) (-739.248) -- 0:00:22
631500 -- (-738.282) (-736.083) [-739.338] (-737.266) * (-739.093) (-737.094) (-736.819) [-737.565] -- 0:00:22
632000 -- (-738.133) (-738.726) [-736.902] (-738.607) * (-739.676) [-737.365] (-737.498) (-739.222) -- 0:00:22
632500 -- [-737.145] (-738.513) (-737.251) (-737.853) * [-736.772] (-736.238) (-741.056) (-741.230) -- 0:00:22
633000 -- (-737.569) (-736.957) (-738.114) [-737.207] * (-739.131) (-737.583) [-738.468] (-736.135) -- 0:00:22
633500 -- [-738.287] (-741.600) (-736.432) (-738.613) * [-739.997] (-742.846) (-738.234) (-736.104) -- 0:00:21
634000 -- (-739.871) [-739.060] (-741.428) (-738.139) * (-740.919) [-737.787] (-739.226) (-740.998) -- 0:00:21
634500 -- (-743.074) (-737.094) [-735.843] (-739.475) * (-742.808) [-736.634] (-737.318) (-740.131) -- 0:00:21
635000 -- (-739.338) (-739.229) [-737.126] (-739.528) * (-737.792) [-736.629] (-737.179) (-741.065) -- 0:00:21
Average standard deviation of split frequencies: 0.013243
635500 -- (-742.787) [-737.300] (-737.489) (-740.290) * (-739.584) [-736.931] (-736.715) (-738.119) -- 0:00:21
636000 -- (-738.578) (-738.507) (-739.071) [-737.697] * (-738.398) [-736.153] (-740.729) (-738.221) -- 0:00:21
636500 -- [-737.293] (-743.726) (-739.470) (-738.590) * (-739.428) (-736.005) [-739.682] (-738.279) -- 0:00:21
637000 -- (-737.410) [-737.221] (-735.921) (-740.771) * (-743.002) (-736.101) [-736.998] (-738.997) -- 0:00:21
637500 -- (-738.885) [-738.751] (-739.286) (-744.739) * (-740.888) (-739.561) [-736.481] (-739.998) -- 0:00:21
638000 -- [-736.309] (-738.583) (-738.215) (-736.858) * (-749.892) (-737.271) (-735.735) [-741.411] -- 0:00:21
638500 -- (-738.653) [-736.701] (-739.786) (-737.768) * (-743.203) (-736.334) (-737.684) [-742.453] -- 0:00:21
639000 -- (-737.807) (-737.138) [-739.236] (-738.574) * (-739.617) (-739.237) (-737.112) [-736.206] -- 0:00:21
639500 -- (-737.168) (-737.328) (-739.882) [-738.448] * (-737.862) (-740.490) (-735.983) [-737.563] -- 0:00:21
640000 -- (-735.794) (-737.855) (-739.320) [-735.942] * (-736.357) (-739.117) (-737.653) [-736.355] -- 0:00:21
Average standard deviation of split frequencies: 0.013244
640500 -- [-735.900] (-736.271) (-738.351) (-737.315) * (-739.616) (-737.923) [-736.404] (-736.924) -- 0:00:21
641000 -- [-737.720] (-736.200) (-738.374) (-743.676) * (-740.751) (-739.966) [-736.590] (-739.085) -- 0:00:21
641500 -- [-738.000] (-736.501) (-739.572) (-737.865) * (-742.946) (-742.243) [-738.137] (-739.294) -- 0:00:21
642000 -- [-738.431] (-736.581) (-739.212) (-737.061) * (-739.788) [-738.221] (-738.611) (-740.640) -- 0:00:21
642500 -- (-738.588) [-735.817] (-742.089) (-736.859) * (-735.666) (-737.417) [-737.439] (-737.986) -- 0:00:21
643000 -- (-738.826) (-736.061) (-738.892) [-736.377] * (-738.902) (-736.287) (-739.296) [-737.607] -- 0:00:21
643500 -- [-741.073] (-738.715) (-742.710) (-743.463) * (-737.127) (-736.909) [-737.447] (-737.310) -- 0:00:21
644000 -- (-737.863) (-737.198) [-739.869] (-737.149) * (-738.741) (-736.902) [-737.383] (-738.436) -- 0:00:21
644500 -- (-739.021) (-739.420) (-739.639) [-736.640] * (-739.310) (-737.632) (-736.000) [-736.241] -- 0:00:20
645000 -- (-736.507) [-737.921] (-742.743) (-736.798) * (-736.750) (-736.901) (-737.503) [-735.733] -- 0:00:20
Average standard deviation of split frequencies: 0.012649
645500 -- [-740.437] (-743.881) (-737.796) (-736.665) * [-741.183] (-737.456) (-736.193) (-741.049) -- 0:00:21
646000 -- (-738.405) (-747.660) [-741.224] (-735.969) * (-740.374) (-739.102) [-736.708] (-738.438) -- 0:00:21
646500 -- (-738.237) (-742.741) (-738.277) [-738.612] * (-742.242) [-741.369] (-736.456) (-739.236) -- 0:00:21
647000 -- (-739.630) (-745.216) [-738.960] (-735.806) * (-739.499) [-739.145] (-737.873) (-739.160) -- 0:00:21
647500 -- [-737.707] (-738.557) (-740.327) (-738.842) * (-739.274) [-737.592] (-737.776) (-738.236) -- 0:00:21
648000 -- (-737.373) (-736.536) [-740.068] (-736.753) * (-739.712) [-737.143] (-737.147) (-739.241) -- 0:00:21
648500 -- (-742.994) (-736.772) (-741.085) [-744.990] * [-736.503] (-738.815) (-737.423) (-738.266) -- 0:00:21
649000 -- (-737.274) (-739.745) (-738.021) [-737.381] * (-736.624) (-736.195) [-739.271] (-736.771) -- 0:00:21
649500 -- (-737.630) (-738.233) [-737.197] (-738.325) * (-736.493) (-738.232) [-737.604] (-737.536) -- 0:00:21
650000 -- (-736.445) (-739.789) (-736.279) [-736.265] * (-739.556) (-736.961) [-736.922] (-736.640) -- 0:00:21
Average standard deviation of split frequencies: 0.012558
650500 -- (-736.125) (-740.227) (-738.750) [-736.639] * (-739.394) (-738.292) (-737.594) [-736.730] -- 0:00:20
651000 -- (-736.558) (-740.266) (-736.278) [-736.345] * (-738.073) (-738.212) [-738.496] (-741.301) -- 0:00:20
651500 -- (-736.640) (-741.738) (-741.205) [-736.937] * [-738.402] (-736.260) (-737.812) (-741.031) -- 0:00:20
652000 -- [-737.583] (-738.934) (-737.106) (-740.290) * (-737.210) (-735.792) [-736.031] (-737.423) -- 0:00:20
652500 -- (-737.896) (-737.990) (-738.270) [-738.686] * (-738.309) (-737.602) (-736.292) [-737.336] -- 0:00:20
653000 -- (-736.557) (-737.794) [-736.615] (-740.836) * (-738.594) (-738.063) [-739.098] (-736.275) -- 0:00:20
653500 -- (-738.342) [-737.742] (-737.016) (-740.499) * (-739.312) (-739.246) (-739.492) [-740.051] -- 0:00:20
654000 -- (-737.005) (-737.817) [-738.682] (-738.183) * [-737.111] (-740.965) (-740.020) (-738.081) -- 0:00:20
654500 -- (-738.047) [-738.320] (-740.671) (-737.561) * (-738.986) (-738.339) [-736.771] (-740.730) -- 0:00:20
655000 -- (-740.510) (-736.570) (-738.857) [-738.024] * (-740.536) [-737.338] (-737.476) (-737.776) -- 0:00:20
Average standard deviation of split frequencies: 0.012552
655500 -- (-740.288) (-737.112) (-740.560) [-737.831] * (-746.541) (-736.849) (-737.551) [-736.935] -- 0:00:20
656000 -- (-736.754) [-736.841] (-738.880) (-736.488) * (-743.144) (-740.277) (-739.361) [-739.436] -- 0:00:20
656500 -- (-738.494) (-738.458) (-739.769) [-736.310] * (-737.800) [-738.024] (-740.426) (-738.678) -- 0:00:20
657000 -- (-738.381) [-737.905] (-736.340) (-739.711) * [-740.083] (-740.827) (-740.669) (-737.381) -- 0:00:20
657500 -- (-739.846) (-737.504) [-736.234] (-739.787) * (-740.290) (-738.656) (-740.234) [-738.863] -- 0:00:20
658000 -- (-740.008) (-737.634) [-737.313] (-740.849) * (-738.006) [-739.838] (-737.905) (-736.303) -- 0:00:20
658500 -- (-738.588) (-738.856) [-738.789] (-740.245) * (-738.946) [-739.017] (-736.450) (-735.993) -- 0:00:20
659000 -- (-737.409) [-736.996] (-737.537) (-738.931) * (-739.521) (-737.494) [-739.137] (-738.917) -- 0:00:20
659500 -- (-738.285) (-736.135) (-738.102) [-738.133] * (-737.528) (-737.891) [-738.511] (-739.184) -- 0:00:20
660000 -- (-739.300) [-736.148] (-739.318) (-739.368) * (-737.577) (-736.713) (-738.678) [-738.876] -- 0:00:20
Average standard deviation of split frequencies: 0.012130
660500 -- [-740.207] (-739.574) (-737.088) (-736.568) * [-738.728] (-737.787) (-736.644) (-736.564) -- 0:00:20
661000 -- (-737.910) (-736.955) [-737.518] (-736.514) * (-736.852) (-736.157) [-740.587] (-737.345) -- 0:00:20
661500 -- (-741.858) (-738.948) [-736.357] (-739.292) * [-737.083] (-739.355) (-740.727) (-738.968) -- 0:00:19
662000 -- (-740.042) (-739.196) (-736.463) [-738.271] * [-739.463] (-738.835) (-737.267) (-737.058) -- 0:00:20
662500 -- (-740.475) [-737.799] (-738.033) (-738.653) * (-741.421) (-739.091) [-736.313] (-738.413) -- 0:00:20
663000 -- (-736.324) (-739.065) (-737.500) [-739.012] * (-739.916) (-739.542) [-736.567] (-738.229) -- 0:00:20
663500 -- (-736.408) (-736.778) [-737.608] (-742.215) * (-739.563) [-737.938] (-737.856) (-739.962) -- 0:00:20
664000 -- (-736.422) (-736.681) (-740.016) [-737.661] * [-735.947] (-737.647) (-737.182) (-736.780) -- 0:00:20
664500 -- (-736.521) [-739.212] (-738.428) (-736.402) * (-740.972) [-737.252] (-738.041) (-736.329) -- 0:00:20
665000 -- (-740.890) [-739.579] (-738.393) (-735.967) * (-741.174) [-738.369] (-742.064) (-736.873) -- 0:00:20
Average standard deviation of split frequencies: 0.012343
665500 -- (-740.563) (-737.592) (-740.503) [-738.753] * (-741.253) (-738.769) [-741.860] (-737.571) -- 0:00:20
666000 -- (-738.400) (-738.184) (-737.399) [-738.010] * (-739.387) [-736.065] (-736.062) (-739.539) -- 0:00:20
666500 -- (-739.079) (-739.681) (-738.712) [-736.730] * (-736.697) (-737.770) (-740.367) [-738.163] -- 0:00:20
667000 -- (-738.636) (-742.314) (-738.785) [-738.581] * (-738.715) (-738.857) (-739.934) [-741.412] -- 0:00:19
667500 -- (-739.114) (-738.591) (-743.643) [-736.179] * (-742.929) (-738.275) [-736.269] (-739.012) -- 0:00:19
668000 -- (-737.539) (-737.680) (-742.276) [-737.841] * [-736.709] (-736.853) (-737.459) (-738.800) -- 0:00:19
668500 -- [-736.976] (-738.311) (-739.552) (-739.176) * (-739.442) (-739.137) (-738.065) [-737.396] -- 0:00:19
669000 -- (-736.504) (-737.814) (-737.356) [-739.903] * (-737.527) (-737.108) [-735.817] (-736.996) -- 0:00:19
669500 -- (-739.763) (-741.664) (-736.642) [-741.024] * [-737.085] (-736.406) (-736.145) (-740.831) -- 0:00:19
670000 -- (-737.429) [-735.966] (-736.727) (-738.905) * [-741.059] (-736.624) (-738.508) (-736.544) -- 0:00:19
Average standard deviation of split frequencies: 0.011510
670500 -- (-738.081) (-741.202) (-736.912) [-739.649] * (-742.338) [-739.270] (-736.119) (-742.879) -- 0:00:19
671000 -- [-736.716] (-736.349) (-737.421) (-736.636) * (-736.413) (-741.349) [-736.651] (-738.301) -- 0:00:19
671500 -- (-737.043) (-735.652) [-736.276] (-736.370) * (-738.657) (-740.656) [-736.601] (-739.329) -- 0:00:19
672000 -- [-737.855] (-736.814) (-738.232) (-736.526) * (-737.875) (-742.271) (-736.339) [-740.445] -- 0:00:19
672500 -- (-739.597) (-739.715) [-739.555] (-736.369) * (-737.797) (-740.458) (-736.900) [-737.504] -- 0:00:19
673000 -- (-736.808) (-740.206) [-736.797] (-738.279) * (-736.438) (-739.328) (-736.622) [-736.648] -- 0:00:19
673500 -- (-737.254) (-739.034) (-738.680) [-736.802] * (-736.776) (-740.593) (-737.231) [-737.162] -- 0:00:19
674000 -- (-740.216) [-736.495] (-736.184) (-737.389) * (-737.460) (-736.726) (-737.055) [-739.142] -- 0:00:19
674500 -- (-736.497) (-740.613) [-736.737] (-740.588) * (-738.449) (-736.614) [-736.551] (-736.480) -- 0:00:19
675000 -- (-737.165) (-738.259) (-739.055) [-736.533] * [-739.014] (-736.597) (-736.393) (-737.441) -- 0:00:19
Average standard deviation of split frequencies: 0.011114
675500 -- [-737.793] (-738.092) (-737.821) (-735.650) * (-736.246) (-737.376) [-739.050] (-740.019) -- 0:00:19
676000 -- [-742.864] (-738.804) (-737.166) (-735.889) * [-735.740] (-735.734) (-736.466) (-738.402) -- 0:00:19
676500 -- (-740.273) (-736.856) [-737.747] (-736.432) * [-741.861] (-735.745) (-740.233) (-740.501) -- 0:00:19
677000 -- [-738.618] (-737.380) (-737.306) (-736.676) * (-736.914) (-737.441) (-737.496) [-738.546] -- 0:00:19
677500 -- [-742.240] (-737.332) (-739.556) (-736.412) * [-739.744] (-745.681) (-739.081) (-743.057) -- 0:00:19
678000 -- [-737.075] (-740.586) (-737.967) (-738.658) * (-737.463) [-737.090] (-738.488) (-737.547) -- 0:00:18
678500 -- [-739.759] (-736.525) (-738.213) (-737.651) * (-737.076) (-735.821) (-737.383) [-736.695] -- 0:00:19
679000 -- (-737.309) (-737.061) (-737.360) [-737.572] * (-738.102) (-738.595) [-736.874] (-736.905) -- 0:00:19
679500 -- (-739.307) [-736.181] (-738.639) (-736.177) * (-737.100) (-736.826) (-736.000) [-739.589] -- 0:00:19
680000 -- (-736.507) (-736.141) (-738.792) [-736.656] * (-737.217) (-738.838) [-738.543] (-739.114) -- 0:00:19
Average standard deviation of split frequencies: 0.011471
680500 -- (-736.560) (-741.736) [-737.352] (-736.400) * [-736.108] (-736.330) (-739.044) (-739.893) -- 0:00:19
681000 -- (-736.538) (-736.865) [-738.073] (-742.168) * [-740.324] (-736.675) (-740.153) (-738.316) -- 0:00:19
681500 -- (-738.806) (-737.043) (-738.258) [-740.249] * (-738.041) (-736.675) (-736.463) [-738.275] -- 0:00:19
682000 -- (-737.945) [-740.392] (-738.696) (-736.445) * (-737.130) (-735.801) [-737.232] (-737.788) -- 0:00:19
682500 -- (-737.770) [-738.655] (-739.127) (-739.369) * (-737.687) (-737.610) [-740.934] (-737.629) -- 0:00:19
683000 -- (-737.772) [-736.459] (-737.667) (-739.750) * (-738.346) (-740.212) (-737.712) [-736.246] -- 0:00:19
683500 -- [-737.051] (-742.074) (-742.216) (-738.208) * (-735.951) [-739.476] (-737.070) (-736.399) -- 0:00:18
684000 -- [-736.477] (-738.149) (-736.760) (-737.136) * (-736.733) (-739.151) [-738.630] (-739.480) -- 0:00:18
684500 -- [-738.109] (-736.031) (-741.178) (-736.060) * (-739.372) (-737.752) (-736.522) [-738.387] -- 0:00:18
685000 -- (-742.590) [-738.274] (-740.660) (-737.179) * [-742.172] (-737.044) (-739.083) (-739.116) -- 0:00:18
Average standard deviation of split frequencies: 0.011682
685500 -- (-737.915) (-737.532) (-738.284) [-738.526] * (-739.251) (-742.053) (-737.406) [-736.744] -- 0:00:18
686000 -- (-738.037) (-737.629) [-740.632] (-739.539) * (-738.959) (-736.151) [-737.149] (-736.073) -- 0:00:18
686500 -- (-738.898) (-739.805) [-737.957] (-740.717) * [-737.617] (-737.166) (-739.651) (-736.647) -- 0:00:18
687000 -- (-737.073) (-739.027) [-736.540] (-738.104) * (-737.536) [-736.096] (-738.488) (-737.602) -- 0:00:18
687500 -- [-738.073] (-740.312) (-740.131) (-739.044) * (-738.755) (-739.231) [-739.625] (-736.927) -- 0:00:18
688000 -- (-736.481) (-736.931) [-738.897] (-736.706) * [-736.864] (-737.372) (-741.967) (-738.503) -- 0:00:18
688500 -- (-741.455) [-736.568] (-737.608) (-738.544) * [-736.487] (-739.396) (-743.224) (-736.165) -- 0:00:18
689000 -- [-739.448] (-741.426) (-736.813) (-736.530) * [-738.145] (-742.296) (-738.674) (-738.998) -- 0:00:18
