--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:35:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -737.22          -740.22
2       -737.16          -740.72
--------------------------------------
TOTAL     -737.19          -740.50
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.891955    0.091876    0.385454    1.514722    0.857537   1501.00   1501.00    1.000
r(A<->C){all}   0.159139    0.017792    0.000091    0.422114    0.123121    261.69    342.31    1.000
r(A<->G){all}   0.162222    0.019288    0.000135    0.440418    0.124040    173.38    179.26    1.000
r(A<->T){all}   0.166677    0.020564    0.000131    0.469117    0.128485    139.98    190.53    1.002
r(C<->G){all}   0.165972    0.019197    0.000007    0.433085    0.131093    194.79    232.41    1.009
r(C<->T){all}   0.179481    0.021029    0.000001    0.459274    0.147255    197.63    235.15    1.000
r(G<->T){all}   0.166509    0.020382    0.000036    0.453226    0.125120    153.17    212.19    1.003
pi(A){all}      0.212433    0.000311    0.178886    0.247428    0.212148   1070.78   1165.68    1.001
pi(C){all}      0.271496    0.000358    0.236216    0.309681    0.270886   1149.01   1156.80    1.000
pi(G){all}      0.313506    0.000374    0.277768    0.353507    0.312814   1353.71   1376.71    1.000
pi(T){all}      0.202565    0.000300    0.166202    0.233964    0.201793   1201.05   1322.61    1.000
alpha{1,2}      0.413473    0.226103    0.000129    1.382489    0.249313   1291.36   1292.33    1.000
alpha{3}        0.465597    0.263113    0.000236    1.483969    0.293367   1158.06   1188.78    1.000
pinvar{all}     0.997024    0.000012    0.990323    0.999999    0.998129   1189.10   1232.33    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-703.311677
Model 2: PositiveSelection	-703.311675
Model 0: one-ratio	-703.311677
Model 7: beta	-703.311663
Model 8: beta&w>1	-703.311655


Model 0 vs 1	0.0

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	1.5999999959603883E-5
>C1
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C2
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C3
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C4
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C5
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C6
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179 

C1              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C2              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C3              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C4              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C5              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C6              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
                **************************************************

C1              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C2              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C3              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C4              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C5              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C6              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
                **************************************************

C1              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C2              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C3              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C4              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C5              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C6              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
                **************************************************

C1              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C2              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C3              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C4              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C5              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C6              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
                *****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  179 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  179 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5370]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5370]--->[5370]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 30.708 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C2              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C3              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C4              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C5              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
C6              MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
                **************************************************

C1              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C2              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C3              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C4              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C5              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
C6              IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
                **************************************************

C1              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C2              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C3              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C4              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C5              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
C6              GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
                **************************************************

C1              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C2              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C3              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C4              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C5              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
C6              RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
                *****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C2              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C3              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C4              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C5              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
C6              ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
                **************************************************

C1              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C2              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C3              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C4              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C5              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
C6              CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
                **************************************************

C1              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C2              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C3              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C4              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C5              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
C6              ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
                **************************************************

C1              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C2              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C3              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C4              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C5              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
C6              ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
                **************************************************

C1              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C2              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C3              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C4              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C5              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
C6              ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
                **************************************************

C1              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C2              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C3              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C4              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C5              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
C6              ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
                **************************************************

C1              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C2              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C3              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C4              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C5              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
C6              GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
                **************************************************

C1              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C2              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C3              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C4              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C5              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
C6              GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
                **************************************************

C1              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C2              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C3              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C4              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C5              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
C6              TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
                **************************************************

C1              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C2              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C3              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C4              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C5              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
C6              CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
                **************************************************

C1              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C2              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C3              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C4              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C5              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
C6              CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
                *************************************