689500 -- (-736.927) [-736.526] (-736.813) (-738.455) * [-738.388] (-736.825) (-736.293) (-740.161) -- 0:00:18
690000 -- (-742.097) (-738.159) [-739.922] (-736.996) * (-736.855) (-736.473) [-735.889] (-740.805) -- 0:00:18
Average standard deviation of split frequencies: 0.011987
690500 -- (-738.367) (-736.756) (-736.502) [-735.749] * [-737.211] (-737.938) (-738.158) (-738.410) -- 0:00:18
691000 -- (-735.529) (-736.990) (-740.454) [-736.325] * (-736.393) (-737.188) (-737.217) [-738.603] -- 0:00:18
691500 -- (-737.378) (-738.037) [-739.506] (-737.103) * (-736.150) (-737.748) [-737.218] (-741.510) -- 0:00:18
692000 -- (-737.250) (-739.393) (-738.963) [-736.308] * (-736.198) (-737.842) (-737.221) [-737.247] -- 0:00:18
692500 -- [-737.589] (-738.547) (-738.185) (-736.056) * (-737.485) (-741.149) [-736.375] (-737.368) -- 0:00:18
693000 -- (-739.182) (-738.072) [-737.187] (-737.852) * (-737.074) (-739.880) [-736.386] (-737.102) -- 0:00:18
693500 -- [-736.758] (-737.494) (-736.335) (-738.727) * [-736.551] (-738.690) (-737.275) (-736.301) -- 0:00:18
694000 -- (-735.993) (-736.902) (-740.429) [-737.341] * [-739.612] (-741.278) (-737.547) (-737.203) -- 0:00:18
694500 -- (-737.172) (-736.902) (-738.374) [-737.143] * (-742.090) [-737.833] (-738.150) (-735.974) -- 0:00:18
695000 -- (-738.745) [-736.657] (-737.209) (-738.597) * (-738.319) (-738.879) [-738.516] (-736.209) -- 0:00:17
Average standard deviation of split frequencies: 0.011952
695500 -- (-737.341) (-736.045) [-736.196] (-735.669) * (-737.776) (-739.939) [-738.846] (-736.457) -- 0:00:18
696000 -- (-742.558) [-739.528] (-735.947) (-736.556) * (-735.968) (-739.753) (-737.500) [-736.305] -- 0:00:18
696500 -- [-737.966] (-737.652) (-735.855) (-735.772) * [-739.679] (-736.174) (-739.556) (-739.741) -- 0:00:18
697000 -- (-737.983) (-738.390) (-736.782) [-736.768] * (-737.157) [-737.551] (-738.059) (-738.477) -- 0:00:18
697500 -- (-737.631) [-736.481] (-737.641) (-737.282) * (-738.019) (-738.714) (-738.757) [-736.177] -- 0:00:18
698000 -- (-738.170) [-739.725] (-738.524) (-736.839) * (-736.208) (-740.385) (-737.728) [-737.439] -- 0:00:18
698500 -- [-739.648] (-739.705) (-737.280) (-739.730) * (-736.201) [-739.286] (-736.801) (-736.622) -- 0:00:18
699000 -- [-736.753] (-737.746) (-739.416) (-737.778) * (-737.431) (-738.611) [-736.385] (-736.402) -- 0:00:18
699500 -- (-738.142) [-737.215] (-737.420) (-736.962) * (-738.059) [-737.869] (-738.971) (-736.838) -- 0:00:18
700000 -- [-737.203] (-736.775) (-737.345) (-744.856) * (-739.611) [-737.510] (-737.851) (-736.478) -- 0:00:18
Average standard deviation of split frequencies: 0.011992
700500 -- [-739.997] (-735.617) (-737.895) (-739.635) * (-737.957) [-737.534] (-737.584) (-736.272) -- 0:00:17
701000 -- (-740.143) (-738.036) [-737.150] (-739.683) * (-739.956) (-738.640) (-739.863) [-738.339] -- 0:00:17
701500 -- (-742.255) (-740.757) [-735.952] (-739.484) * (-735.990) (-736.813) (-737.159) [-736.583] -- 0:00:17
702000 -- (-738.767) (-736.265) (-736.009) [-740.190] * [-737.695] (-738.080) (-737.480) (-738.137) -- 0:00:17
702500 -- (-737.800) (-739.791) (-738.093) [-735.787] * [-738.671] (-735.926) (-738.286) (-736.463) -- 0:00:17
703000 -- (-737.274) (-739.560) (-735.923) [-736.057] * (-736.181) (-738.430) (-736.892) [-736.827] -- 0:00:17
703500 -- [-736.470] (-742.636) (-735.923) (-736.138) * (-743.660) (-736.997) (-737.832) [-737.232] -- 0:00:17
704000 -- (-737.102) (-737.343) [-738.552] (-736.273) * (-738.619) (-737.005) [-737.874] (-740.888) -- 0:00:17
704500 -- [-738.263] (-737.915) (-736.354) (-737.610) * [-736.546] (-737.990) (-737.726) (-744.061) -- 0:00:17
705000 -- (-740.721) [-736.516] (-737.864) (-737.317) * (-736.982) [-735.826] (-737.887) (-739.915) -- 0:00:17
Average standard deviation of split frequencies: 0.012215
705500 -- (-736.538) [-736.859] (-737.268) (-737.333) * (-737.541) (-736.703) [-736.224] (-741.135) -- 0:00:17
706000 -- (-737.778) (-737.199) [-736.510] (-736.096) * (-741.182) [-738.427] (-738.145) (-737.716) -- 0:00:17
706500 -- [-739.252] (-738.562) (-736.854) (-737.581) * (-740.379) (-738.010) (-737.647) [-739.885] -- 0:00:17
707000 -- (-738.379) (-737.612) [-735.834] (-736.801) * (-740.039) (-742.780) [-736.761] (-740.289) -- 0:00:17
707500 -- (-737.254) [-738.573] (-737.621) (-736.676) * [-735.988] (-741.853) (-739.487) (-738.882) -- 0:00:17
708000 -- (-736.759) [-739.763] (-738.292) (-738.010) * (-735.822) (-738.033) [-737.571] (-737.342) -- 0:00:17
708500 -- [-738.114] (-742.142) (-739.241) (-741.660) * (-736.182) (-738.857) (-742.425) [-736.965] -- 0:00:17
709000 -- [-736.722] (-739.126) (-737.227) (-741.693) * (-736.437) (-738.057) [-737.974] (-735.901) -- 0:00:17
709500 -- [-739.506] (-738.603) (-741.962) (-738.228) * (-738.100) (-738.891) [-736.477] (-738.906) -- 0:00:17
710000 -- [-736.712] (-737.569) (-739.074) (-736.883) * [-737.645] (-740.870) (-738.510) (-738.764) -- 0:00:17
Average standard deviation of split frequencies: 0.011940
710500 -- (-736.764) (-740.029) (-737.814) [-738.459] * (-736.673) (-738.650) (-737.148) [-737.570] -- 0:00:17
711000 -- (-739.338) [-739.113] (-737.210) (-737.535) * [-738.302] (-737.900) (-738.673) (-736.892) -- 0:00:17
711500 -- (-740.314) (-737.842) (-742.688) [-739.370] * (-738.775) [-736.187] (-739.835) (-735.881) -- 0:00:17
712000 -- (-739.008) (-739.345) [-739.614] (-736.467) * [-742.750] (-737.302) (-739.491) (-737.182) -- 0:00:17
712500 -- [-738.854] (-739.866) (-737.230) (-736.510) * (-738.331) (-736.728) (-737.899) [-738.701] -- 0:00:17
713000 -- (-741.338) (-740.930) (-741.624) [-738.733] * (-736.744) (-742.781) [-736.889] (-738.376) -- 0:00:17
713500 -- (-738.502) (-737.563) (-738.633) [-736.575] * (-736.595) (-744.117) [-738.516] (-736.162) -- 0:00:17
714000 -- (-736.440) (-738.740) [-738.690] (-736.118) * [-737.741] (-741.739) (-736.377) (-736.947) -- 0:00:17
714500 -- (-738.125) [-737.895] (-741.601) (-736.297) * (-737.910) (-738.737) [-737.758] (-742.431) -- 0:00:17
715000 -- [-740.099] (-737.649) (-736.097) (-740.701) * (-737.849) (-737.422) [-736.025] (-740.570) -- 0:00:17
Average standard deviation of split frequencies: 0.012345
715500 -- (-741.411) [-735.849] (-738.197) (-738.499) * (-740.581) (-737.224) (-737.975) [-738.968] -- 0:00:17
716000 -- (-738.793) (-735.772) [-737.379] (-740.014) * (-739.244) (-738.859) [-741.372] (-735.656) -- 0:00:17
716500 -- [-739.238] (-739.426) (-737.308) (-740.532) * (-740.472) (-739.432) [-740.007] (-739.872) -- 0:00:17
717000 -- (-738.459) (-745.865) [-738.303] (-737.549) * (-736.332) [-737.928] (-736.726) (-740.915) -- 0:00:16
717500 -- [-737.939] (-742.682) (-738.772) (-737.666) * (-736.205) [-737.028] (-738.352) (-737.891) -- 0:00:16
718000 -- (-738.235) (-737.307) (-738.059) [-738.937] * [-740.398] (-741.222) (-737.620) (-741.410) -- 0:00:16
718500 -- (-737.216) [-736.118] (-738.301) (-739.583) * (-739.905) (-739.629) [-736.942] (-739.099) -- 0:00:16
719000 -- (-740.460) (-740.277) [-737.960] (-736.504) * (-738.072) [-736.482] (-737.935) (-736.827) -- 0:00:16
719500 -- (-740.260) [-737.115] (-739.782) (-740.701) * (-738.697) (-740.027) (-737.836) [-737.913] -- 0:00:16
720000 -- (-738.061) [-738.335] (-737.606) (-739.756) * (-737.756) (-741.091) (-738.480) [-737.745] -- 0:00:16
Average standard deviation of split frequencies: 0.011949
720500 -- (-737.131) [-738.534] (-739.290) (-738.848) * [-739.647] (-738.294) (-736.668) (-738.055) -- 0:00:16
721000 -- (-740.717) (-737.156) (-736.228) [-737.712] * (-738.427) (-736.088) (-736.540) [-736.263] -- 0:00:16
721500 -- (-736.809) [-737.265] (-737.221) (-736.482) * (-736.857) (-738.538) [-736.206] (-736.258) -- 0:00:16
722000 -- (-737.651) (-735.733) [-738.825] (-738.315) * (-736.673) (-739.041) (-736.784) [-737.170] -- 0:00:16
722500 -- [-739.758] (-738.452) (-737.853) (-741.271) * (-737.825) [-736.840] (-738.049) (-739.666) -- 0:00:16
723000 -- (-738.151) (-741.640) [-737.321] (-740.485) * (-737.962) (-737.428) (-737.115) [-736.169] -- 0:00:16
723500 -- (-737.690) (-740.228) (-735.861) [-736.504] * (-739.106) (-739.160) [-737.650] (-737.262) -- 0:00:16
724000 -- [-736.748] (-736.598) (-737.593) (-738.826) * [-740.020] (-741.346) (-736.513) (-738.286) -- 0:00:16
724500 -- (-737.018) [-736.256] (-740.532) (-738.902) * (-738.152) (-741.853) (-736.661) [-737.082] -- 0:00:16
725000 -- [-735.842] (-736.939) (-736.969) (-741.756) * [-736.227] (-741.095) (-735.661) (-737.280) -- 0:00:16
Average standard deviation of split frequencies: 0.011322
725500 -- (-738.385) (-738.410) (-738.235) [-737.187] * (-737.095) [-739.001] (-736.531) (-739.005) -- 0:00:16
726000 -- (-736.876) (-737.699) (-737.498) [-739.066] * (-737.882) (-737.102) [-736.468] (-739.544) -- 0:00:16
726500 -- (-737.889) [-738.663] (-739.791) (-736.688) * (-737.026) (-737.609) [-737.109] (-737.419) -- 0:00:16
727000 -- [-736.081] (-741.005) (-738.840) (-736.414) * (-738.754) (-737.201) (-739.588) [-736.677] -- 0:00:16
727500 -- (-737.237) (-737.625) [-739.451] (-737.580) * (-740.543) (-738.213) (-736.527) [-737.029] -- 0:00:16
728000 -- [-738.139] (-736.525) (-737.408) (-738.017) * (-738.367) [-739.806] (-740.208) (-739.977) -- 0:00:16
728500 -- (-737.514) [-735.759] (-737.423) (-738.566) * (-739.255) [-740.880] (-736.831) (-737.627) -- 0:00:16
729000 -- (-737.358) (-740.043) [-737.497] (-741.441) * (-738.111) [-736.563] (-736.591) (-741.184) -- 0:00:16
729500 -- (-736.670) (-739.086) [-738.445] (-740.779) * (-736.103) (-736.335) [-737.938] (-738.503) -- 0:00:16
730000 -- (-738.611) (-738.192) [-736.571] (-737.779) * (-736.840) [-739.315] (-737.402) (-738.615) -- 0:00:16
Average standard deviation of split frequencies: 0.011936
730500 -- [-737.102] (-737.708) (-736.978) (-737.275) * (-737.075) [-736.684] (-740.978) (-738.699) -- 0:00:16
731000 -- (-738.508) (-742.817) (-735.741) [-738.347] * [-742.719] (-737.082) (-736.126) (-736.662) -- 0:00:16
731500 -- (-736.684) (-740.553) [-737.594] (-738.536) * (-736.146) [-736.503] (-738.838) (-736.482) -- 0:00:16
732000 -- [-736.150] (-740.507) (-737.502) (-740.977) * (-740.616) [-737.432] (-742.673) (-738.023) -- 0:00:16
732500 -- (-736.753) (-739.048) (-737.148) [-737.868] * (-737.075) [-737.415] (-738.797) (-737.798) -- 0:00:16
733000 -- (-738.467) [-740.501] (-737.630) (-741.779) * [-740.406] (-736.537) (-743.886) (-738.198) -- 0:00:16
733500 -- [-737.100] (-739.117) (-739.288) (-739.527) * (-737.393) (-736.867) [-738.022] (-737.499) -- 0:00:15
734000 -- (-735.966) [-738.940] (-740.171) (-739.047) * (-737.650) (-736.198) (-736.729) [-736.818] -- 0:00:15
734500 -- (-739.162) (-736.411) (-738.943) [-738.526] * (-738.456) (-736.328) (-738.708) [-736.835] -- 0:00:15
735000 -- (-738.022) [-736.387] (-737.465) (-737.002) * [-737.214] (-738.989) (-737.195) (-739.621) -- 0:00:15
Average standard deviation of split frequencies: 0.011145
735500 -- (-736.583) (-737.132) [-737.936] (-737.965) * [-738.655] (-739.427) (-738.693) (-738.778) -- 0:00:15
736000 -- (-736.116) (-736.791) (-736.656) [-738.986] * (-740.482) (-737.946) [-738.617] (-738.240) -- 0:00:15
736500 -- [-739.745] (-746.253) (-737.295) (-736.705) * (-740.934) (-737.119) [-738.586] (-739.961) -- 0:00:15
737000 -- [-739.422] (-736.827) (-736.986) (-736.277) * [-736.521] (-740.587) (-738.502) (-740.099) -- 0:00:15
737500 -- (-741.106) [-736.661] (-741.106) (-742.406) * (-738.309) [-737.394] (-742.240) (-740.146) -- 0:00:15
738000 -- (-738.416) (-738.192) [-738.864] (-737.465) * (-736.030) (-736.525) (-743.263) [-738.584] -- 0:00:15
738500 -- (-739.364) (-738.919) (-736.565) [-737.444] * (-736.606) (-738.141) [-736.635] (-739.449) -- 0:00:15
739000 -- (-737.684) (-736.298) (-738.483) [-738.077] * (-738.353) (-738.072) [-736.101] (-737.624) -- 0:00:15
739500 -- [-738.762] (-737.240) (-738.625) (-739.312) * [-737.765] (-736.806) (-735.878) (-739.384) -- 0:00:15
740000 -- [-737.276] (-739.191) (-736.811) (-738.650) * [-739.568] (-736.045) (-735.865) (-737.637) -- 0:00:15
Average standard deviation of split frequencies: 0.010693
740500 -- (-737.303) (-738.840) (-740.586) [-738.758] * (-738.246) (-740.045) (-736.089) [-737.151] -- 0:00:15
741000 -- (-736.591) (-738.091) [-737.459] (-743.471) * (-739.885) (-740.080) [-736.378] (-738.168) -- 0:00:15
741500 -- (-737.110) [-736.080] (-739.541) (-739.426) * (-738.462) (-738.378) [-737.857] (-740.729) -- 0:00:15
742000 -- (-735.707) (-740.142) (-738.067) [-737.873] * (-736.001) (-738.577) (-743.085) [-738.631] -- 0:00:15
742500 -- [-737.753] (-737.888) (-739.650) (-738.629) * [-736.242] (-740.393) (-738.662) (-739.630) -- 0:00:15
743000 -- [-739.287] (-736.670) (-739.509) (-739.658) * (-737.632) (-736.874) (-740.253) [-736.788] -- 0:00:15
743500 -- (-737.242) (-740.168) [-737.065] (-739.296) * (-739.437) (-738.900) [-737.299] (-739.712) -- 0:00:15
744000 -- (-739.312) (-742.066) (-736.755) [-737.543] * (-736.331) (-740.710) [-737.809] (-738.468) -- 0:00:15
744500 -- (-736.709) (-744.912) [-738.707] (-736.327) * [-736.591] (-737.943) (-747.933) (-737.412) -- 0:00:15
745000 -- (-738.554) (-739.168) [-741.255] (-736.669) * [-735.698] (-735.752) (-743.646) (-736.367) -- 0:00:15
Average standard deviation of split frequencies: 0.010363
745500 -- (-738.126) (-742.142) [-738.613] (-738.939) * (-740.595) (-736.763) (-742.388) [-737.978] -- 0:00:15
746000 -- (-737.517) (-740.184) [-738.970] (-737.331) * (-739.745) (-736.895) [-740.102] (-736.211) -- 0:00:15
746500 -- (-743.684) (-736.611) [-739.708] (-743.569) * [-738.338] (-737.261) (-739.604) (-738.681) -- 0:00:15