>C1
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C2
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C3
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C4
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C5
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C6
ATGTCGCGCATTGGTAAGCAGCCGATTCCGGTCCCCGCCGGAGTCGACAT
CACGATCGATGGTCAAAACGTCTTGGTGAAGGGGCCCAAGGGTACTCTGG
ATTTGACGGTCGCTGAGCCGATCATGTTGGCGCGCAACGACGAAGGTGCA
ATCGTGGTCACCCGTCCCGACAATGAGCGGCGCAACCGCTCGCTGCACGG
ATTGTCGCGCACTTTGGTGTCCAACCTGGTCACCGGTGTGACGCAGGGTT
ACACTGTCAGCATGGAGATCTTCGGTGTCGGTTACCGGGCCCAGCTCAAG
GGCTCCAATCTGGAATTCGCGCTAGGGTATAGCCATCCAGTGGTGATCGA
GGCTCCCGAGGGTATCACGTTCGCGGTTCAGTCACCGACGAAGTTCACTA
TCACGGGGATCGACAAGCAGAAGGTTGGTCAGATCTCGGCGAACATCCGC
CGTCTGCGCCGTCCTGACCCTTATAAGGGTAAGGGCGTGCGTTACGAGGG
CGAACAGATTCGCCGCAAGGTCGGAAAAACAGGTAAG
>C1
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C2
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C3
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C4
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C5
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
>C6
MSRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGA
IVVTRPDNERRNRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 537 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790008
      Setting output file names to "/data/11res/rplF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 965419037
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0395276445
      Seed = 1318977423
      Swapseed = 1579790008
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1201.831744 -- -24.965149
         Chain 2 -- -1201.831561 -- -24.965149
         Chain 3 -- -1201.831674 -- -24.965149
         Chain 4 -- -1201.831744 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1201.831561 -- -24.965149
         Chain 2 -- -1201.831561 -- -24.965149
         Chain 3 -- -1201.831674 -- -24.965149
         Chain 4 -- -1201.831561 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1201.832] (-1201.832) (-1201.832) (-1201.832) * [-1201.832] (-1201.832) (-1201.832) (-1201.832) 
        500 -- (-749.697) [-745.111] (-748.833) (-743.578) * (-750.583) (-759.125) (-755.633) [-751.461] -- 0:00:00
       1000 -- (-747.339) (-750.024) (-762.711) [-746.669] * (-749.922) (-742.659) [-743.674] (-747.535) -- 0:00:00
       1500 -- (-745.909) (-746.465) [-742.787] (-748.400) * (-749.931) (-749.568) (-743.866) [-746.907] -- 0:00:00
       2000 -- (-750.348) (-744.094) [-748.245] (-745.333) * (-741.130) (-746.885) [-746.044] (-749.078) -- 0:00:00
       2500 -- (-756.896) [-749.353] (-749.687) (-751.386) * (-748.427) [-744.854] (-749.160) (-755.734) -- 0:00:00
       3000 -- (-744.406) (-742.343) (-747.937) [-745.609] * (-748.165) (-748.072) (-753.727) [-740.578] -- 0:00:00
       3500 -- (-749.928) (-739.827) (-747.956) [-748.911] * (-745.861) (-744.412) (-760.608) [-751.251] -- 0:00:00
       4000 -- (-750.453) (-745.082) [-741.961] (-750.180) * (-743.900) [-745.137] (-740.863) (-746.186) -- 0:00:00
       4500 -- [-747.660] (-750.179) (-746.790) (-748.838) * (-756.091) [-749.638] (-753.432) (-750.010) -- 0:00:00
       5000 -- (-742.414) [-742.612] (-746.657) (-749.101) * [-741.143] (-753.514) (-745.660) (-751.886) -- 0:00:00