747000 -- (-738.028) (-737.334) (-736.601) [-740.515] * (-740.638) (-742.531) [-742.274] (-736.199) -- 0:00:15
747500 -- (-736.013) (-735.994) (-736.765) [-737.137] * (-737.672) (-739.261) (-740.707) [-738.632] -- 0:00:15
748000 -- [-736.043] (-736.916) (-740.636) (-737.054) * (-742.909) (-737.533) (-736.967) [-736.384] -- 0:00:15
748500 -- (-742.125) (-736.593) [-735.716] (-738.679) * [-736.303] (-739.026) (-737.578) (-738.928) -- 0:00:15
749000 -- (-735.934) [-736.456] (-740.636) (-737.890) * (-736.583) (-738.498) (-737.325) [-736.571] -- 0:00:15
749500 -- [-736.324] (-738.027) (-740.372) (-738.890) * [-737.711] (-740.421) (-738.227) (-736.982) -- 0:00:15
750000 -- [-737.107] (-736.481) (-739.834) (-736.857) * [-738.020] (-738.207) (-736.540) (-739.668) -- 0:00:15
Average standard deviation of split frequencies: 0.010440
750500 -- (-739.761) (-737.147) (-737.698) [-736.764] * (-742.935) (-744.149) (-736.009) [-737.206] -- 0:00:14
751000 -- (-739.936) (-737.208) [-737.159] (-736.604) * (-738.879) (-738.430) (-737.601) [-736.989] -- 0:00:14
751500 -- [-737.121] (-741.093) (-737.914) (-736.898) * (-738.471) (-737.738) [-738.014] (-737.405) -- 0:00:14
752000 -- (-737.362) (-740.565) [-738.355] (-738.721) * (-737.936) [-737.236] (-737.197) (-736.560) -- 0:00:14
752500 -- (-737.290) (-738.653) [-737.052] (-741.501) * (-737.428) [-736.924] (-741.131) (-735.768) -- 0:00:14
753000 -- [-736.897] (-737.574) (-737.040) (-740.381) * (-737.219) (-735.882) [-739.947] (-740.040) -- 0:00:14
753500 -- [-740.449] (-741.120) (-740.570) (-741.091) * (-737.128) (-737.084) (-738.452) [-741.313] -- 0:00:14
754000 -- (-741.379) (-742.494) [-738.270] (-739.992) * (-737.090) (-738.805) [-738.036] (-738.260) -- 0:00:14
754500 -- (-741.013) (-747.715) [-739.880] (-737.892) * [-736.250] (-738.975) (-741.688) (-736.797) -- 0:00:14
755000 -- [-740.199] (-742.461) (-741.092) (-737.902) * (-740.710) [-738.817] (-736.049) (-736.918) -- 0:00:14
Average standard deviation of split frequencies: 0.010434
755500 -- (-736.539) [-736.161] (-736.397) (-738.137) * (-738.898) (-737.608) [-736.237] (-736.818) -- 0:00:14
756000 -- (-742.612) (-742.290) [-737.101] (-739.603) * (-743.806) [-736.317] (-736.369) (-737.572) -- 0:00:14
756500 -- (-737.861) (-744.242) [-737.805] (-738.903) * (-740.231) (-739.275) [-736.106] (-738.308) -- 0:00:14
757000 -- (-738.570) (-742.898) (-738.423) [-740.925] * (-738.856) (-738.340) [-738.237] (-736.566) -- 0:00:14
757500 -- [-737.618] (-737.295) (-737.067) (-736.712) * (-740.281) (-735.873) [-739.548] (-736.566) -- 0:00:14
758000 -- (-736.536) (-736.768) (-737.716) [-736.710] * (-740.702) [-737.821] (-738.485) (-736.221) -- 0:00:14
758500 -- [-737.506] (-739.946) (-738.525) (-736.213) * (-736.942) [-737.703] (-737.467) (-738.400) -- 0:00:14
759000 -- [-737.661] (-742.537) (-736.354) (-740.869) * [-736.867] (-738.765) (-738.137) (-736.178) -- 0:00:14
759500 -- (-738.754) (-739.553) (-743.962) [-737.476] * [-736.778] (-738.184) (-739.784) (-735.940) -- 0:00:14
760000 -- (-736.749) (-738.117) [-740.705] (-737.123) * (-737.724) [-738.449] (-736.123) (-738.725) -- 0:00:14
Average standard deviation of split frequencies: 0.011238
760500 -- (-738.767) [-736.542] (-736.643) (-738.088) * (-738.384) (-738.122) (-736.802) [-738.822] -- 0:00:14
761000 -- (-737.380) [-737.190] (-737.355) (-740.916) * (-739.175) [-736.060] (-738.693) (-738.255) -- 0:00:14
761500 -- (-737.334) (-738.043) [-736.749] (-739.901) * (-737.148) (-740.711) (-738.394) [-737.121] -- 0:00:14
762000 -- (-737.092) (-736.743) [-737.769] (-743.941) * (-739.072) (-740.106) [-737.790] (-737.552) -- 0:00:14
762500 -- [-738.231] (-738.050) (-737.698) (-737.663) * [-738.701] (-741.804) (-737.616) (-738.609) -- 0:00:14
763000 -- (-740.318) [-738.599] (-737.986) (-738.299) * (-742.021) (-738.500) [-736.819] (-738.588) -- 0:00:14
763500 -- [-737.622] (-737.527) (-738.125) (-742.882) * (-737.982) (-737.726) (-737.938) [-737.684] -- 0:00:14
764000 -- (-737.347) (-738.849) [-736.997] (-740.119) * (-743.481) (-737.909) (-737.633) [-736.800] -- 0:00:14
764500 -- (-736.249) [-737.139] (-737.481) (-736.859) * (-739.597) (-738.909) [-738.242] (-736.381) -- 0:00:14
765000 -- (-737.650) (-737.189) [-738.374] (-737.055) * (-737.004) [-737.839] (-736.906) (-737.063) -- 0:00:14
Average standard deviation of split frequencies: 0.010913
765500 -- (-736.661) (-739.880) (-738.377) [-736.215] * (-741.110) (-737.452) (-738.007) [-737.363] -- 0:00:14
766000 -- (-738.989) [-742.193] (-736.773) (-738.848) * (-741.692) (-737.740) [-738.678] (-737.924) -- 0:00:14
766500 -- (-740.769) [-739.175] (-736.809) (-737.354) * (-738.601) (-736.258) [-738.336] (-736.647) -- 0:00:14
767000 -- [-739.502] (-739.310) (-736.546) (-740.141) * (-738.893) [-736.954] (-737.169) (-738.473) -- 0:00:13
767500 -- (-737.994) [-736.633] (-737.300) (-739.319) * (-738.599) (-739.425) (-742.013) [-737.702] -- 0:00:13
768000 -- (-737.310) [-736.365] (-739.959) (-737.254) * (-738.618) (-738.610) [-739.602] (-737.137) -- 0:00:13
768500 -- (-737.652) [-741.815] (-737.322) (-738.291) * (-737.372) (-743.858) (-744.769) [-737.853] -- 0:00:13
769000 -- [-738.622] (-743.128) (-737.327) (-740.073) * (-737.856) (-739.012) (-738.326) [-738.773] -- 0:00:13
769500 -- (-738.626) (-742.850) [-738.696] (-737.679) * [-737.679] (-736.565) (-737.506) (-737.360) -- 0:00:13
770000 -- (-738.844) (-736.731) [-737.024] (-736.572) * (-737.849) (-737.447) [-737.121] (-737.855) -- 0:00:13
Average standard deviation of split frequencies: 0.010317
770500 -- (-736.874) (-737.413) (-740.213) [-737.519] * (-737.670) [-740.302] (-742.901) (-736.320) -- 0:00:13
771000 -- (-736.397) (-738.984) (-737.098) [-737.875] * [-736.340] (-736.624) (-738.586) (-741.359) -- 0:00:13
771500 -- (-736.583) (-740.219) [-736.406] (-736.175) * (-737.009) [-737.862] (-736.322) (-740.642) -- 0:00:13
772000 -- (-742.591) [-738.829] (-736.979) (-738.765) * (-739.789) [-737.147] (-738.593) (-737.251) -- 0:00:13
772500 -- [-746.080] (-736.390) (-739.900) (-738.733) * (-737.781) (-737.266) (-743.013) [-740.301] -- 0:00:13
773000 -- (-736.317) (-737.758) (-744.414) [-737.819] * (-738.129) (-736.521) [-737.236] (-738.655) -- 0:00:13
773500 -- [-737.601] (-736.516) (-737.550) (-738.229) * (-736.685) (-736.820) (-738.272) [-739.776] -- 0:00:13
774000 -- (-741.217) (-737.506) (-737.606) [-739.330] * (-736.516) (-737.282) (-736.141) [-737.329] -- 0:00:13
774500 -- (-738.047) (-738.746) [-737.362] (-736.961) * [-741.885] (-737.596) (-737.528) (-737.925) -- 0:00:13
775000 -- (-737.685) (-737.101) [-738.704] (-738.109) * (-742.283) (-738.168) (-736.971) [-738.987] -- 0:00:13
Average standard deviation of split frequencies: 0.010530
775500 -- [-737.540] (-738.666) (-741.159) (-736.170) * (-740.020) (-739.399) [-739.002] (-737.840) -- 0:00:13
776000 -- (-737.108) (-740.013) (-738.721) [-736.388] * (-737.375) (-740.320) [-742.015] (-739.379) -- 0:00:13
776500 -- (-736.097) [-737.308] (-739.010) (-736.989) * (-739.922) (-736.557) [-738.928] (-744.206) -- 0:00:13
777000 -- (-735.728) (-737.007) (-739.124) [-740.417] * (-740.266) (-738.914) (-737.764) [-737.231] -- 0:00:13
777500 -- (-736.542) (-737.634) [-737.088] (-736.723) * (-739.712) [-738.722] (-739.155) (-737.057) -- 0:00:13
778000 -- [-737.033] (-740.006) (-737.271) (-736.326) * (-738.044) [-736.848] (-735.949) (-736.661) -- 0:00:13
778500 -- [-738.858] (-736.614) (-742.467) (-736.221) * (-738.423) (-736.798) [-736.969] (-736.912) -- 0:00:13
779000 -- [-738.528] (-736.858) (-739.148) (-737.995) * [-740.322] (-738.546) (-740.773) (-740.334) -- 0:00:13
779500 -- [-737.345] (-737.301) (-737.380) (-739.905) * (-735.712) (-739.039) (-737.423) [-736.198] -- 0:00:13
780000 -- (-737.522) [-736.686] (-737.654) (-739.274) * (-737.949) (-736.310) [-739.899] (-737.383) -- 0:00:13
Average standard deviation of split frequencies: 0.010265
780500 -- (-737.832) (-736.152) (-736.274) [-736.847] * (-738.957) (-736.795) [-736.782] (-736.730) -- 0:00:13
781000 -- (-737.461) (-739.914) [-737.707] (-735.653) * (-738.977) [-736.242] (-736.582) (-737.062) -- 0:00:13
781500 -- (-742.594) [-739.341] (-742.095) (-739.284) * [-736.594] (-738.782) (-737.197) (-736.649) -- 0:00:13
782000 -- (-741.467) (-737.077) (-735.995) [-738.076] * (-736.224) (-739.141) [-739.474] (-737.617) -- 0:00:13
782500 -- (-737.937) [-738.174] (-738.655) (-743.924) * (-739.611) (-741.293) [-736.755] (-736.646) -- 0:00:13
783000 -- [-736.657] (-737.160) (-737.380) (-738.196) * (-738.767) (-742.026) [-742.000] (-736.810) -- 0:00:13
783500 -- (-736.194) [-738.656] (-736.598) (-739.178) * (-737.100) (-738.398) [-738.701] (-737.374) -- 0:00:12
784000 -- [-735.957] (-737.740) (-738.495) (-737.071) * (-736.931) [-738.842] (-740.102) (-739.013) -- 0:00:12
784500 -- (-736.639) [-739.966] (-739.927) (-737.953) * [-738.477] (-735.902) (-737.439) (-736.811) -- 0:00:12
785000 -- (-737.286) (-737.548) [-740.234] (-741.701) * (-738.509) (-737.213) [-736.187] (-739.909) -- 0:00:12
Average standard deviation of split frequencies: 0.010116
785500 -- [-739.173] (-737.383) (-737.667) (-738.316) * [-736.783] (-737.016) (-737.874) (-740.079) -- 0:00:12
786000 -- (-739.383) (-738.828) [-737.341] (-739.869) * [-739.159] (-737.458) (-736.854) (-739.254) -- 0:00:12
786500 -- [-736.271] (-737.607) (-739.360) (-740.200) * (-736.590) (-736.080) [-736.241] (-736.190) -- 0:00:12
787000 -- (-736.453) (-736.048) (-739.676) [-740.722] * [-736.749] (-738.000) (-740.709) (-738.769) -- 0:00:12
787500 -- (-736.274) (-737.999) [-736.995] (-736.589) * [-738.634] (-737.312) (-736.273) (-738.016) -- 0:00:12
788000 -- [-737.546] (-738.883) (-738.701) (-736.980) * [-739.337] (-736.949) (-739.966) (-738.668) -- 0:00:12
788500 -- [-738.517] (-735.984) (-736.958) (-738.574) * (-738.214) [-736.380] (-743.720) (-742.591) -- 0:00:12
789000 -- (-737.851) (-736.464) (-741.597) [-743.785] * [-736.629] (-736.861) (-746.616) (-738.887) -- 0:00:12
789500 -- (-741.525) [-735.944] (-738.390) (-738.647) * [-739.456] (-740.310) (-737.116) (-737.797) -- 0:00:12
790000 -- (-739.543) [-739.291] (-739.907) (-740.287) * (-737.094) [-736.899] (-736.978) (-737.032) -- 0:00:12
Average standard deviation of split frequencies: 0.010215
790500 -- [-738.144] (-738.237) (-737.896) (-737.415) * [-741.443] (-737.034) (-737.832) (-735.861) -- 0:00:12
791000 -- (-737.475) [-737.503] (-740.780) (-737.772) * [-738.043] (-736.381) (-737.566) (-737.002) -- 0:00:12
791500 -- (-737.755) (-736.526) [-737.354] (-740.437) * (-738.192) (-736.598) [-737.944] (-736.434) -- 0:00:12
792000 -- (-737.294) (-737.494) [-738.176] (-740.835) * (-740.437) (-736.321) [-737.312] (-739.683) -- 0:00:12
792500 -- [-740.089] (-741.181) (-737.763) (-739.881) * (-738.806) [-739.038] (-738.601) (-735.955) -- 0:00:12
793000 -- [-738.880] (-741.029) (-737.650) (-736.086) * [-735.914] (-741.784) (-737.856) (-736.171) -- 0:00:12
793500 -- (-736.784) (-738.086) (-738.458) [-736.174] * (-737.403) (-737.948) [-736.795] (-736.835) -- 0:00:12
794000 -- (-737.926) (-738.486) [-735.763] (-737.418) * (-739.549) (-739.506) (-739.283) [-738.359] -- 0:00:12
794500 -- (-736.881) (-736.554) [-735.782] (-737.535) * (-738.375) (-737.559) (-736.505) [-736.065] -- 0:00:12
795000 -- (-736.629) (-737.172) (-737.420) [-738.055] * (-740.132) (-738.394) (-738.573) [-736.463] -- 0:00:12
Average standard deviation of split frequencies: 0.009910
795500 -- [-736.952] (-739.950) (-740.032) (-735.970) * [-736.281] (-737.574) (-738.452) (-738.463) -- 0:00:12
796000 -- (-736.176) (-737.204) (-736.116) [-736.421] * (-736.348) (-737.152) (-738.671) [-737.184] -- 0:00:12
796500 -- [-741.517] (-739.142) (-737.710) (-737.422) * (-737.129) (-735.962) (-736.225) [-736.767] -- 0:00:12
797000 -- (-742.303) (-737.935) (-737.320) [-737.787] * (-736.454) [-736.629] (-735.855) (-736.791) -- 0:00:12
797500 -- (-739.103) [-737.677] (-736.625) (-737.072) * (-737.594) [-736.705] (-739.968) (-738.893) -- 0:00:12
798000 -- (-742.319) (-737.285) (-737.415) [-739.811] * [-736.936] (-736.129) (-738.580) (-737.793) -- 0:00:12
798500 -- [-739.791] (-738.680) (-738.712) (-737.515) * (-736.631) (-738.854) [-738.735] (-736.617) -- 0:00:12
799000 -- [-739.234] (-743.240) (-738.248) (-736.875) * (-736.447) [-738.018] (-738.165) (-736.630) -- 0:00:12
799500 -- (-737.514) (-736.511) (-738.609) [-735.886] * (-735.861) (-737.785) [-737.726] (-738.309) -- 0:00:12
800000 -- [-737.514] (-741.593) (-738.477) (-737.799) * (-736.318) [-737.415] (-736.936) (-739.414) -- 0:00:12
Average standard deviation of split frequencies: 0.009773
800500 -- (-740.187) (-736.945) [-737.189] (-741.618) * (-741.361) (-737.345) (-736.600) [-736.936] -- 0:00:11
801000 -- (-740.247) (-737.099) (-738.917) [-739.922] * (-737.054) (-738.055) (-741.695) [-738.489] -- 0:00:11
801500 -- [-737.155] (-736.544) (-738.768) (-739.473) * (-740.711) [-742.348] (-740.409) (-737.091) -- 0:00:11
802000 -- (-736.186) (-741.235) [-741.144] (-738.317) * (-739.817) (-740.828) [-736.945] (-736.522) -- 0:00:11
802500 -- (-738.038) (-739.849) (-738.018) [-737.468] * (-738.414) (-738.207) (-737.786) [-739.240] -- 0:00:11
803000 -- (-742.113) [-736.007] (-738.820) (-736.747) * (-736.182) [-738.514] (-735.679) (-738.446) -- 0:00:11
803500 -- [-741.950] (-740.797) (-737.894) (-739.322) * (-740.550) (-736.486) [-739.381] (-739.082) -- 0:00:11
804000 -- (-737.901) [-740.160] (-737.972) (-737.207) * (-744.775) (-736.938) [-739.749] (-740.166) -- 0:00:11
804500 -- (-742.349) (-737.686) (-739.710) [-740.697] * (-737.854) [-736.483] (-741.154) (-740.875) -- 0:00:11