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-743.187) (-743.376) [-744.032] (-749.111) * (-746.543) (-741.416) [-749.759] (-743.417) -- 0:00:00
       6000 -- [-751.635] (-747.646) (-746.562) (-748.707) * (-745.904) [-748.765] (-744.920) (-743.450) -- 0:00:00
       6500 -- (-748.182) (-747.336) [-741.085] (-742.954) * [-743.186] (-755.604) (-742.042) (-750.533) -- 0:00:00
       7000 -- (-750.022) (-753.232) [-746.938] (-751.132) * (-749.871) (-745.768) [-749.277] (-749.742) -- 0:00:00
       7500 -- [-742.987] (-753.798) (-752.840) (-745.068) * (-747.097) (-745.420) [-745.649] (-753.078) -- 0:00:00
       8000 -- (-748.160) (-748.997) [-743.285] (-743.118) * [-750.666] (-751.831) (-751.603) (-757.365) -- 0:00:00
       8500 -- (-748.060) (-747.492) (-748.327) [-745.073] * (-747.717) (-747.384) (-754.519) [-745.876] -- 0:00:00
       9000 -- (-751.967) (-750.697) (-746.214) [-746.999] * (-743.464) [-745.510] (-751.435) (-744.658) -- 0:00:00
       9500 -- (-745.796) (-747.662) (-745.580) [-742.856] * (-749.702) [-745.066] (-750.443) (-753.749) -- 0:00:00
      10000 -- (-747.958) (-752.202) (-746.225) [-744.345] * (-748.611) [-745.355] (-747.453) (-753.055) -- 0:00:00

      Average standard deviation of split frequencies: 0.083736

      10500 -- (-748.056) (-745.670) [-756.432] (-752.513) * [-743.681] (-745.249) (-749.032) (-751.758) -- 0:00:00
      11000 -- (-749.663) (-743.845) [-746.182] (-747.456) * [-745.996] (-746.155) (-747.174) (-743.270) -- 0:00:00
      11500 -- (-751.601) [-744.854] (-751.564) (-749.701) * (-745.871) [-745.186] (-750.702) (-744.495) -- 0:00:00
      12000 -- [-746.393] (-744.896) (-742.016) (-750.788) * (-743.895) [-742.890] (-741.006) (-745.485) -- 0:00:00
      12500 -- (-752.907) (-746.005) (-744.795) [-747.931] * (-745.481) [-741.849] (-749.214) (-747.542) -- 0:00:00
      13000 -- (-747.511) [-742.047] (-748.351) (-742.010) * (-750.335) (-743.162) (-742.444) [-748.358] -- 0:00:00
      13500 -- (-747.062) [-742.147] (-751.586) (-744.699) * (-741.605) [-750.114] (-748.965) (-747.303) -- 0:00:00
      14000 -- (-744.303) [-747.437] (-761.982) (-750.056) * [-737.735] (-747.756) (-744.951) (-749.314) -- 0:01:10
      14500 -- (-744.037) (-747.075) (-746.073) [-747.690] * (-736.789) (-756.787) [-744.910] (-738.989) -- 0:01:07
      15000 -- (-745.284) [-746.835] (-746.719) (-745.144) * (-738.467) (-745.593) (-745.605) [-739.649] -- 0:01:05

      Average standard deviation of split frequencies: 0.071331

      15500 -- (-749.634) (-743.470) (-755.201) [-745.123] * [-739.560] (-744.884) (-746.079) (-741.728) -- 0:01:03
      16000 -- (-743.989) [-747.756] (-750.385) (-740.848) * (-737.943) [-751.024] (-748.017) (-737.981) -- 0:01:01
      16500 -- [-754.193] (-749.869) (-744.317) (-746.914) * (-736.162) [-746.182] (-753.855) (-735.813) -- 0:00:59
      17000 -- [-744.427] (-749.628) (-746.598) (-751.544) * (-740.680) (-750.233) (-743.587) [-740.532] -- 0:00:57
      17500 -- (-747.741) [-742.998] (-745.980) (-753.709) * (-742.292) (-747.245) (-752.613) [-739.282] -- 0:00:56
      18000 -- [-749.678] (-745.960) (-748.696) (-753.203) * (-738.201) (-742.232) (-755.712) [-739.983] -- 0:00:54
      18500 -- [-755.847] (-746.213) (-743.457) (-745.427) * (-743.873) (-746.153) (-757.985) [-737.936] -- 0:00:53
      19000 -- (-748.358) (-743.098) [-746.819] (-742.849) * [-739.566] (-742.805) (-754.759) (-736.930) -- 0:00:51
      19500 -- (-747.194) (-758.987) [-745.170] (-746.638) * (-737.769) [-743.325] (-747.988) (-735.961) -- 0:00:50
      20000 -- (-756.523) (-754.205) [-746.010] (-754.019) * [-737.891] (-752.388) (-743.698) (-737.676) -- 0:00:49