805000 -- (-737.476) [-736.966] (-737.562) (-742.234) * (-736.739) (-738.460) [-738.773] (-737.584) -- 0:00:11
Average standard deviation of split frequencies: 0.010177
805500 -- (-737.637) (-744.147) [-738.728] (-738.407) * (-737.640) [-736.447] (-742.717) (-741.979) -- 0:00:11
806000 -- [-737.031] (-738.071) (-737.186) (-740.960) * [-738.116] (-738.983) (-737.641) (-741.933) -- 0:00:11
806500 -- (-740.427) (-739.922) [-736.476] (-737.065) * (-739.471) (-740.948) (-737.220) [-738.781] -- 0:00:11
807000 -- (-737.754) [-741.660] (-736.270) (-739.515) * (-739.777) (-736.746) [-737.278] (-737.288) -- 0:00:11
807500 -- (-737.064) (-737.455) [-738.321] (-740.524) * (-738.700) (-737.304) [-736.534] (-738.866) -- 0:00:11
808000 -- [-738.221] (-738.791) (-740.829) (-736.228) * (-737.904) (-737.735) (-736.943) [-736.645] -- 0:00:11
808500 -- (-736.426) (-736.007) [-736.867] (-737.695) * (-737.771) (-739.049) (-741.629) [-736.273] -- 0:00:11
809000 -- (-739.280) (-739.383) [-738.632] (-738.772) * (-737.525) (-739.705) (-739.569) [-737.060] -- 0:00:11
809500 -- (-737.418) [-741.489] (-741.318) (-737.006) * (-737.643) (-737.443) (-736.823) [-736.514] -- 0:00:11
810000 -- [-738.742] (-737.774) (-741.993) (-738.823) * (-738.480) [-739.600] (-737.388) (-736.668) -- 0:00:11
Average standard deviation of split frequencies: 0.009886
810500 -- (-739.477) [-738.977] (-741.045) (-737.189) * [-736.959] (-738.737) (-737.863) (-740.510) -- 0:00:11
811000 -- (-740.567) [-739.602] (-737.644) (-743.016) * [-737.174] (-738.271) (-738.741) (-737.315) -- 0:00:11
811500 -- (-738.407) [-740.919] (-738.716) (-738.137) * (-736.946) (-736.221) [-738.541] (-736.759) -- 0:00:11
812000 -- (-737.119) [-740.455] (-741.340) (-736.272) * (-736.517) [-739.013] (-739.525) (-736.621) -- 0:00:11
812500 -- (-738.068) (-742.472) (-739.424) [-737.701] * (-735.691) (-740.163) (-739.063) [-735.992] -- 0:00:11
813000 -- (-737.466) (-737.321) (-745.965) [-737.965] * (-737.655) [-741.660] (-737.577) (-737.862) -- 0:00:11
813500 -- (-740.199) (-735.737) (-737.340) [-739.885] * (-743.767) (-740.396) [-737.042] (-741.850) -- 0:00:11
814000 -- [-736.867] (-737.083) (-736.328) (-739.992) * (-738.536) (-737.767) (-738.403) [-739.160] -- 0:00:11
814500 -- (-736.998) [-739.897] (-737.780) (-737.193) * (-739.001) (-736.035) (-736.303) [-737.885] -- 0:00:11
815000 -- (-737.877) (-739.445) (-737.283) [-736.046] * [-737.407] (-735.909) (-736.355) (-736.355) -- 0:00:11
Average standard deviation of split frequencies: 0.009936
815500 -- (-737.353) [-738.066] (-736.038) (-739.215) * (-736.905) (-738.640) [-737.103] (-741.386) -- 0:00:11
816000 -- (-738.403) (-740.499) [-736.554] (-738.272) * (-737.177) [-736.873] (-739.788) (-742.062) -- 0:00:11
816500 -- (-738.952) (-738.068) (-737.460) [-738.316] * [-736.657] (-738.755) (-737.915) (-736.387) -- 0:00:11
817000 -- [-740.070] (-736.022) (-737.807) (-741.814) * (-737.991) (-738.315) (-735.771) [-737.212] -- 0:00:10
817500 -- (-735.760) [-736.230] (-737.132) (-741.871) * [-741.511] (-735.727) (-738.148) (-736.780) -- 0:00:10
818000 -- (-737.675) [-736.286] (-742.379) (-739.724) * (-739.799) (-737.688) (-736.515) [-737.193] -- 0:00:10
818500 -- (-736.821) (-737.120) (-739.685) [-737.558] * (-743.875) [-737.287] (-742.615) (-738.335) -- 0:00:10
819000 -- [-738.440] (-736.139) (-738.884) (-737.874) * (-749.823) (-737.715) [-739.372] (-740.712) -- 0:00:10
819500 -- (-742.570) (-739.395) [-736.722] (-739.557) * (-740.506) (-739.044) [-740.339] (-738.364) -- 0:00:10
820000 -- (-738.369) [-736.841] (-735.808) (-744.462) * (-736.694) [-739.162] (-742.814) (-738.443) -- 0:00:10
Average standard deviation of split frequencies: 0.010071
820500 -- (-737.733) (-738.062) [-735.671] (-736.568) * (-736.571) (-737.095) (-736.999) [-739.187] -- 0:00:10
821000 -- [-740.606] (-735.894) (-735.932) (-737.846) * [-736.125] (-740.459) (-737.069) (-740.021) -- 0:00:10
821500 -- (-740.870) (-737.616) [-737.739] (-737.150) * (-738.636) [-736.804] (-739.271) (-738.615) -- 0:00:10
822000 -- [-737.571] (-740.381) (-738.830) (-736.970) * (-737.676) [-737.743] (-737.945) (-738.984) -- 0:00:10
822500 -- (-739.976) (-736.633) (-739.116) [-737.895] * [-738.831] (-737.022) (-741.682) (-736.731) -- 0:00:10
823000 -- (-740.156) (-739.502) (-738.038) [-737.525] * (-737.081) (-736.191) (-738.017) [-737.151] -- 0:00:10
823500 -- (-737.199) (-742.927) (-740.541) [-739.007] * [-736.760] (-737.118) (-740.595) (-736.781) -- 0:00:10
824000 -- (-739.056) (-738.170) [-736.117] (-737.290) * (-741.173) (-736.274) (-739.869) [-736.817] -- 0:00:10
824500 -- (-738.405) [-737.400] (-735.885) (-737.219) * [-737.044] (-737.871) (-741.483) (-736.611) -- 0:00:10
825000 -- [-739.235] (-736.721) (-738.091) (-738.319) * (-737.586) (-738.527) (-737.282) [-738.837] -- 0:00:10
Average standard deviation of split frequencies: 0.010387
825500 -- (-738.230) [-737.866] (-741.153) (-737.023) * (-739.070) (-742.258) (-737.437) [-738.541] -- 0:00:10
826000 -- (-740.775) (-738.300) (-738.544) [-736.384] * (-737.313) (-740.291) [-736.013] (-739.683) -- 0:00:10
826500 -- (-739.868) (-738.489) [-736.510] (-740.456) * [-736.683] (-740.212) (-736.388) (-744.175) -- 0:00:10
827000 -- (-737.475) [-737.194] (-737.654) (-742.641) * (-741.337) (-736.531) [-736.991] (-735.763) -- 0:00:10
827500 -- [-737.228] (-737.064) (-737.960) (-740.590) * [-737.165] (-742.705) (-743.311) (-737.710) -- 0:00:10
828000 -- [-737.455] (-739.133) (-738.084) (-739.227) * (-736.370) [-736.134] (-740.224) (-738.983) -- 0:00:10
828500 -- (-741.762) (-737.045) [-737.210] (-738.699) * [-740.311] (-738.694) (-737.875) (-737.857) -- 0:00:10
829000 -- (-736.485) (-740.247) [-736.587] (-740.016) * (-736.242) (-738.428) (-737.035) [-742.913] -- 0:00:10
829500 -- (-737.273) (-736.961) [-740.482] (-739.045) * [-739.372] (-736.561) (-736.609) (-738.279) -- 0:00:10
830000 -- (-737.691) (-739.293) [-737.130] (-736.428) * (-740.524) (-735.951) [-737.724] (-738.640) -- 0:00:10
Average standard deviation of split frequencies: 0.009799
830500 -- (-739.524) [-738.005] (-737.206) (-738.491) * [-735.932] (-735.887) (-738.780) (-740.621) -- 0:00:10
831000 -- (-740.826) (-736.710) (-736.794) [-740.012] * (-738.332) [-736.702] (-738.482) (-739.594) -- 0:00:10
831500 -- (-738.183) (-739.515) [-738.838] (-740.705) * (-738.815) [-735.839] (-737.940) (-736.648) -- 0:00:10
832000 -- (-739.679) (-736.896) [-736.372] (-741.607) * (-740.039) (-736.782) [-739.827] (-737.697) -- 0:00:10
832500 -- (-738.336) (-743.831) [-740.332] (-742.456) * (-743.748) (-736.955) [-736.659] (-738.270) -- 0:00:10
833000 -- [-738.107] (-742.111) (-737.746) (-737.543) * (-736.955) (-739.046) (-737.045) [-737.784] -- 0:00:10
833500 -- (-736.624) (-742.105) [-737.523] (-737.539) * (-736.858) (-735.764) [-737.042] (-736.425) -- 0:00:09
834000 -- (-737.660) (-741.649) (-737.107) [-736.907] * [-736.750] (-736.009) (-738.336) (-739.465) -- 0:00:09
834500 -- (-735.893) (-738.926) (-738.363) [-736.139] * [-739.453] (-736.471) (-737.722) (-737.662) -- 0:00:09
835000 -- (-738.770) (-739.095) (-739.099) [-737.677] * (-736.522) [-736.698] (-738.169) (-737.073) -- 0:00:09
Average standard deviation of split frequencies: 0.010075
835500 -- (-738.794) (-735.819) [-739.012] (-736.888) * (-736.484) (-739.981) (-741.084) [-737.428] -- 0:00:09
836000 -- (-736.366) (-739.209) [-739.851] (-737.721) * (-739.152) (-739.356) [-737.891] (-739.726) -- 0:00:09
836500 -- (-736.598) (-738.646) [-741.531] (-738.724) * (-739.711) (-739.472) (-736.745) [-736.680] -- 0:00:09
837000 -- (-738.069) [-738.637] (-744.190) (-738.441) * (-739.051) (-738.513) (-737.465) [-736.426] -- 0:00:09
837500 -- [-739.816] (-737.432) (-738.682) (-736.426) * (-737.198) (-738.580) [-735.789] (-740.389) -- 0:00:09
838000 -- (-737.097) (-735.946) [-737.433] (-737.965) * (-743.605) [-736.674] (-738.178) (-739.295) -- 0:00:09
838500 -- [-738.763] (-737.829) (-739.172) (-737.791) * (-737.464) (-737.585) [-737.681] (-738.014) -- 0:00:09
839000 -- (-740.809) [-737.537] (-741.787) (-736.643) * [-736.205] (-737.156) (-738.830) (-739.179) -- 0:00:09
839500 -- (-743.747) [-738.748] (-741.205) (-743.305) * (-735.688) (-738.254) [-739.543] (-741.589) -- 0:00:09
840000 -- (-735.624) [-739.971] (-737.806) (-738.672) * [-736.921] (-738.147) (-736.231) (-739.210) -- 0:00:09
Average standard deviation of split frequencies: 0.009944
840500 -- (-740.419) (-739.140) [-738.661] (-737.325) * [-736.165] (-740.641) (-741.468) (-739.075) -- 0:00:09
841000 -- (-739.213) (-742.093) [-737.286] (-736.139) * (-738.989) [-738.487] (-738.659) (-740.847) -- 0:00:09
841500 -- (-738.371) (-738.661) [-735.810] (-736.411) * [-736.672] (-736.914) (-740.314) (-738.754) -- 0:00:09
842000 -- (-737.330) (-739.594) [-735.916] (-739.554) * (-739.376) (-737.908) (-738.257) [-736.269] -- 0:00:09
842500 -- (-738.004) (-738.898) (-736.481) [-736.269] * (-740.284) (-738.292) (-742.753) [-738.403] -- 0:00:09
843000 -- (-739.536) (-737.732) [-735.958] (-738.484) * [-738.090] (-741.617) (-742.758) (-739.288) -- 0:00:09
843500 -- [-737.590] (-736.452) (-740.192) (-737.916) * (-737.217) [-740.705] (-736.301) (-743.062) -- 0:00:09
844000 -- [-736.758] (-736.809) (-737.516) (-737.414) * (-735.756) (-736.554) (-736.267) [-737.866] -- 0:00:09
844500 -- (-742.813) (-736.979) [-736.294] (-736.157) * [-736.036] (-739.199) (-737.422) (-740.422) -- 0:00:09
845000 -- [-736.979] (-736.347) (-737.759) (-740.620) * [-736.280] (-737.234) (-736.614) (-736.382) -- 0:00:09
Average standard deviation of split frequencies: 0.009807
845500 -- (-736.724) (-737.301) [-737.336] (-739.586) * (-739.019) [-737.666] (-744.449) (-737.503) -- 0:00:09
846000 -- [-737.547] (-741.663) (-738.472) (-736.893) * (-741.518) (-740.769) [-738.214] (-739.037) -- 0:00:09
846500 -- (-745.836) (-738.396) [-740.226] (-737.082) * (-738.459) (-742.792) (-739.165) [-737.828] -- 0:00:09
847000 -- (-737.980) (-736.810) (-738.851) [-737.984] * (-736.502) (-739.033) [-737.499] (-736.481) -- 0:00:09
847500 -- (-738.070) (-735.605) [-738.385] (-739.362) * (-742.023) (-737.071) [-736.638] (-736.187) -- 0:00:09
848000 -- (-740.638) (-737.090) [-739.241] (-738.244) * (-739.527) (-738.295) (-740.175) [-736.038] -- 0:00:09
848500 -- [-737.653] (-740.022) (-738.765) (-736.288) * [-736.119] (-738.829) (-743.985) (-739.735) -- 0:00:09
849000 -- [-738.416] (-739.543) (-739.306) (-737.202) * (-737.384) (-737.557) (-740.167) [-738.395] -- 0:00:09
849500 -- (-738.045) (-737.088) [-738.476] (-736.780) * (-736.322) (-742.034) [-736.629] (-737.040) -- 0:00:09
850000 -- (-738.368) [-736.620] (-740.010) (-739.778) * (-741.240) [-737.009] (-739.623) (-740.776) -- 0:00:09
Average standard deviation of split frequencies: 0.009642
850500 -- (-739.696) (-738.972) [-741.230] (-742.703) * (-741.000) [-736.529] (-739.099) (-742.238) -- 0:00:08
851000 -- [-736.911] (-737.537) (-738.256) (-739.743) * (-738.840) (-740.746) (-738.109) [-740.171] -- 0:00:08
851500 -- [-736.932] (-740.193) (-737.016) (-742.255) * (-739.485) (-739.624) (-736.517) [-739.311] -- 0:00:08
852000 -- (-737.599) (-739.149) [-736.197] (-738.088) * (-740.379) (-738.455) (-737.733) [-736.985] -- 0:00:08
852500 -- (-737.473) [-738.888] (-739.017) (-736.111) * (-738.570) (-737.047) [-738.379] (-736.190) -- 0:00:08
853000 -- (-738.913) [-736.308] (-737.532) (-736.814) * (-737.455) (-739.095) (-740.103) [-737.281] -- 0:00:08
853500 -- (-740.714) (-739.459) (-739.205) [-735.750] * (-737.418) (-737.428) (-737.057) [-737.281] -- 0:00:08
854000 -- (-745.410) (-738.154) (-737.488) [-741.525] * (-739.383) [-736.235] (-736.184) (-739.240) -- 0:00:08
854500 -- (-740.382) (-738.174) [-740.677] (-743.616) * (-739.627) [-735.652] (-739.645) (-741.837) -- 0:00:08
855000 -- (-739.956) (-739.766) (-738.199) [-742.987] * (-737.104) (-739.065) (-736.934) [-738.424] -- 0:00:08
Average standard deviation of split frequencies: 0.009582
855500 -- (-736.851) (-742.564) (-739.295) [-737.613] * (-736.899) [-736.504] (-736.418) (-742.773) -- 0:00:08
856000 -- [-738.130] (-739.321) (-740.256) (-738.155) * (-736.606) [-736.936] (-738.634) (-738.685) -- 0:00:08
856500 -- (-739.348) (-737.402) (-742.084) [-739.128] * (-738.919) (-738.151) [-736.792] (-739.617) -- 0:00:08
857000 -- (-736.645) [-739.120] (-739.248) (-738.337) * (-736.002) (-736.788) (-737.434) [-736.595] -- 0:00:08
857500 -- (-737.866) (-741.041) [-738.360] (-740.865) * (-736.933) [-739.403] (-736.078) (-737.795) -- 0:00:08
858000 -- [-736.974] (-743.462) (-737.488) (-736.497) * [-740.516] (-740.060) (-738.216) (-743.541) -- 0:00:08
858500 -- (-739.471) [-741.456] (-738.268) (-739.042) * [-736.925] (-739.351) (-739.537) (-739.047) -- 0:00:08
859000 -- (-739.207) (-737.320) [-739.032] (-741.687) * (-738.084) (-737.788) (-735.802) [-737.099] -- 0:00:08
859500 -- (-744.143) (-744.044) (-737.442) [-737.884] * (-738.272) (-738.065) [-736.865] (-738.786) -- 0:00:08
860000 -- (-741.473) (-735.743) (-737.986) [-735.937] * (-738.315) (-737.542) [-736.542] (-738.377) -- 0:00:08
Average standard deviation of split frequencies: 0.009056
860500 -- (-742.429) [-740.867] (-737.565) (-736.637) * (-738.405) (-737.953) (-735.724) [-737.583] -- 0:00:08
861000 -- [-736.135] (-739.482) (-737.971) (-736.144) * (-738.368) [-737.279] (-736.515) (-741.425) -- 0:00:08
861500 -- (-737.402) (-744.504) [-737.744] (-736.819) * (-739.806) (-739.354) (-737.761) [-739.128] -- 0:00:08
862000 -- [-738.510] (-738.174) (-736.893) (-739.550) * (-737.315) [-739.732] (-736.779) (-739.757) -- 0:00:08