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-765.395) (-752.521) [-746.995] (-745.438) * (-737.451) (-750.943) [-745.049] (-739.177) -- 0:00:47
      21000 -- [-737.600] (-750.160) (-759.504) (-749.371) * (-737.437) (-748.613) (-748.897) [-738.936] -- 0:00:46
      21500 -- [-737.668] (-752.231) (-752.442) (-749.109) * (-738.391) [-754.284] (-747.729) (-738.412) -- 0:00:45
      22000 -- (-738.356) (-744.828) [-739.811] (-753.687) * (-739.376) (-756.755) (-751.332) [-736.390] -- 0:00:44
      22500 -- (-736.870) (-748.308) (-741.419) [-749.004] * (-743.130) (-748.633) [-747.297] (-741.233) -- 0:00:43
      23000 -- [-736.430] (-741.290) (-737.625) (-753.418) * (-740.537) (-749.946) (-749.078) [-743.713] -- 0:00:42
      23500 -- [-738.517] (-745.205) (-738.067) (-748.182) * (-738.543) (-753.871) (-751.584) [-737.844] -- 0:00:41
      24000 -- (-739.401) (-751.076) (-736.830) [-746.067] * (-737.451) (-748.745) (-742.550) [-737.825] -- 0:00:40
      24500 -- (-737.519) (-739.989) [-740.152] (-742.092) * (-738.242) (-744.478) (-743.438) [-737.992] -- 0:00:39
      25000 -- [-737.694] (-742.498) (-740.748) (-757.087) * (-738.356) (-744.424) [-744.692] (-741.685) -- 0:00:39

      Average standard deviation of split frequencies: 0.056983

      25500 -- (-735.748) (-746.138) [-741.129] (-747.403) * [-736.860] (-748.952) (-746.917) (-737.185) -- 0:00:38
      26000 -- (-736.704) (-749.209) [-737.687] (-742.295) * [-735.850] (-754.097) (-743.025) (-738.263) -- 0:00:37
      26500 -- (-736.735) (-756.933) (-737.766) [-746.061] * [-737.883] (-745.465) (-750.891) (-736.459) -- 0:00:36
      27000 -- [-736.119] (-747.482) (-746.135) (-752.711) * (-737.550) (-741.089) (-741.924) [-738.992] -- 0:00:36
      27500 -- (-737.204) (-753.112) (-747.785) [-740.851] * (-736.407) (-753.071) [-748.231] (-737.707) -- 0:00:35
      28000 -- (-739.200) (-747.348) (-741.300) [-746.412] * [-736.625] (-749.759) (-745.001) (-737.366) -- 0:00:34
      28500 -- (-738.488) [-750.035] (-736.660) (-750.848) * (-737.349) (-746.430) (-751.014) [-738.424] -- 0:00:34
      29000 -- (-740.718) (-749.078) (-739.327) [-757.932] * [-740.513] (-762.709) (-750.275) (-736.710) -- 0:00:33
      29500 -- (-737.683) (-753.570) (-736.333) [-745.822] * (-743.463) (-745.256) (-749.560) [-741.218] -- 0:00:32
      30000 -- (-741.058) (-753.472) (-737.959) [-741.540] * (-739.804) (-756.481) (-754.290) [-737.668] -- 0:00:32

      Average standard deviation of split frequencies: 0.047653

      30500 -- (-738.262) (-748.346) (-737.941) [-753.706] * (-737.532) (-747.867) [-742.820] (-737.533) -- 0:01:03
      31000 -- [-739.580] (-745.990) (-739.683) (-745.458) * (-737.805) (-751.807) (-749.570) [-735.766] -- 0:01:02
      31500 -- (-736.247) (-749.617) (-737.414) [-742.654] * (-737.593) (-743.327) [-741.443] (-737.676) -- 0:01:01
      32000 -- (-737.177) (-749.457) (-740.288) [-744.399] * [-737.785] (-749.803) (-747.144) (-740.868) -- 0:01:00
      32500 -- (-736.555) [-751.744] (-740.298) (-744.817) * [-735.771] (-746.320) (-745.619) (-740.271) -- 0:00:59
      33000 -- (-736.870) [-747.656] (-738.699) (-750.293) * (-737.411) (-742.452) [-742.794] (-744.043) -- 0:00:58
      33500 -- (-739.018) [-748.316] (-739.183) (-751.508) * [-742.125] (-740.663) (-750.058) (-742.823) -- 0:00:57
      34000 -- (-740.288) (-747.914) (-736.858) [-743.620] * (-736.348) (-751.566) (-753.055) [-739.285] -- 0:00:56
      34500 -- (-738.446) [-747.928] (-737.641) (-743.855) * (-740.670) (-744.205) [-753.507] (-740.613) -- 0:00:55
      35000 -- (-738.867) (-754.788) (-738.428) [-748.655] * [-737.234] (-749.366) (-746.661) (-738.374) -- 0:00:55

      Average standard deviation of split frequencies: 0.038595

      35500 -- (-737.837) (-742.023) (-739.928) [-754.252] * [-738.344] (-749.788) (-762.527) (-738.245) -- 0:00:54
      36000 -- [-739.692] (-746.042) (-738.008) (-748.425) * (-739.069) (-754.724) (-745.706) [-736.376] -- 0:00:53
      36500 -- (-740.190) (-747.684) [-736.968] (-744.622) * [-738.168] (-742.610) (-754.168) (-735.678) -- 0:00:52
      37000 -- (-737.914) (-747.257) [-738.892] (-749.743) * (-736.885) [-738.805] (-746.831) (-735.956) -- 0:00:52
      37500 -- [-737.749] (-744.756) (-740.958) (-746.258) * [-738.397] (-736.745) (-748.941) (-736.173) -- 0:00:51
      38000 -- (-737.732) (-748.970) (-741.302) [-742.120] * (-742.812) (-736.677) (-743.734) [-737.430] -- 0:00:50
      38500 -- (-736.202) [-747.917] (-738.825) (-757.656) * (-742.467) (-738.954) [-745.345] (-738.572) -- 0:00:49
      39000 -- (-736.080) (-742.288) [-736.550] (-756.682) * (-740.653) (-739.826) (-750.489) [-735.868] -- 0:00:49
      39500 -- (-738.670) (-750.730) (-740.065) [-746.074] * (-739.899) [-739.074] (-746.231) (-736.752) -- 0:00:48
      40000 -- [-737.612] (-749.477) (-737.308) (-744.544) * (-736.744) (-737.525) [-747.049] (-741.685) -- 0:00:48

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-739.798) (-747.820) [-737.777] (-751.225) * [-735.740] (-742.522) (-745.760) (-739.093) -- 0:00:47
      41000 -- (-739.359) [-740.340] (-738.621) (-747.038) * (-737.220) (-737.315) [-751.741] (-737.312) -- 0:00:46
      41500 -- (-741.150) (-742.320) (-737.997) [-745.308] * [-736.421] (-738.565) (-751.550) (-736.847) -- 0:00:46
      42000 -- (-738.310) [-739.893] (-737.835) (-749.840) * (-736.114) [-737.827] (-748.501) (-738.422) -- 0:00:45
      42500 -- (-736.871) [-737.721] (-736.328) (-746.951) * (-740.171) (-736.410) [-748.288] (-739.808) -- 0:00:45
      43000 -- [-736.867] (-738.327) (-737.684) (-756.921) * [-736.962] (-738.617) (-747.327) (-737.198) -- 0:00:44
      43500 -- (-738.165) (-742.247) (-740.782) [-746.693] * (-738.998) [-737.935] (-756.140) (-737.356) -- 0:00:43
      44000 -- (-736.931) (-737.691) (-739.750) [-744.546] * (-740.498) (-737.132) [-742.920] (-736.123) -- 0:00:43
      44500 -- (-738.984) (-737.621) (-736.670) [-743.524] * (-738.248) (-736.280) [-745.344] (-736.861) -- 0:00:42
      45000 -- (-738.431) (-737.353) [-737.513] (-754.304) * [-742.728] (-736.744) (-747.642) (-738.300) -- 0:00:42