862500 -- (-737.455) (-737.337) (-736.485) [-739.707] * (-736.993) (-738.573) (-737.525) [-738.489] -- 0:00:08
863000 -- (-739.978) (-738.057) (-738.879) [-737.417] * [-737.744] (-738.263) (-738.041) (-739.187) -- 0:00:08
863500 -- (-736.589) (-737.882) (-738.221) [-739.350] * (-736.959) (-736.710) [-737.720] (-736.108) -- 0:00:08
864000 -- (-735.832) [-738.083] (-737.647) (-737.672) * (-737.783) (-740.645) (-739.334) [-741.889] -- 0:00:08
864500 -- (-736.702) (-738.342) [-738.655] (-739.746) * [-737.146] (-744.042) (-738.956) (-741.162) -- 0:00:08
865000 -- (-737.278) [-736.485] (-737.952) (-738.335) * (-737.655) (-737.382) (-737.263) [-737.775] -- 0:00:08
Average standard deviation of split frequencies: 0.009254
865500 -- (-738.383) [-742.618] (-736.475) (-738.263) * [-735.977] (-739.302) (-737.980) (-737.172) -- 0:00:08
866000 -- (-744.081) (-739.296) (-736.081) [-736.721] * [-736.505] (-739.043) (-736.586) (-737.398) -- 0:00:08
866500 -- (-737.064) (-737.934) (-740.499) [-737.125] * [-737.306] (-738.832) (-739.990) (-736.484) -- 0:00:08
867000 -- (-738.570) (-738.750) (-739.998) [-740.766] * (-740.985) (-737.802) (-739.159) [-736.474] -- 0:00:07
867500 -- (-738.789) [-738.158] (-738.840) (-740.079) * (-736.879) [-736.162] (-736.821) (-736.548) -- 0:00:07
868000 -- [-737.015] (-738.518) (-736.234) (-737.425) * (-738.662) (-740.081) (-738.872) [-738.062] -- 0:00:07
868500 -- (-738.130) (-739.331) (-736.149) [-735.850] * [-736.754] (-736.768) (-741.472) (-738.718) -- 0:00:07
869000 -- (-739.961) (-737.659) (-737.412) [-737.460] * (-737.203) (-737.770) (-739.790) [-737.001] -- 0:00:07
869500 -- (-738.216) (-737.783) [-738.756] (-738.946) * (-738.132) (-739.830) (-738.817) [-736.609] -- 0:00:07
870000 -- (-738.971) (-740.366) (-741.063) [-736.164] * (-737.570) (-738.031) [-738.808] (-737.019) -- 0:00:07
Average standard deviation of split frequencies: 0.009276
870500 -- (-735.689) (-737.638) (-737.926) [-735.883] * (-742.465) (-737.150) (-738.561) [-738.793] -- 0:00:07
871000 -- (-737.381) [-737.127] (-742.601) (-737.053) * (-738.872) (-736.874) (-737.796) [-737.577] -- 0:00:07
871500 -- (-737.407) (-738.587) (-736.807) [-736.194] * (-737.468) (-736.791) [-736.393] (-737.272) -- 0:00:07
872000 -- (-739.786) (-740.660) (-736.798) [-742.084] * (-740.135) [-737.369] (-737.101) (-737.606) -- 0:00:07
872500 -- (-738.333) (-736.843) (-738.482) [-738.375] * (-740.436) (-736.979) [-739.943] (-739.413) -- 0:00:07
873000 -- [-739.964] (-737.089) (-738.690) (-737.189) * (-742.550) [-738.426] (-743.717) (-738.042) -- 0:00:07
873500 -- [-737.061] (-737.766) (-738.880) (-740.639) * (-741.273) (-738.277) (-737.453) [-737.708] -- 0:00:07
874000 -- [-738.238] (-738.866) (-742.646) (-737.917) * (-739.610) (-737.659) (-737.794) [-736.122] -- 0:00:07
874500 -- [-737.079] (-736.560) (-739.258) (-738.890) * (-740.213) (-745.691) [-736.817] (-736.634) -- 0:00:07
875000 -- [-736.235] (-737.787) (-738.516) (-737.142) * (-738.795) (-736.871) (-737.764) [-736.408] -- 0:00:07
Average standard deviation of split frequencies: 0.008933
875500 -- (-736.084) [-737.126] (-738.742) (-739.470) * [-736.079] (-738.456) (-738.538) (-737.264) -- 0:00:07
876000 -- (-738.618) [-737.335] (-736.439) (-737.735) * (-741.910) [-739.306] (-738.566) (-740.149) -- 0:00:07
876500 -- (-738.301) [-741.296] (-736.961) (-738.200) * (-737.788) (-736.967) [-737.628] (-737.046) -- 0:00:07
877000 -- [-738.239] (-740.913) (-736.716) (-737.393) * (-740.234) (-736.480) [-736.062] (-735.880) -- 0:00:07
877500 -- [-740.793] (-740.136) (-737.339) (-737.865) * [-737.091] (-738.172) (-736.017) (-736.026) -- 0:00:07
878000 -- (-738.134) (-737.093) (-738.288) [-736.884] * (-736.359) (-739.790) [-737.803] (-736.750) -- 0:00:07
878500 -- (-737.271) [-739.384] (-737.690) (-740.452) * (-737.697) (-739.858) [-736.532] (-738.363) -- 0:00:07
879000 -- [-736.283] (-735.941) (-736.942) (-739.641) * [-736.017] (-739.643) (-736.057) (-739.470) -- 0:00:07
879500 -- (-737.052) (-738.370) (-739.038) [-736.414] * (-736.416) [-743.718] (-736.145) (-737.072) -- 0:00:07
880000 -- (-736.577) [-736.826] (-736.626) (-737.840) * (-738.739) [-739.054] (-735.955) (-737.837) -- 0:00:07
Average standard deviation of split frequencies: 0.008565
880500 -- (-737.668) (-738.127) [-737.885] (-738.228) * (-736.704) (-738.194) [-736.712] (-739.001) -- 0:00:07
881000 -- (-739.630) (-745.434) [-737.124] (-737.184) * (-737.293) [-738.826] (-737.397) (-739.099) -- 0:00:07
881500 -- (-739.115) (-740.447) [-737.763] (-737.139) * (-741.172) (-738.701) [-735.928] (-739.012) -- 0:00:07
882000 -- (-736.921) (-742.319) (-735.936) [-736.792] * (-737.462) (-737.831) [-736.659] (-736.188) -- 0:00:07
882500 -- (-738.510) (-736.865) (-739.546) [-736.887] * (-740.691) (-740.286) (-739.396) [-737.469] -- 0:00:07
883000 -- (-737.126) (-735.977) (-748.494) [-736.727] * (-736.820) (-741.434) (-737.124) [-736.726] -- 0:00:07
883500 -- (-743.022) (-741.822) (-744.259) [-737.408] * [-737.483] (-741.481) (-736.504) (-739.220) -- 0:00:06
884000 -- (-741.983) (-737.094) (-739.874) [-736.310] * [-739.821] (-736.920) (-740.938) (-736.825) -- 0:00:06
884500 -- (-738.741) [-738.666] (-738.153) (-738.796) * [-738.238] (-739.159) (-741.630) (-737.676) -- 0:00:06
885000 -- (-738.336) (-738.437) [-738.138] (-740.076) * (-739.436) (-738.336) [-738.422] (-738.780) -- 0:00:06
Average standard deviation of split frequencies: 0.008300
885500 -- (-737.369) (-740.775) (-739.472) [-739.892] * (-742.255) [-737.775] (-737.979) (-737.380) -- 0:00:06
886000 -- (-736.839) [-738.086] (-736.666) (-736.988) * (-740.588) (-736.556) (-737.790) [-736.871] -- 0:00:06
886500 -- (-740.533) (-737.658) [-736.908] (-735.809) * (-737.377) [-739.336] (-737.336) (-740.661) -- 0:00:06
887000 -- (-739.531) (-736.420) [-738.450] (-738.591) * (-736.883) (-740.847) (-736.570) [-736.019] -- 0:00:06
887500 -- (-738.743) [-739.176] (-741.142) (-740.155) * (-740.429) (-736.264) [-736.604] (-740.080) -- 0:00:06
888000 -- [-736.773] (-736.968) (-737.776) (-737.093) * (-739.514) (-742.248) [-736.042] (-736.732) -- 0:00:06
888500 -- (-737.338) (-736.362) [-737.220] (-742.305) * (-738.415) (-738.423) [-736.702] (-738.832) -- 0:00:06
889000 -- (-738.186) (-737.813) (-737.149) [-738.426] * (-739.958) (-740.152) [-737.095] (-738.051) -- 0:00:06
889500 -- (-739.278) (-740.634) [-736.423] (-737.220) * [-740.126] (-736.933) (-736.690) (-737.466) -- 0:00:06
890000 -- (-738.407) [-737.758] (-736.655) (-736.602) * (-738.737) (-736.710) (-737.083) [-736.615] -- 0:00:06
Average standard deviation of split frequencies: 0.008751
890500 -- (-737.595) (-736.685) (-736.530) [-738.976] * (-737.459) [-736.616] (-738.563) (-740.599) -- 0:00:06
891000 -- (-740.113) [-737.227] (-738.415) (-737.062) * (-737.833) [-738.839] (-736.819) (-739.292) -- 0:00:06
891500 -- (-739.345) (-740.003) (-738.007) [-738.062] * (-736.379) (-738.828) [-737.270] (-737.947) -- 0:00:06
892000 -- (-739.442) (-735.822) [-737.133] (-740.297) * (-737.829) (-738.374) (-737.371) [-738.108] -- 0:00:06
892500 -- (-741.466) (-736.584) (-737.352) [-737.932] * [-738.360] (-737.583) (-737.483) (-738.236) -- 0:00:06
893000 -- [-740.148] (-735.822) (-736.318) (-737.480) * [-738.688] (-737.521) (-738.788) (-737.442) -- 0:00:06
893500 -- (-737.142) (-735.672) (-736.182) [-742.682] * (-740.005) [-736.434] (-739.744) (-735.943) -- 0:00:06
894000 -- (-739.236) (-738.180) (-737.313) [-739.779] * (-738.985) (-736.458) (-740.362) [-735.774] -- 0:00:06
894500 -- (-739.262) [-740.263] (-737.828) (-743.786) * (-737.207) (-741.145) (-737.462) [-737.793] -- 0:00:06
895000 -- (-736.822) [-737.891] (-738.784) (-738.837) * (-740.526) (-736.791) [-738.004] (-738.161) -- 0:00:06
Average standard deviation of split frequencies: 0.008839
895500 -- [-737.008] (-737.213) (-736.118) (-742.893) * [-738.728] (-739.400) (-737.889) (-738.385) -- 0:00:06
896000 -- (-737.794) (-738.063) [-738.835] (-739.282) * (-737.509) (-739.394) (-737.023) [-739.806] -- 0:00:06
896500 -- (-737.803) [-738.260] (-739.030) (-738.302) * [-737.363] (-737.825) (-737.132) (-737.652) -- 0:00:06
897000 -- [-740.185] (-738.023) (-739.751) (-738.359) * (-736.246) (-739.056) (-743.211) [-738.978] -- 0:00:06
897500 -- (-742.605) (-736.058) [-740.542] (-739.831) * (-737.465) (-736.446) [-738.341] (-739.005) -- 0:00:06
898000 -- (-739.833) [-736.346] (-737.635) (-741.290) * (-738.980) [-738.016] (-737.389) (-742.857) -- 0:00:06
898500 -- (-739.084) [-736.249] (-736.933) (-737.489) * [-738.035] (-740.634) (-740.895) (-738.384) -- 0:00:06
899000 -- (-740.942) [-736.248] (-737.252) (-741.605) * (-736.509) (-742.690) (-740.997) [-739.378] -- 0:00:06
899500 -- (-744.124) [-736.926] (-736.252) (-738.828) * [-736.687] (-736.454) (-738.044) (-739.440) -- 0:00:06
900000 -- (-749.383) (-736.402) [-738.179] (-738.854) * [-736.356] (-737.332) (-735.775) (-736.383) -- 0:00:06
Average standard deviation of split frequencies: 0.008688
900500 -- (-737.893) (-738.023) [-738.089] (-738.755) * (-738.977) (-737.756) [-738.447] (-736.648) -- 0:00:05
901000 -- (-737.288) (-736.982) [-738.643] (-740.167) * (-740.535) [-738.062] (-737.527) (-737.147) -- 0:00:05
901500 -- [-738.085] (-738.271) (-737.785) (-737.626) * (-738.321) [-737.355] (-738.893) (-738.070) -- 0:00:05
902000 -- (-735.777) (-738.121) [-736.306] (-736.422) * (-740.678) (-737.572) [-736.455] (-738.639) -- 0:00:05
902500 -- [-738.251] (-738.385) (-736.919) (-737.646) * (-738.695) (-737.797) (-742.591) [-739.089] -- 0:00:05
903000 -- [-738.847] (-738.038) (-737.963) (-740.257) * (-739.799) (-738.903) [-738.780] (-736.257) -- 0:00:05
903500 -- (-739.042) (-738.422) [-737.732] (-739.324) * (-737.992) (-737.814) [-738.189] (-737.859) -- 0:00:05
904000 -- [-740.160] (-737.124) (-740.994) (-738.576) * (-738.441) (-737.447) [-736.266] (-746.758) -- 0:00:05
904500 -- (-741.689) [-737.052] (-739.995) (-738.790) * [-737.232] (-737.654) (-737.288) (-740.287) -- 0:00:05
905000 -- (-738.607) (-737.496) [-739.364] (-737.422) * (-738.303) [-737.799] (-736.660) (-740.359) -- 0:00:05
Average standard deviation of split frequencies: 0.008429
905500 -- (-738.674) [-739.386] (-737.040) (-738.381) * (-737.534) (-736.189) (-739.179) [-738.410] -- 0:00:05
906000 -- [-739.968] (-737.987) (-737.165) (-738.097) * [-737.920] (-736.678) (-737.240) (-743.236) -- 0:00:05
906500 -- [-738.780] (-738.075) (-735.930) (-737.059) * (-737.781) [-736.461] (-737.496) (-738.223) -- 0:00:05
907000 -- [-737.180] (-738.841) (-741.617) (-741.258) * (-738.426) (-736.311) (-736.386) [-738.536] -- 0:00:05
907500 -- [-736.879] (-737.296) (-737.816) (-740.131) * (-739.685) [-737.252] (-736.707) (-737.403) -- 0:00:05
908000 -- (-739.295) (-738.790) [-737.877] (-737.624) * (-738.777) [-736.250] (-737.751) (-739.074) -- 0:00:05
908500 -- (-738.617) [-739.410] (-740.425) (-736.948) * [-740.109] (-736.382) (-738.664) (-735.864) -- 0:00:05
909000 -- [-738.553] (-738.504) (-738.583) (-737.899) * (-740.562) (-745.462) [-736.872] (-736.391) -- 0:00:05
909500 -- (-739.235) (-738.924) [-736.669] (-737.412) * (-740.126) (-737.550) [-736.040] (-737.853) -- 0:00:05
910000 -- (-737.295) (-738.985) (-736.053) [-736.858] * (-737.591) [-738.489] (-736.937) (-738.051) -- 0:00:05
Average standard deviation of split frequencies: 0.008800
910500 -- (-735.999) (-737.441) [-737.320] (-737.516) * (-737.517) [-737.732] (-737.940) (-738.459) -- 0:00:05
911000 -- (-736.193) (-739.171) [-740.327] (-736.544) * (-740.973) (-740.480) [-736.918] (-738.892) -- 0:00:05
911500 -- (-737.100) (-738.868) [-737.537] (-738.345) * (-737.657) [-735.732] (-737.497) (-738.454) -- 0:00:05
912000 -- [-739.256] (-738.400) (-736.818) (-736.870) * [-737.253] (-736.079) (-736.632) (-738.820) -- 0:00:05
912500 -- (-738.732) [-739.601] (-737.279) (-736.882) * [-738.205] (-739.710) (-740.407) (-739.497) -- 0:00:05
913000 -- (-739.048) (-745.414) (-739.845) [-736.575] * (-739.309) [-737.825] (-737.663) (-736.614) -- 0:00:05
913500 -- (-739.989) (-739.974) (-736.095) [-737.312] * [-740.471] (-737.048) (-737.191) (-736.294) -- 0:00:05
914000 -- (-738.222) (-737.884) [-738.241] (-739.984) * (-737.437) (-744.607) (-737.280) [-738.492] -- 0:00:05
914500 -- [-738.690] (-738.779) (-737.526) (-738.110) * (-735.750) (-740.303) (-736.406) [-740.356] -- 0:00:05
915000 -- (-739.805) (-737.177) [-738.945] (-736.739) * (-739.103) [-737.984] (-738.935) (-736.359) -- 0:00:05
Average standard deviation of split frequencies: 0.009023
915500 -- (-738.016) (-739.865) [-740.736] (-737.947) * (-742.568) [-739.088] (-736.344) (-736.528) -- 0:00:05
916000 -- (-736.047) (-739.631) (-739.015) [-740.698] * (-739.664) [-738.569] (-736.524) (-736.717) -- 0:00:05
916500 -- [-738.129] (-738.149) (-742.996) (-737.428) * (-741.035) (-738.091) [-737.259] (-736.909) -- 0:00:05
917000 -- (-737.018) (-740.117) [-743.858] (-739.003) * (-738.367) [-736.066] (-739.868) (-738.486) -- 0:00:04
917500 -- [-736.958] (-741.632) (-743.482) (-741.394) * (-737.366) (-736.361) (-739.785) [-737.807] -- 0:00:04
918000 -- (-737.588) (-740.127) [-736.643] (-736.408) * (-738.031) (-735.876) [-739.685] (-737.181) -- 0:00:04
918500 -- (-736.916) (-740.845) (-741.152) [-738.374] * (-740.251) (-735.879) [-738.021] (-736.283) -- 0:00:04
919000 -- (-738.272) (-737.733) (-739.968) [-736.075] * (-737.823) (-740.106) (-736.880) [-736.169] -- 0:00:04
919500 -- (-738.338) (-735.786) [-741.976] (-736.470) * (-738.280) (-736.875) [-736.998] (-740.986) -- 0:00:04
920000 -- (-739.572) [-739.346] (-738.242) (-736.089) * (-739.814) [-736.746] (-737.378) (-737.873) -- 0:00:04
Average standard deviation of split frequencies: 0.008841
920500 -- (-738.488) (-737.815) (-738.184) [-738.078] * (-736.691) [-740.291] (-738.118) (-738.822) -- 0:00:04
921000 -- (-736.308) (-736.128) [-736.331] (-736.948) * (-736.377) (-741.952) (-737.202) [-738.711] -- 0:00:04
921500 -- (-740.459) (-741.907) [-740.286] (-739.131) * (-737.572) [-739.317] (-738.557) (-737.139) -- 0:00:04
922000 -- [-736.561] (-737.595) (-737.675) (-739.334) * (-738.327) [-737.977] (-737.446) (-739.925) -- 0:00:04
922500 -- [-739.435] (-739.360) (-737.729) (-739.717) * (-740.894) (-735.860) (-736.693) [-739.007] -- 0:00:04
923000 -- (-736.531) (-741.577) [-738.529] (-737.585) * [-737.708] (-741.862) (-736.318) (-740.287) -- 0:00:04
923500 -- (-738.689) (-738.815) [-737.629] (-737.680) * (-736.368) (-739.906) [-736.275] (-737.528) -- 0:00:04
924000 -- (-739.386) (-740.719) [-741.869] (-738.696) * [-737.290] (-737.033) (-738.607) (-740.679) -- 0:00:04
924500 -- (-738.001) (-737.597) (-739.370) [-736.475] * (-737.456) (-737.096) [-737.516] (-736.291) -- 0:00:04
925000 -- (-739.198) (-737.453) [-737.423] (-736.726) * [-735.637] (-738.368) (-739.165) (-736.989) -- 0:00:04
Average standard deviation of split frequencies: 0.009062
925500 -- [-738.469] (-737.488) (-739.401) (-737.696) * (-738.446) (-737.759) (-737.958) [-737.342] -- 0:00:04
926000 -- (-740.854) (-736.430) (-740.547) [-737.215] * (-738.846) (-737.784) (-737.632) [-739.197] -- 0:00:04
926500 -- (-737.497) (-738.061) (-739.078) [-737.607] * [-738.690] (-737.896) (-736.404) (-736.584) -- 0:00:04
927000 -- (-739.059) (-741.663) (-736.091) [-738.542] * [-742.059] (-739.174) (-739.421) (-738.436) -- 0:00:04
927500 -- (-739.241) (-738.095) [-739.737] (-740.760) * (-741.369) (-737.523) (-738.650) [-739.257] -- 0:00:04
928000 -- (-740.652) (-739.103) [-737.577] (-738.406) * (-740.966) (-736.110) (-738.357) [-737.046] -- 0:00:04
928500 -- (-735.795) (-738.833) [-738.579] (-738.302) * [-740.099] (-739.785) (-739.530) (-738.349) -- 0:00:04
929000 -- [-736.994] (-736.142) (-743.805) (-738.099) * (-740.082) [-737.638] (-737.003) (-738.104) -- 0:00:04
929500 -- (-741.002) (-736.938) [-740.305] (-737.004) * (-740.382) [-740.383] (-740.630) (-736.864) -- 0:00:04
930000 -- [-736.421] (-737.246) (-738.900) (-736.687) * (-737.114) (-737.745) (-738.369) [-736.064] -- 0:00:04
Average standard deviation of split frequencies: 0.008915
930500 -- (-736.255) [-738.399] (-737.875) (-737.497) * (-737.508) (-738.260) (-738.224) [-738.978] -- 0:00:04
931000 -- (-736.795) (-736.802) [-737.249] (-737.069) * (-741.293) (-739.193) (-740.249) [-739.869] -- 0:00:04
931500 -- (-736.092) [-736.395] (-737.675) (-739.098) * [-737.690] (-736.258) (-739.142) (-738.695) -- 0:00:04
932000 -- (-739.056) (-738.339) [-736.615] (-736.984) * (-737.473) (-738.923) [-740.315] (-737.151) -- 0:00:04
932500 -- [-736.923] (-737.442) (-738.871) (-736.903) * (-737.666) (-737.745) [-737.214] (-737.909) -- 0:00:04
933000 -- (-738.332) (-737.641) (-736.314) [-741.890] * (-738.841) (-737.013) [-738.672] (-742.288) -- 0:00:04
933500 -- [-738.703] (-739.194) (-736.507) (-737.569) * (-736.077) [-737.809] (-738.689) (-741.525) -- 0:00:03
934000 -- [-737.248] (-738.188) (-735.741) (-737.456) * (-739.580) [-740.164] (-741.571) (-743.657) -- 0:00:03
934500 -- [-736.525] (-738.346) (-738.337) (-740.362) * (-737.827) [-737.901] (-740.261) (-737.133) -- 0:00:03
935000 -- [-738.138] (-738.414) (-736.432) (-736.293) * (-737.526) [-736.708] (-736.405) (-738.831) -- 0:00:03
Average standard deviation of split frequencies: 0.009401
935500 -- [-737.145] (-737.504) (-736.934) (-736.502) * (-739.777) (-737.164) [-737.356] (-740.405) -- 0:00:03
936000 -- (-735.689) [-736.221] (-738.825) (-737.387) * [-736.300] (-741.297) (-737.977) (-741.671) -- 0:00:03
936500 -- (-738.838) [-736.600] (-741.336) (-736.465) * (-738.600) (-744.863) (-736.968) [-737.687] -- 0:00:03
937000 -- (-737.576) (-741.107) [-739.859] (-735.674) * (-740.845) [-742.300] (-736.830) (-739.096) -- 0:00:03
937500 -- (-738.114) (-739.848) (-737.760) [-736.093] * (-743.930) (-737.446) [-736.281] (-740.255) -- 0:00:03
938000 -- (-737.103) (-738.398) (-738.122) [-736.375] * (-736.291) (-737.087) (-736.099) [-739.973] -- 0:00:03
938500 -- (-737.904) [-737.415] (-739.086) (-736.608) * (-736.715) (-736.701) [-736.345] (-742.084) -- 0:00:03
939000 -- (-737.541) (-736.124) [-738.410] (-738.053) * [-742.503] (-739.369) (-736.351) (-737.738) -- 0:00:03
939500 -- (-738.834) (-736.156) (-745.841) [-738.756] * (-740.431) (-741.555) (-737.222) [-736.570] -- 0:00:03
940000 -- (-738.824) [-736.013] (-735.796) (-736.860) * (-737.968) (-737.583) [-736.418] (-742.005) -- 0:00:03
Average standard deviation of split frequencies: 0.009488
940500 -- (-737.672) (-739.171) [-736.644] (-739.814) * (-738.537) (-736.265) (-735.868) [-740.477] -- 0:00:03
941000 -- (-737.343) (-742.047) [-736.717] (-739.046) * (-736.724) [-737.600] (-737.562) (-736.885) -- 0:00:03
941500 -- (-740.685) (-739.315) (-736.747) [-741.179] * (-737.198) (-738.954) (-736.295) [-737.875] -- 0:00:03
942000 -- [-735.988] (-739.708) (-736.720) (-738.306) * (-738.309) [-738.057] (-736.699) (-736.919) -- 0:00:03
942500 -- (-738.395) (-739.135) (-740.650) [-738.156] * [-739.114] (-739.979) (-736.279) (-736.837) -- 0:00:03
943000 -- [-737.330] (-738.360) (-737.251) (-738.951) * (-740.155) (-739.390) (-738.480) [-736.991] -- 0:00:03
943500 -- (-737.652) (-740.844) [-736.901] (-736.226) * [-738.247] (-738.702) (-737.578) (-737.582) -- 0:00:03
944000 -- [-740.016] (-736.401) (-736.498) (-737.150) * (-737.724) (-740.154) (-736.158) [-737.104] -- 0:00:03
944500 -- (-739.085) [-739.457] (-736.720) (-735.695) * [-741.416] (-738.671) (-736.179) (-737.768) -- 0:00:03
945000 -- [-739.762] (-736.791) (-737.031) (-735.700) * (-743.189) (-738.136) (-737.250) [-736.997] -- 0:00:03
Average standard deviation of split frequencies: 0.009501
945500 -- [-740.109] (-737.210) (-736.479) (-736.614) * (-741.373) (-738.598) (-737.627) [-736.404] -- 0:00:03
946000 -- (-739.459) (-741.684) (-741.292) [-739.509] * (-741.364) (-737.608) [-741.329] (-737.010) -- 0:00:03
946500 -- (-742.046) (-738.764) (-737.916) [-740.760] * (-736.273) (-743.650) (-738.905) [-736.382] -- 0:00:03
947000 -- [-736.218] (-736.760) (-740.409) (-740.634) * [-736.399] (-739.764) (-736.510) (-736.204) -- 0:00:03
947500 -- (-735.955) (-737.452) (-738.899) [-738.848] * (-738.715) [-736.870] (-736.122) (-737.274) -- 0:00:03
948000 -- (-736.610) (-736.573) [-736.393] (-737.509) * [-739.278] (-737.820) (-736.469) (-739.224) -- 0:00:03
948500 -- (-737.480) [-737.856] (-736.332) (-739.285) * (-739.779) (-740.971) [-736.058] (-738.141) -- 0:00:03
949000 -- (-737.103) [-737.737] (-736.522) (-738.861) * (-737.118) [-737.816] (-739.290) (-739.503) -- 0:00:03
949500 -- [-736.763] (-739.060) (-737.958) (-738.465) * [-735.779] (-737.710) (-739.014) (-738.023) -- 0:00:03
950000 -- (-736.149) [-737.674] (-736.806) (-739.694) * (-742.357) (-737.599) [-738.787] (-740.935) -- 0:00:03
Average standard deviation of split frequencies: 0.010017
950500 -- (-737.263) (-737.667) (-736.210) [-736.824] * (-738.177) (-738.527) [-738.950] (-738.767) -- 0:00:02
951000 -- (-735.806) (-738.540) (-736.314) [-737.391] * (-737.066) (-737.329) (-738.073) [-737.195] -- 0:00:02
951500 -- (-738.375) (-736.448) (-739.003) [-737.494] * (-738.025) (-746.769) [-738.641] (-737.334) -- 0:00:02
952000 -- (-736.662) [-737.015] (-737.526) (-736.462) * [-736.723] (-737.348) (-738.078) (-736.291) -- 0:00:02
952500 -- (-737.850) (-737.708) [-737.423] (-737.433) * (-736.599) (-737.761) (-736.485) [-735.999] -- 0:00:02
953000 -- (-738.589) [-738.505] (-740.202) (-736.172) * (-740.692) (-737.073) [-737.768] (-736.594) -- 0:00:02
953500 -- (-737.153) (-736.736) (-738.652) [-737.400] * [-737.145] (-736.431) (-737.658) (-742.376) -- 0:00:02
954000 -- (-736.081) [-738.020] (-737.946) (-738.371) * (-736.015) (-738.327) (-737.244) [-738.073] -- 0:00:02
954500 -- (-737.870) [-739.378] (-738.451) (-738.390) * (-736.713) [-737.022] (-737.808) (-739.579) -- 0:00:02
955000 -- (-737.590) (-738.413) (-741.914) [-736.333] * (-735.962) (-737.090) (-739.009) [-739.608] -- 0:00:02
Average standard deviation of split frequencies: 0.010158
955500 -- (-737.077) [-738.211] (-737.239) (-736.412) * [-737.977] (-736.970) (-738.387) (-737.404) -- 0:00:02
956000 -- (-742.108) (-737.575) [-736.761] (-737.031) * (-739.743) (-737.142) [-736.769] (-737.415) -- 0:00:02
956500 -- (-737.035) [-741.691] (-737.648) (-737.419) * (-736.666) [-736.970] (-740.131) (-737.048) -- 0:00:02
957000 -- (-736.493) [-737.107] (-736.649) (-737.936) * [-738.977] (-738.367) (-737.465) (-736.274) -- 0:00:02
957500 -- (-736.478) (-738.471) (-737.058) [-742.331] * [-737.535] (-737.925) (-735.718) (-740.632) -- 0:00:02
958000 -- [-737.101] (-737.090) (-737.577) (-738.301) * [-737.816] (-738.400) (-737.599) (-737.279) -- 0:00:02
958500 -- (-742.496) (-736.262) [-736.160] (-738.155) * [-740.678] (-736.863) (-742.074) (-736.312) -- 0:00:02
959000 -- (-741.892) (-738.425) [-736.799] (-739.792) * (-740.221) (-738.607) (-738.368) [-736.372] -- 0:00:02
959500 -- (-741.121) (-737.109) [-735.731] (-736.002) * (-738.947) (-739.634) (-736.961) [-737.987] -- 0:00:02
960000 -- [-741.358] (-738.605) (-739.713) (-736.181) * (-739.904) (-736.268) [-736.912] (-738.531) -- 0:00:02
Average standard deviation of split frequencies: 0.010207
960500 -- (-743.195) (-743.056) [-741.390] (-737.279) * [-737.158] (-744.464) (-735.712) (-738.819) -- 0:00:02
961000 -- (-739.939) (-738.805) [-738.873] (-736.300) * [-740.043] (-738.116) (-738.351) (-735.827) -- 0:00:02
961500 -- (-739.343) (-737.040) [-737.015] (-740.358) * (-737.768) [-737.872] (-738.018) (-738.133) -- 0:00:02
962000 -- [-739.106] (-739.227) (-740.099) (-739.614) * (-738.148) (-737.519) (-735.831) [-738.685] -- 0:00:02
962500 -- [-738.898] (-739.277) (-739.999) (-738.662) * (-737.184) (-738.927) [-737.538] (-739.597) -- 0:00:02
963000 -- (-737.486) [-736.821] (-737.220) (-736.832) * (-737.413) [-737.690] (-740.219) (-738.821) -- 0:00:02
963500 -- [-736.233] (-736.136) (-740.629) (-739.113) * (-739.601) (-737.381) (-738.568) [-736.808] -- 0:00:02
964000 -- [-737.181] (-744.262) (-736.825) (-744.654) * [-739.832] (-737.544) (-737.009) (-740.485) -- 0:00:02
964500 -- [-735.585] (-738.983) (-737.829) (-737.101) * (-739.593) [-737.948] (-737.938) (-745.357) -- 0:00:02
965000 -- (-739.038) [-739.034] (-739.642) (-737.008) * [-739.441] (-741.270) (-737.180) (-741.389) -- 0:00:02
Average standard deviation of split frequencies: 0.010248
965500 -- (-738.915) (-736.915) (-739.424) [-737.067] * (-737.239) [-740.966] (-736.427) (-737.292) -- 0:00:02
966000 -- (-737.662) (-736.661) (-740.460) [-737.086] * (-736.723) [-736.981] (-744.121) (-736.861) -- 0:00:02
966500 -- (-737.452) [-735.917] (-739.196) (-739.004) * (-741.339) (-742.753) [-738.737] (-737.756) -- 0:00:02
967000 -- (-736.502) (-739.891) [-740.209] (-738.523) * [-739.875] (-737.917) (-741.108) (-737.274) -- 0:00:01
967500 -- (-738.229) (-736.760) [-738.100] (-736.803) * (-736.478) (-736.752) [-738.273] (-737.890) -- 0:00:01
968000 -- [-736.114] (-736.998) (-740.582) (-736.369) * (-736.076) (-738.277) [-741.734] (-736.876) -- 0:00:01
968500 -- (-737.248) (-736.939) [-739.144] (-737.709) * (-736.982) (-739.036) (-737.681) [-738.160] -- 0:00:01
969000 -- (-737.160) (-736.653) (-737.458) [-736.633] * [-736.048] (-738.153) (-739.906) (-737.433) -- 0:00:01
969500 -- (-739.732) (-741.011) (-740.822) [-739.908] * (-738.590) (-736.815) (-739.278) [-739.373] -- 0:00:01
970000 -- (-737.366) (-739.166) (-737.828) [-739.022] * (-740.282) (-737.156) (-740.078) [-739.771] -- 0:00:01
Average standard deviation of split frequencies: 0.010458
970500 -- (-742.799) (-737.898) (-739.160) [-737.970] * (-736.158) (-736.998) (-737.448) [-736.816] -- 0:00:01
971000 -- (-737.850) (-738.940) (-738.593) [-736.131] * (-736.884) [-736.221] (-739.157) (-738.675) -- 0:00:01
971500 -- [-737.809] (-740.970) (-737.504) (-736.618) * [-736.242] (-737.560) (-741.809) (-738.065) -- 0:00:01
972000 -- (-737.474) [-739.988] (-737.668) (-737.093) * (-739.380) (-739.607) (-739.960) [-737.412] -- 0:00:01
972500 -- (-736.613) [-737.159] (-737.630) (-736.186) * (-738.241) [-736.744] (-735.860) (-741.313) -- 0:00:01
973000 -- (-737.517) [-736.209] (-743.069) (-736.187) * (-740.317) (-738.949) (-736.611) [-736.221] -- 0:00:01
973500 -- (-736.815) [-736.096] (-741.639) (-737.931) * [-736.514] (-739.264) (-738.077) (-739.373) -- 0:00:01
974000 -- (-735.978) (-737.365) (-741.117) [-738.247] * (-737.251) [-739.528] (-738.109) (-737.811) -- 0:00:01
974500 -- (-738.654) (-737.526) (-737.279) [-736.849] * (-737.176) [-739.745] (-737.084) (-741.607) -- 0:00:01
975000 -- (-737.667) [-736.216] (-739.983) (-736.600) * (-738.845) (-737.441) (-740.018) [-738.554] -- 0:00:01
Average standard deviation of split frequencies: 0.010562
975500 -- (-736.825) (-738.546) (-737.578) [-736.575] * (-738.275) [-737.040] (-740.852) (-738.655) -- 0:00:01
976000 -- (-738.939) (-737.593) [-736.781] (-737.421) * (-738.587) (-737.244) (-742.462) [-740.756] -- 0:00:01
976500 -- (-739.454) [-736.941] (-736.818) (-738.725) * (-738.288) (-736.177) [-738.782] (-740.017) -- 0:00:01
977000 -- (-736.986) [-737.132] (-736.451) (-737.524) * (-738.525) (-736.093) [-738.039] (-740.002) -- 0:00:01
977500 -- (-738.739) (-737.414) (-737.867) [-738.307] * (-738.342) (-736.036) (-738.514) [-738.222] -- 0:00:01
978000 -- (-737.471) (-739.515) (-737.465) [-737.699] * (-743.087) (-736.064) [-738.805] (-737.121) -- 0:00:01