      Average standard deviation of split frequencies: 0.026840

      45500 -- (-740.153) (-736.601) (-740.638) [-746.850] * (-738.266) (-736.342) (-745.862) [-735.866] -- 0:00:41
      46000 -- (-739.956) (-735.936) (-737.254) [-745.572] * [-740.532] (-737.537) (-751.491) (-736.559) -- 0:00:41
      46500 -- [-739.971] (-737.101) (-736.833) (-753.202) * (-743.239) (-736.910) (-758.118) [-737.248] -- 0:00:41
      47000 -- (-740.916) [-738.389] (-737.737) (-751.042) * (-735.829) (-736.256) (-742.602) [-737.837] -- 0:01:00
      47500 -- (-736.990) [-737.414] (-736.642) (-743.403) * (-740.448) (-736.871) (-750.606) [-739.760] -- 0:01:00
      48000 -- (-736.566) (-736.132) (-738.076) [-747.706] * (-740.316) [-737.083] (-745.527) (-738.119) -- 0:00:59
      48500 -- (-737.060) (-738.271) [-736.881] (-743.955) * [-737.263] (-737.800) (-756.255) (-736.218) -- 0:00:58
      49000 -- (-736.670) [-736.286] (-739.604) (-746.465) * (-738.914) (-738.308) (-745.025) [-737.078] -- 0:00:58
      49500 -- (-736.262) (-745.826) [-737.335] (-753.655) * (-740.358) (-737.675) (-745.834) [-736.249] -- 0:00:57
      50000 -- (-740.080) (-740.457) [-736.791] (-750.744) * (-738.202) (-736.743) (-751.482) [-735.764] -- 0:00:57

      Average standard deviation of split frequencies: 0.030872

      50500 -- (-738.301) (-736.820) [-737.728] (-747.593) * (-737.332) (-737.220) [-745.261] (-738.959) -- 0:00:56
      51000 -- (-742.034) (-740.601) (-740.329) [-744.182] * (-740.766) [-738.802] (-751.601) (-739.579) -- 0:00:55
      51500 -- (-737.540) [-739.792] (-737.989) (-745.593) * (-736.656) (-739.962) (-753.229) [-737.572] -- 0:00:55
      52000 -- (-742.633) [-741.389] (-736.333) (-745.029) * [-736.491] (-746.077) (-752.402) (-737.639) -- 0:00:54
      52500 -- (-740.309) (-739.157) (-735.769) [-743.692] * (-740.527) (-744.430) (-747.006) [-736.657] -- 0:00:54
      53000 -- [-740.023] (-737.729) (-743.521) (-744.995) * [-737.737] (-737.736) (-752.246) (-737.583) -- 0:00:53
      53500 -- (-740.925) [-737.712] (-741.061) (-747.263) * (-736.401) (-738.097) (-740.194) [-737.204] -- 0:00:53
      54000 -- (-737.290) [-737.067] (-744.339) (-744.293) * (-736.827) [-736.386] (-735.505) (-737.536) -- 0:00:52
      54500 -- [-739.593] (-739.642) (-740.018) (-751.399) * (-739.595) (-737.399) [-740.892] (-737.330) -- 0:00:52
      55000 -- (-737.113) [-736.183] (-737.698) (-752.804) * (-738.435) [-737.587] (-740.186) (-737.293) -- 0:00:51