978500 -- (-740.710) (-739.203) (-737.249) [-737.047] * (-735.804) [-735.772] (-736.270) (-736.410) -- 0:00:01
979000 -- (-741.522) (-736.382) [-736.735] (-737.599) * (-736.461) (-736.452) [-736.809] (-744.940) -- 0:00:01
979500 -- (-738.226) (-739.709) [-736.806] (-737.862) * (-736.301) (-740.674) (-740.322) [-738.359] -- 0:00:01
980000 -- (-739.129) [-735.812] (-739.248) (-736.716) * (-738.113) (-736.187) [-741.548] (-743.109) -- 0:00:01
Average standard deviation of split frequencies: 0.010800
980500 -- [-737.974] (-736.221) (-736.023) (-740.436) * (-739.376) (-736.485) [-736.315] (-739.413) -- 0:00:01
981000 -- (-736.919) (-736.221) [-737.691] (-736.735) * (-739.621) (-736.014) [-736.635] (-740.542) -- 0:00:01
981500 -- [-735.920] (-737.139) (-738.656) (-739.434) * (-741.938) [-735.546] (-736.350) (-737.044) -- 0:00:01
982000 -- (-740.014) (-739.909) (-741.344) [-738.158] * (-739.288) (-737.309) (-737.651) [-736.860] -- 0:00:01
982500 -- (-736.237) (-736.537) [-741.818] (-740.521) * (-741.100) [-738.693] (-740.891) (-740.768) -- 0:00:01
983000 -- (-739.307) [-739.003] (-741.721) (-743.200) * (-741.132) [-739.589] (-736.993) (-737.514) -- 0:00:01
983500 -- [-739.160] (-737.383) (-742.036) (-738.084) * [-736.244] (-740.748) (-736.839) (-736.469) -- 0:00:00
984000 -- [-735.815] (-737.575) (-742.197) (-736.734) * (-742.011) (-738.765) (-736.946) [-737.972] -- 0:00:00
984500 -- (-735.949) [-739.701] (-742.334) (-738.531) * [-737.727] (-742.075) (-737.621) (-737.989) -- 0:00:00
985000 -- (-736.146) (-737.226) [-736.827] (-740.271) * (-737.638) (-737.078) [-736.646] (-737.982) -- 0:00:00
Average standard deviation of split frequencies: 0.011251
985500 -- (-736.670) (-736.072) (-736.869) [-740.225] * (-736.951) [-737.419] (-736.909) (-737.052) -- 0:00:00
986000 -- (-736.049) [-737.112] (-737.339) (-738.122) * [-738.511] (-740.766) (-737.636) (-737.318) -- 0:00:00
986500 -- (-738.728) [-738.835] (-747.972) (-737.698) * (-738.636) (-744.247) [-736.362] (-739.736) -- 0:00:00
987000 -- (-736.928) (-738.844) (-737.455) [-736.625] * (-736.874) (-737.169) (-742.371) [-737.281] -- 0:00:00
987500 -- (-738.885) (-742.861) [-736.008] (-737.332) * (-737.115) (-737.936) [-737.314] (-737.612) -- 0:00:00
988000 -- [-737.112] (-741.227) (-739.300) (-739.651) * (-736.065) (-735.635) [-737.883] (-738.943) -- 0:00:00
988500 -- (-737.810) (-739.593) [-737.690] (-739.039) * [-736.439] (-736.403) (-740.645) (-742.192) -- 0:00:00
989000 -- [-738.751] (-737.321) (-739.521) (-736.395) * (-738.959) [-737.691] (-737.969) (-742.147) -- 0:00:00
989500 -- [-741.091] (-736.471) (-738.884) (-738.754) * (-741.001) [-737.546] (-738.231) (-736.773) -- 0:00:00
990000 -- (-738.010) (-736.461) [-737.942] (-738.879) * [-740.805] (-737.975) (-739.986) (-742.014) -- 0:00:00
Average standard deviation of split frequencies: 0.011325
990500 -- (-736.541) [-737.458] (-740.335) (-740.913) * (-738.102) (-741.300) [-736.884] (-736.373) -- 0:00:00
991000 -- (-738.313) (-738.332) [-736.988] (-740.825) * (-737.619) (-737.974) (-738.249) [-736.591] -- 0:00:00
991500 -- (-737.384) (-736.306) [-735.802] (-738.227) * (-737.244) [-739.885] (-743.699) (-740.395) -- 0:00:00
992000 -- (-738.834) (-736.711) [-738.926] (-738.596) * [-738.507] (-741.270) (-736.530) (-737.389) -- 0:00:00
992500 -- [-736.963] (-737.587) (-737.576) (-739.160) * (-736.553) (-741.193) [-736.012] (-742.486) -- 0:00:00
993000 -- [-737.456] (-738.048) (-738.799) (-738.477) * [-736.571] (-740.260) (-737.714) (-740.167) -- 0:00:00
993500 -- (-740.027) (-737.165) (-737.575) [-737.065] * (-735.885) (-738.754) [-738.836] (-737.539) -- 0:00:00
994000 -- (-737.957) (-739.614) [-738.823] (-737.681) * (-740.329) [-739.157] (-739.047) (-736.426) -- 0:00:00
994500 -- [-740.120] (-738.423) (-738.976) (-737.799) * (-739.011) (-740.147) (-737.566) [-738.013] -- 0:00:00
995000 -- [-739.159] (-736.843) (-736.331) (-738.019) * [-737.436] (-739.245) (-736.323) (-737.548) -- 0:00:00
Average standard deviation of split frequencies: 0.011643
995500 -- (-736.942) (-736.978) [-737.454] (-736.766) * (-743.601) [-738.271] (-736.748) (-737.930) -- 0:00:00
996000 -- (-737.432) (-736.771) [-737.577] (-737.209) * (-740.878) (-736.773) (-739.725) [-737.125] -- 0:00:00
996500 -- (-740.405) (-738.660) [-737.026] (-737.417) * [-737.121] (-736.046) (-739.214) (-740.333) -- 0:00:00
997000 -- (-738.801) [-739.123] (-738.752) (-738.573) * (-739.025) [-736.493] (-737.874) (-737.696) -- 0:00:00
997500 -- (-738.804) [-737.671] (-737.271) (-742.956) * (-736.064) (-736.666) (-736.644) [-737.089] -- 0:00:00
998000 -- (-737.284) (-738.051) (-742.161) [-737.897] * (-736.183) (-738.238) (-737.642) [-737.070] -- 0:00:00
998500 -- (-737.900) (-735.871) [-740.672] (-739.801) * (-736.436) [-736.390] (-736.330) (-738.876) -- 0:00:00
999000 -- (-738.466) [-738.330] (-736.926) (-738.429) * [-741.365] (-740.029) (-738.090) (-737.725) -- 0:00:00
999500 -- [-736.530] (-740.286) (-739.500) (-741.608) * (-737.180) [-738.978] (-737.685) (-737.740) -- 0:00:00
1000000 -- (-737.074) (-736.840) [-737.186] (-738.214) * (-738.126) (-737.478) (-740.907) [-738.422] -- 0:00:00
Average standard deviation of split frequencies: 0.011463
Analysis completed in 60 seconds
Analysis used 59.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -735.45
Likelihood of best state for "cold" chain of run 2 was -735.45
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.4 % ( 19 %) Dirichlet(Pi{all})
32.8 % ( 26 %) Slider(Pi{all})
79.2 % ( 54 %) Multiplier(Alpha{1,2})
78.0 % ( 59 %) Multiplier(Alpha{3})
23.7 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.0 % ( 35 %) Dirichlet(Pi{all})
32.7 % ( 25 %) Slider(Pi{all})
78.1 % ( 55 %) Multiplier(Alpha{1,2})
77.9 % ( 55 %) Multiplier(Alpha{3})
22.8 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
70.4 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167760 0.82 0.67
3 | 166515 166233 0.84
4 | 166719 166280 166493
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165733 0.82 0.67
3 | 167156 166571 0.84
4 | 166618 166870 167052
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -737.25
| 1 2 |
| 11 1 |
| 1 1 1 2 2 2 1 |
| 2 222 2 2 * 2 2 2 222 1 |
|2 2 2 2 2 1 12 2 |
| 1 * 1 1 2 2 *1 1 1 1*1 1 1 1 2 2|
| * 1 2 2 12 2 1 2 21 22 * 1|
| 1 2 11 2 11 1 1 1 |
| 2 * 1 22 1 1 1 22 2 2 |
| 1 1 1 1 2 2 * 11 |
|1 2 2 12 1 |
| 2 1 2 |
| 1 |
| 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -738.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -737.22 -740.22
2 -737.16 -740.72
--------------------------------------
TOTAL -737.19 -740.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891955 0.091876 0.385454 1.514722 0.857537 1501.00 1501.00 1.000
r(A<->C){all} 0.159139 0.017792 0.000091 0.422114 0.123121 261.69 342.31 1.000
r(A<->G){all} 0.162222 0.019288 0.000135 0.440418 0.124040 173.38 179.26 1.000
r(A<->T){all} 0.166677 0.020564 0.000131 0.469117 0.128485 139.98 190.53 1.002
r(C<->G){all} 0.165972 0.019197 0.000007 0.433085 0.131093 194.79 232.41 1.009
r(C<->T){all} 0.179481 0.021029 0.000001 0.459274 0.147255 197.63 235.15 1.000
r(G<->T){all} 0.166509 0.020382 0.000036 0.453226 0.125120 153.17 212.19 1.003
pi(A){all} 0.212433 0.000311 0.178886 0.247428 0.212148 1070.78 1165.68 1.001
pi(C){all} 0.271496 0.000358 0.236216 0.309681 0.270886 1149.01 1156.80 1.000
pi(G){all} 0.313506 0.000374 0.277768 0.353507 0.312814 1353.71 1376.71 1.000
pi(T){all} 0.202565 0.000300 0.166202 0.233964 0.201793 1201.05 1322.61 1.000
alpha{1,2} 0.413473 0.226103 0.000129 1.382489 0.249313 1291.36 1292.33 1.000
alpha{3} 0.465597 0.263113 0.000236 1.483969 0.293367 1158.06 1188.78 1.000
pinvar{all} 0.997024 0.000012 0.990323 0.999999 0.998129 1189.10 1232.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*...*
9 -- ....**
10 -- .**.**
11 -- .*..*.
12 -- ..*.*.
13 -- .****.
14 -- .***.*
15 -- .*.***
16 -- .**...
17 -- ...**.
18 -- ...*.*
19 -- ..****
20 -- ..*..*
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 480 0.159893 0.010364 0.152565 0.167222 2
8 461 0.153564 0.000471 0.153231 0.153897 2
9 458 0.152565 0.010364 0.145237 0.159893 2
10 458 0.152565 0.010364 0.145237 0.159893 2
11 443 0.147568 0.010835 0.139907 0.155230 2
12 436 0.145237 0.016959 0.133245 0.157229 2
13 435 0.144903 0.015546 0.133911 0.155896 2
14 434 0.144570 0.000942 0.143904 0.145237 2
15 428 0.142572 0.016959 0.130580 0.154564 2
16 423 0.140906 0.007066 0.135909 0.145903 2
17 416 0.138574 0.014133 0.128581 0.148568 2
18 416 0.138574 0.020728 0.123917 0.153231 2
19 402 0.133911 0.008480 0.127915 0.139907 2
20 393 0.130913 0.013662 0.121252 0.140573 2
21 386 0.128581 0.015075 0.117921 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100376 0.009851 0.000036 0.288828 0.071615 1.000 2
length{all}[2] 0.094568 0.009213 0.000039 0.277008 0.065651 1.000 2
length{all}[3] 0.097581 0.009479 0.000012 0.283909 0.067893 1.002 2
length{all}[4] 0.095176 0.008631 0.000059 0.275464 0.066970 1.000 2
length{all}[5] 0.100751 0.010184 0.000032 0.309666 0.069728 1.000 2
length{all}[6] 0.102536 0.010567 0.000101 0.316732 0.069983 1.000 2
length{all}[7] 0.101980 0.010569 0.000119 0.294245 0.068883 1.001 2
length{all}[8] 0.100854 0.010109 0.000003 0.277745 0.070786 0.999 2
length{all}[9] 0.103024 0.010466 0.000013 0.301891 0.068550 0.998 2
length{all}[10] 0.103378 0.011314 0.000104 0.316877 0.069807 0.999 2
length{all}[11] 0.094816 0.008797 0.000242 0.292261 0.064284 0.998 2
length{all}[12] 0.102456 0.011746 0.000019 0.309803 0.071225 0.998 2
length{all}[13] 0.098287 0.009610 0.000355 0.271002 0.070650 1.000 2
length{all}[14] 0.094810 0.008466 0.000271 0.291205 0.071473 0.999 2
length{all}[15] 0.099553 0.010106 0.000111 0.305812 0.073216 0.998 2
length{all}[16] 0.091474 0.009753 0.000270 0.269076 0.064240 1.000 2
length{all}[17] 0.112836 0.013782 0.001084 0.338447 0.080011 0.999 2
length{all}[18] 0.108074 0.010895 0.000033 0.295350 0.077788 0.998 2
length{all}[19] 0.094117 0.009001 0.000120 0.298731 0.065076 0.998 2
length{all}[20] 0.099871 0.009629 0.000022 0.301909 0.066583 0.998 2
length{all}[21] 0.091753 0.008955 0.000005 0.291029 0.055619 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011463
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 537
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 179 / 179 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 179 / 179 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084031 0.062978 0.068685 0.036613 0.031832 0.010961 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -755.196097
Iterating by ming2
Initial: fx= 755.196097
x= 0.08403 0.06298 0.06869 0.03661 0.03183 0.01096 0.30000 1.30000
1 h-m-p 0.0000 0.0001 429.3340 ++ 743.738936 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0113 29.4168 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 392.1474 ++ 725.449545 m 0.0001 44 | 2/8
4 h-m-p 0.0019 0.0165 21.5912 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 351.6370 ++ 722.082713 m 0.0000 76 | 3/8
6 h-m-p 0.0005 0.0249 15.7238 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 304.3098 ++ 708.086996 m 0.0002 107 | 4/8
8 h-m-p 0.0034 0.0424 10.9298 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 249.4172 ++ 706.053517 m 0.0000 139 | 5/8
10 h-m-p 0.0009 0.1237 6.3826 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 176.3035 ++ 703.311677 m 0.0001 170 | 6/8
12 h-m-p 0.1374 8.0000 0.0000 +++ 703.311677 m 8.0000 182 | 6/8
13 h-m-p 0.2607 8.0000 0.0001 +++ 703.311677 m 8.0000 196 | 6/8
14 h-m-p 0.0160 8.0000 0.0615 ------C 703.311677 0 0.0000 215 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 C 703.311677 0 0.0163 228 | 6/8
16 h-m-p 0.0160 8.0000 0.0002 +++++ 703.311677 m 8.0000 244 | 6/8
17 h-m-p 0.0099 3.8491 0.1342 -------C 703.311677 0 0.0000 264 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 ---Y 703.311677 0 0.0001 280 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/8
21 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -703.311677
353 lfun, 353 eigenQcodon, 2118 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061096 0.040671 0.038199 0.080521 0.103838 0.083808 0.301034 0.563783 0.366109
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.609116
np = 9
lnL0 = -772.952410
Iterating by ming2
Initial: fx= 772.952410
x= 0.06110 0.04067 0.03820 0.08052 0.10384 0.08381 0.30103 0.56378 0.36611
1 h-m-p 0.0000 0.0002 404.0500 +++ 734.639482 m 0.0002 24 | 1/9
2 h-m-p 0.0000 0.0001 224.7597 ++ 732.470336 m 0.0001 45 | 2/9
3 h-m-p 0.0000 0.0000 4418.2425 ++ 718.562874 m 0.0000 65 | 3/9
4 h-m-p 0.0000 0.0001 2069.3939 ++ 708.107995 m 0.0001 84 | 4/9
5 h-m-p 0.0000 0.0000 981.7151 ++ 706.854301 m 0.0000 102 | 5/9
6 h-m-p 0.0000 0.0000 17186.5465 ++ 704.243515 m 0.0000 119 | 6/9
7 h-m-p 0.0119 0.2714 2.7272 -------------.. | 6/9
8 h-m-p 0.0000 0.0000 175.9930 ++ 703.311682 m 0.0000 161 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311682 m 8.0000 179 | 7/9
10 h-m-p 0.0044 2.1827 0.2982 +++++ 703.311677 m 2.1827 196 | 7/9
11 h-m-p 0.0000 0.0000 0.0222
h-m-p: 6.15187896e-16 3.07593948e-15 2.21764993e-02 703.311677
.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311677 m 8.0000 224 | 7/9
13 h-m-p 0.0000 0.0001 0.5155 ---C 703.311677 0 0.0000 241 | 7/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 703.311677 m 8.0000 258 | 7/9
15 h-m-p 0.0009 0.0043 0.4578 ------C 703.311677 0 0.0000 278 | 7/9
16 h-m-p 0.0029 1.4678 0.0010 -----Y 703.311677 0 0.0000 297 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 -----------C 703.311677 0 0.0000 322
Out..
lnL = -703.311677
323 lfun, 969 eigenQcodon, 3876 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088811 0.029557 0.100498 0.094630 0.045214 0.085613 0.089160 1.244520 0.362074 0.278383 1.539743
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.379825
np = 11
lnL0 = -775.607361
Iterating by ming2
Initial: fx= 775.607361
x= 0.08881 0.02956 0.10050 0.09463 0.04521 0.08561 0.08916 1.24452 0.36207 0.27838 1.53974
1 h-m-p 0.0000 0.0002 369.2222 +++ 748.379233 m 0.0002 28 | 1/11
2 h-m-p 0.0001 0.0003 237.8803 ++ 735.130991 m 0.0003 53 | 2/11
3 h-m-p 0.0000 0.0001 1528.0189 ++ 708.296036 m 0.0001 77 | 3/11
4 h-m-p 0.0001 0.0003 119.5479 ++ 706.434051 m 0.0003 100 | 4/11
5 h-m-p 0.0000 0.0002 385.8148 ++ 705.602930 m 0.0002 122 | 5/11
6 h-m-p 0.0031 0.2319 4.8087 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 246.3860 ++ 704.258930 m 0.0000 173 | 6/11
8 h-m-p 0.0017 0.0370 2.1946 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 175.4666 ++ 703.311675 m 0.0000 222 | 7/11
10 h-m-p 0.0324 8.0000 0.0000 ++++ 703.311675 m 8.0000 243 | 7/11
11 h-m-p 0.0160 8.0000 0.2477 --------C 703.311675 0 0.0000 269 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 --Y 703.311675 0 0.0003 289 | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 703.311675 m 8.0000 310 | 7/11
14 h-m-p 0.0160 8.0000 1.7171 -----------Y 703.311675 0 0.0000 339 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 ---C 703.311675 0 0.0001 360 | 7/11
16 h-m-p 0.0160 8.0000 0.0000 -------C 703.311675 0 0.0000 385
Out..
lnL = -703.311675
386 lfun, 1544 eigenQcodon, 6948 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -703.323347 S = -703.309017 -0.005488
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038054 0.102629 0.018557 0.031935 0.037783 0.032616 0.063264 1.187627 1.412453
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.119097
np = 9
lnL0 = -748.193679
Iterating by ming2
Initial: fx= 748.193679
x= 0.03805 0.10263 0.01856 0.03193 0.03778 0.03262 0.06326 1.18763 1.41245
1 h-m-p 0.0000 0.0001 409.9923 ++ 729.467340 m 0.0001 23 | 1/9
2 h-m-p 0.0006 0.0032 32.3752 ++ 728.340065 m 0.0032 44 | 2/9
3 h-m-p 0.0000 0.0002 3051.2172 ++ 721.441779 m 0.0002 64 | 3/9
4 h-m-p 0.0000 0.0000 107.5144 ++ 721.025308 m 0.0000 83 | 4/9
5 h-m-p 0.0002 0.0350 8.1690 ----------.. | 4/9
6 h-m-p 0.0000 0.0000 293.4407 ++ 717.567270 m 0.0000 126 | 5/9
7 h-m-p 0.0007 0.0429 13.9607 -----------.. | 5/9
8 h-m-p 0.0000 0.0000 240.3002 ++ 717.446791 m 0.0000 168 | 6/9
9 h-m-p 0.0001 0.0489 12.2413 ---------.. | 6/9
10 h-m-p 0.0000 0.0005 167.3810 +++ 703.311669 m 0.0005 207 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 703.311669 m 8.0000 222 | 7/9
12 h-m-p 0.0160 8.0000 0.0230 +++++ 703.311669 m 8.0000 239 | 7/9
13 h-m-p 0.1183 8.0000 1.5577 ++++ 703.311664 m 8.0000 255 | 7/9
14 h-m-p 1.6000 8.0000 0.5438 ++ 703.311664 m 8.0000 269 | 7/9
15 h-m-p 0.6501 8.0000 6.6913 ++ 703.311663 m 8.0000 283 | 7/9
16 h-m-p 1.3185 6.5927 4.1614 ++ 703.311663 m 6.5927 297 | 8/9
17 h-m-p 0.3651 8.0000 7.5283 -----------C 703.311663 0 0.0000 322 | 8/9
18 h-m-p 0.0160 8.0000 0.0002 --Y 703.311663 0 0.0003 337 | 8/9
19 h-m-p 0.0160 8.0000 0.0000 --Y 703.311663 0 0.0003 352
Out..
lnL = -703.311663
353 lfun, 3883 eigenQcodon, 21180 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080222 0.043972 0.103975 0.080737 0.053420 0.054001 0.000100 0.900000 1.037822 1.539910 1.301496
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.845204
np = 11
lnL0 = -771.974963
Iterating by ming2
Initial: fx= 771.974963
x= 0.08022 0.04397 0.10398 0.08074 0.05342 0.05400 0.00011 0.90000 1.03782 1.53991 1.30150
1 h-m-p 0.0000 0.0000 378.8110 ++ 771.633104 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0021 157.3651 ++++ 728.387611 m 0.0021 54 | 2/11
3 h-m-p 0.0000 0.0000 40549.4277 ++ 720.631493 m 0.0000 78 | 3/11
4 h-m-p 0.0001 0.0003 28.3746 ++ 720.450473 m 0.0003 101 | 4/11
5 h-m-p 0.0000 0.0010 450.4736 +++ 709.774294 m 0.0010 124 | 5/11
6 h-m-p 0.0000 0.0000 299.8632 ++ 709.587275 m 0.0000 145 | 6/11
7 h-m-p 0.0001 0.0003 114.4921 ++ 703.311676 m 0.0003 165 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 703.311676 m 8.0000 184 | 7/11
9 h-m-p 0.0081 4.0526 0.2391 ------C 703.311676 0 0.0000 208 | 7/11
10 h-m-p 0.0160 8.0000 0.0005 ----C 703.311676 0 0.0000 230 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311676 m 8.0000 280 | 7/11
13 h-m-p 0.0160 8.0000 0.0273 -------C 703.311676 0 0.0000 305 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 --C 703.311676 0 0.0003 325 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311676 m 8.0000 346 | 7/11
16 h-m-p 0.0026 1.3146 0.5600 -------C 703.311676 0 0.0000 371 | 7/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 703.311676 m 8.0000 392 | 7/11
18 h-m-p 0.0006 0.2912 0.9367 +++++ 703.311675 m 0.2912 413 | 8/11
19 h-m-p 0.1909 0.9545 0.7751 ----------N 703.311675 0 0.0000 441 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311675 m 8.0000 461 | 8/11
21 h-m-p 0.0044 2.2105 0.3323 +++++ 703.311668 m 2.2105 481 | 9/11
22 h-m-p 0.8873 4.9287 0.5825 -------------C 703.311668 0 0.0000 511 | 9/11
23 h-m-p 0.0160 8.0000 0.0036 +++++ 703.311668 m 8.0000 530 | 9/11
24 h-m-p 0.0361 3.4428 0.8048 ---------Y 703.311668 0 0.0000 555 | 9/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 703.311668 m 8.0000 574 | 9/11
26 h-m-p 0.0020 0.9872 2.8036 ----------C 703.311668 0 0.0000 600 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311668 m 8.0000 619 | 9/11
28 h-m-p 0.0012 0.6164 4.7003 -----------.. | 9/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311668 m 8.0000 663 | 9/11
30 h-m-p 0.0160 8.0000 0.1770 ----------N 703.311668 0 0.0000 689 | 9/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311668 m 8.0000 708 | 9/11
32 h-m-p 0.0160 8.0000 0.3039 +++++ 703.311658 m 8.0000 727 | 9/11
33 h-m-p 0.0145 0.0724 61.0435 ------------C 703.311658 0 0.0000 755 | 9/11
34 h-m-p 0.0007 0.3355 13.1775 -----------.. | 9/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 799 | 9/11
36 h-m-p 0.0160 8.0000 0.5034 ----------Y 703.311658 0 0.0000 825 | 9/11
37 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 844 | 9/11
38 h-m-p 0.0160 8.0000 1.8038 ----------Y 703.311658 0 0.0000 870 | 9/11
39 h-m-p 0.0160 8.0000 0.0001 --------N 703.311658 0 0.0000 894 | 9/11
40 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 913 | 9/11
41 h-m-p 0.0160 8.0000 0.6118 -------------.. | 9/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 959 | 9/11
43 h-m-p 0.0160 8.0000 0.4407 -------------.. | 9/11
44 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 1005 | 9/11
45 h-m-p 0.0160 8.0000 0.4403 ----------C 703.311658 0 0.0000 1031 | 9/11
46 h-m-p 0.0160 8.0000 0.0000 ---Y 703.311658 0 0.0001 1050 | 9/11
47 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 1069 | 9/11
48 h-m-p 0.0153 7.6370 0.9869 -------------.. | 9/11
49 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 1115 | 9/11
50 h-m-p 0.0160 8.0000 0.6997 -------------.. | 9/11
51 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 1161 | 9/11
52 h-m-p 0.0160 8.0000 0.2721 ----------C 703.311658 0 0.0000 1187 | 9/11
53 h-m-p 0.0160 8.0000 0.0000 -Y 703.311658 0 0.0010 1204 | 9/11
54 h-m-p 0.0160 8.0000 0.0000 +++++ 703.311658 m 8.0000 1223 | 9/11
55 h-m-p 0.0008 0.4227 0.3185 ++++
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
+ 703.311655 m 0.4227 1242
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33171) = 5.359920e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33136) = 5.360398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33153) = 5.360159e-161 2000 rounds
| 10/11
56 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33169) = 5.359949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33156) = 5.360118e-161 2000 rounds
Y 703.311655 0 1.6000 1258
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.547226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33174) = 5.359868e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33140) = 5.360345e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
| 10/11
57 h-m-p 1.0000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.33161) = 5.360054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33158) = 5.360093e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360105e-161 2000 rounds
N 703.311655 0 0.0625 1274
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.547223e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33175) = 5.359864e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33140) = 5.360342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360103e-161 2000 rounds
| 10/11
58 h-m-p 0.6667 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360116e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
C 703.311655 0 0.6667 1289
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.547226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33174) = 5.359868e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33140) = 5.360345e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360106e-161 2000 rounds
| 10/11
59 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
C 703.311655 0 0.4000 1304
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.547227e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33174) = 5.359868e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33140) = 5.360346e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33157) = 5.360107e-161 2000 rounds
| 10/11
60 h-m-p 0.0160 8.0000 7.9576
QuantileBeta(0.15, 0.00500, 4.45889) = 5.188740e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.84086) = 4.734504e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.36871) = 3.505909e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.48012) = 1.719383e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 36.92578) = 4.557675e-162 2000 rounds
++ 703.311655 m 8.0000 1322 | 10/11
61 h-m-p 0.4441 2.2206 13.9635 ++ 703.311655 m 2.2206 1337 | 10/11
62 h-m-p 0.0000 0.0000 109.8233
h-m-p: 0.00000000e+00 0.00000000e+00 1.09823308e+02 703.311655
.. | 10/11
63 h-m-p 0.0160 8.0000 0.0000 ---Y 703.311655 0 0.0001 1367 | 10/11
64 h-m-p 0.0160 8.0000 0.0000 ---Y 703.311655 0 0.0001 1385
Out..
lnL = -703.311655
1386 lfun, 16632 eigenQcodon, 91476 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -703.374344 S = -703.312635 -0.027437
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:34
did 20 / 48 patterns 0:34
did 30 / 48 patterns 0:34
did 40 / 48 patterns 0:34
did 48 / 48 patterns 0:34
Time used: 0:34
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179
NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
NC_002677_1_NP_302250_1_1122_rplF MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
**************************************************
NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
NC_002677_1_NP_302250_1_1122_rplF IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
**************************************************
NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
NC_002677_1_NP_302250_1_1122_rplF GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
**************************************************
NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NC_002677_1_NP_302250_1_1122_rplF RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
*****************************
>NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG >NC_002677_1_NP_302250_1_1122_rplF ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG >NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG >NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG >NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG >NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>NC_011896_1_WP_010908571_1_1970_MLBR_RS09350 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK >NC_002677_1_NP_302250_1_1122_rplF MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK >NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK >NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK >NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK >NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420 MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
#NEXUS
[ID: 0395276445]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908571_1_1970_MLBR_RS09350
NC_002677_1_NP_302250_1_1122_rplF
NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335
NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445
NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155
NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908571_1_1970_MLBR_RS09350,
2 NC_002677_1_NP_302250_1_1122_rplF,
3 NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335,
4 NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445,
5 NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155,
6 NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07161464,2:0.06565083,3:0.06789323,4:0.06697013,5:0.06972777,6:0.069983);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07161464,2:0.06565083,3:0.06789323,4:0.06697013,5:0.06972777,6:0.069983);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -737.22 -740.22
2 -737.16 -740.72
--------------------------------------
TOTAL -737.19 -740.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891955 0.091876 0.385454 1.514722 0.857537 1501.00 1501.00 1.000
r(A<->C){all} 0.159139 0.017792 0.000091 0.422114 0.123121 261.69 342.31 1.000
r(A<->G){all} 0.162222 0.019288 0.000135 0.440418 0.124040 173.38 179.26 1.000
r(A<->T){all} 0.166677 0.020564 0.000131 0.469117 0.128485 139.98 190.53 1.002
r(C<->G){all} 0.165972 0.019197 0.000007 0.433085 0.131093 194.79 232.41 1.009
r(C<->T){all} 0.179481 0.021029 0.000001 0.459274 0.147255 197.63 235.15 1.000
r(G<->T){all} 0.166509 0.020382 0.000036 0.453226 0.125120 153.17 212.19 1.003
pi(A){all} 0.212433 0.000311 0.178886 0.247428 0.212148 1070.78 1165.68 1.001
pi(C){all} 0.271496 0.000358 0.236216 0.309681 0.270886 1149.01 1156.80 1.000
pi(G){all} 0.313506 0.000374 0.277768 0.353507 0.312814 1353.71 1376.71 1.000
pi(T){all} 0.202565 0.000300 0.166202 0.233964 0.201793 1201.05 1322.61 1.000
alpha{1,2} 0.413473 0.226103 0.000129 1.382489 0.249313 1291.36 1292.33 1.000
alpha{3} 0.465597 0.263113 0.000236 1.483969 0.293367 1158.06 1188.78 1.000
pinvar{all} 0.997024 0.000012 0.990323 0.999999 0.998129 1189.10 1232.33 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 179
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 1 1 1 1 1 1 | CGC 9 9 9 9 9 9
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 11 11 11 11 11 11 | ACC 2 2 2 2 2 2 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 6 6 6 6 6 6 | AAG 11 11 11 11 11 11 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 12 12 12 12 12 12
GTC 9 9 9 9 9 9 | GCC 2 2 2 2 2 2 | GAC 5 5 5 5 5 5 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 4 4 4 4 4 4 | GAG 6 6 6 6 6 6 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908571_1_1970_MLBR_RS09350
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
#2: NC_002677_1_NP_302250_1_1122_rplF
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
#3: NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
#4: NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
#5: NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
#6: NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 24 | TCC 12 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 24
CTC 6 | CCC 24 | CAC 6 | CGC 54
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 30 | CCG 24 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 12 | Ser S AGT 0
ATC 66 | ACC 12 | AAC 30 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 36 | AAG 66 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 72
GTC 54 | GCC 12 | GAC 30 | GGC 18
GTA 0 | GCA 6 | Glu E GAA 18 | GGA 18
GTG 42 | GCG 24 | GAG 36 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11732 C:0.24022 A:0.28492 G:0.35754
position 2: T:0.28492 C:0.22346 A:0.27933 G:0.21229
position 3: T:0.20112 C:0.35196 A:0.07263 G:0.37430
Average T:0.20112 C:0.27188 A:0.21229 G:0.31471
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 8): -703.311677 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.301034 1.301496
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908571_1_1970_MLBR_RS09350: 0.000004, NC_002677_1_NP_302250_1_1122_rplF: 0.000004, NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335: 0.000004, NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445: 0.000004, NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155: 0.000004, NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30103
omega (dN/dS) = 1.30150
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
7..2 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
7..3 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
7..4 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
7..5 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
7..6 0.000 435.8 101.2 1.3015 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -703.311677 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.089160 0.000261 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908571_1_1970_MLBR_RS09350: 0.000004, NC_002677_1_NP_302250_1_1122_rplF: 0.000004, NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335: 0.000004, NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445: 0.000004, NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155: 0.000004, NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.08916
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00026 0.99974
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
7..2 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
7..3 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
7..4 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
7..5 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
7..6 0.000 439.6 97.4 0.9997 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -703.311675 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.063264 0.596326 0.235645 0.000001 1.590206
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908571_1_1970_MLBR_RS09350: 0.000004, NC_002677_1_NP_302250_1_1122_rplF: 0.000004, NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335: 0.000004, NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445: 0.000004, NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155: 0.000004, NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.06326
MLEs of dN/dS (w) for site classes (K=3)
p: 0.59633 0.23564 0.16803
w: 0.00000 1.00000 1.59021
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
7..2 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
7..3 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
7..4 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
7..5 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
7..6 0.000 440.1 96.9 0.5028 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908571_1_1970_MLBR_RS09350)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908571_1_1970_MLBR_RS09350)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -703.311663 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 10.415986 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908571_1_1970_MLBR_RS09350: 0.000004, NC_002677_1_NP_302250_1_1122_rplF: 0.000004, NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335: 0.000004, NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445: 0.000004, NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155: 0.000004, NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 10.41599 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.05381 0.06666 0.07516 0.08241 0.08929 0.09626 0.10379 0.11257 0.12414 0.14500
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
7..2 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
7..3 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
7..4 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
7..5 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
7..6 0.000 441.4 95.6 0.0949 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -703.311655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908571_1_1970_MLBR_RS09350: 0.000004, NC_002677_1_NP_302250_1_1122_rplF: 0.000004, NZ_LVXE01000061_1_WP_010908571_1_2372_A3216_RS12335: 0.000004, NZ_LYPH01000044_1_WP_010908571_1_1771_A8144_RS08445: 0.000004, NZ_CP029543_1_WP_010908571_1_1995_DIJ64_RS10155: 0.000004, NZ_AP014567_1_WP_010908571_1_2048_JK2ML_RS10420: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 441.4 95.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908571_1_1970_MLBR_RS09350)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:34
Model 1: NearlyNeutral -703.311677 Model 2: PositiveSelection -703.311675 Model 0: one-ratio -703.311677 Model 7: beta -703.311663 Model 8: beta&w>1 -703.311655 Model 0 vs 1 0.0 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.5999999959603883E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