      Average standard deviation of split frequencies: 0.033672

      55500 -- (-735.906) [-736.937] (-738.009) (-746.521) * (-743.363) (-739.086) [-738.159] (-736.484) -- 0:00:51
      56000 -- (-739.359) [-737.644] (-736.966) (-747.847) * (-743.762) [-737.822] (-738.022) (-737.479) -- 0:00:50
      56500 -- (-738.530) [-738.950] (-736.817) (-746.435) * (-739.822) (-739.162) (-739.344) [-738.074] -- 0:00:50
      57000 -- (-737.857) (-740.755) [-736.613] (-754.853) * [-736.401] (-736.752) (-737.101) (-738.860) -- 0:00:49
      57500 -- [-737.449] (-736.638) (-736.865) (-753.107) * (-737.539) (-738.107) [-735.960] (-738.732) -- 0:00:49
      58000 -- [-737.592] (-738.606) (-736.580) (-745.066) * [-737.355] (-738.016) (-735.657) (-738.082) -- 0:00:48
      58500 -- [-738.064] (-737.704) (-736.542) (-748.624) * (-735.772) [-739.090] (-738.279) (-738.712) -- 0:00:48
      59000 -- (-737.542) (-736.577) (-742.902) [-750.284] * (-736.834) (-737.333) (-739.568) [-739.189] -- 0:00:47
      59500 -- (-741.593) (-737.400) [-742.522] (-760.268) * (-739.694) [-737.539] (-737.456) (-738.177) -- 0:00:47
      60000 -- (-739.182) [-740.960] (-738.254) (-749.590) * (-738.338) (-739.996) (-737.207) [-736.534] -- 0:00:47

      Average standard deviation of split frequencies: 0.036909

      60500 -- (-736.261) (-740.817) (-736.917) [-744.928] * (-737.672) (-743.951) (-736.944) [-737.007] -- 0:00:46
      61000 -- (-736.229) (-737.777) (-736.802) [-742.772] * (-739.156) (-745.862) [-736.996] (-741.443) -- 0:00:46
      61500 -- [-736.073] (-739.096) (-737.792) (-748.953) * (-739.734) (-740.003) [-737.025] (-738.172) -- 0:00:45
      62000 -- (-738.093) (-739.445) [-740.085] (-744.829) * (-738.750) (-738.814) [-736.746] (-740.120) -- 0:00:45
      62500 -- [-735.937] (-739.771) (-737.482) (-751.617) * (-739.704) (-739.315) [-740.213] (-736.834) -- 0:00:45
      63000 -- (-737.687) (-739.075) [-739.484] (-748.809) * (-741.924) [-739.371] (-741.379) (-738.732) -- 0:00:44
      63500 -- (-739.497) (-738.460) [-740.545] (-750.903) * (-738.579) [-736.985] (-742.805) (-737.944) -- 0:00:58
      64000 -- [-739.340] (-737.774) (-738.810) (-750.010) * (-738.351) [-739.353] (-744.357) (-738.350) -- 0:00:58
      64500 -- (-739.905) (-736.884) (-736.949) [-744.197] * (-738.140) (-738.560) (-737.699) [-736.227] -- 0:00:58
      65000 -- (-736.536) (-739.092) (-739.342) [-752.257] * [-739.718] (-739.693) (-737.237) (-737.555) -- 0:00:57

      Average standard deviation of split frequencies: 0.036784

      65500 -- (-738.785) (-738.183) (-738.578) [-751.561] * (-738.042) (-738.478) [-739.294] (-737.858) -- 0:00:57
      66000 -- (-740.294) (-738.036) (-739.419) [-744.657] * (-737.799) (-736.662) (-738.222) [-738.274] -- 0:00:56
      66500 -- (-736.282) (-739.209) [-738.020] (-749.730) * (-736.938) [-736.464] (-739.789) (-738.348) -- 0:00:56
      67000 -- (-737.704) [-737.611] (-735.937) (-749.345) * [-736.776] (-735.893) (-738.974) (-736.498) -- 0:00:55
      67500 -- (-738.873) (-737.075) (-739.544) [-754.007] * (-736.141) (-736.269) (-738.971) [-736.260] -- 0:00:55
      68000 -- (-737.253) (-739.521) [-736.479] (-750.481) * (-740.305) [-740.256] (-739.572) (-740.760) -- 0:00:54
      68500 -- [-736.938] (-739.776) (-738.530) (-745.589) * (-737.081) [-738.727] (-736.188) (-738.715) -- 0:00:54
      69000 -- (-736.493) [-738.320] (-740.068) (-737.542) * [-736.973] (-736.772) (-738.538) (-742.549) -- 0:00:53
      69500 -- [-737.265] (-737.442) (-737.161) (-737.330) * [-738.579] (-736.579) (-737.470) (-736.966) -- 0:00:53
      70000 -- [-735.950] (-737.900) (-739.960) (-737.182) * (-740.789) (-740.546) [-736.833] (-739.063) -- 0:00:53

      Average standard deviation of split frequencies: 0.036213

      70500 -- (-743.744) [-737.854] (-739.071) (-738.017) * [-738.340] (-739.766) (-737.576) (-738.679) -- 0:00:52
      71000 -- (-740.545) [-738.439] (-738.512) (-736.070) * (-741.003) (-740.280) (-741.923) [-739.786] -- 0:00:52
      71500 -- (-738.172) (-738.842) [-742.243] (-736.797) * [-737.933] (-744.404) (-739.616) (-741.126) -- 0:00:51
      72000 -- [-738.739] (-738.053) (-741.114) (-740.563) * [-738.394] (-739.260) (-744.618) (-742.574) -- 0:00:51
      72500 -- (-736.537) (-739.237) [-737.719] (-741.087) * [-738.993] (-738.344) (-737.937) (-741.564) -- 0:00:51
      73000 -- (-737.088) [-735.879] (-739.798) (-738.439) * (-737.752) (-738.348) [-738.897] (-739.260) -- 0:00:50
      73500 -- [-736.862] (-738.685) (-736.900) (-739.389) * (-737.517) (-738.679) (-738.396) [-736.403] -- 0:00:50
      74000 -- (-738.426) (-737.279) (-737.717) [-738.166] * (-737.283) (-736.312) (-736.973) [-737.987] -- 0:00:50
      74500 -- (-737.032) (-736.305) (-738.000) [-737.198] * [-739.457] (-736.824) (-737.429) (-737.175) -- 0:00:49
      75000 -- (-736.940) (-737.258) (-737.733) [-737.044] * (-739.405) [-738.134] (-739.906) (-739.906) -- 0:00:49

      Average standard deviation of split frequencies: 0.032646

      75500 -- (-739.032) (-737.395) (-739.422) [-736.202] * (-737.365) (-736.374) (-736.891) [-740.348] -- 0:00:48
      76000 -- [-738.725] (-739.804) (-738.645) (-737.985) * (-735.840) (-737.820) (-738.866) [-738.505] -- 0:00:48
      76500 -- (-738.893) (-736.747) [-740.440] (-737.039) * [-736.030] (-738.169) (-736.445) (-738.149) -- 0:00:48
      77000 -- (-736.666) [-736.788] (-737.927) (-736.934) * (-736.003) [-739.992] (-738.669) (-737.263) -- 0:00:47
      77500 -- (-736.015) (-739.317) (-740.404) [-737.649] * (-737.260) [-737.378] (-738.160) (-738.666) -- 0:00:47
      78000 -- [-736.690] (-738.292) (-739.862) (-736.533) * (-736.699) (-737.364) [-737.129] (-744.978) -- 0:00:47
      78500 -- [-736.650] (-739.258) (-737.080) (-735.945) * (-740.766) (-739.258) (-737.808) [-738.501] -- 0:00:46
      79000 -- (-737.168) [-738.059] (-737.234) (-738.402) * [-737.896] (-740.432) (-737.493) (-739.714) -- 0:00:46
      79500 -- (-738.437) (-737.644) [-738.053] (-738.554) * [-737.325] (-740.701) (-740.251) (-737.575) -- 0:00:46
      80000 -- (-738.013) [-744.618] (-739.835) (-738.779) * (-738.005) [-739.467] (-740.244) (-743.087) -- 0:00:46

      Average standard deviation of split frequencies: 0.032295

      80500 -- [-737.170] (-736.767) (-738.503) (-738.113) * (-738.365) (-740.080) (-739.409) [-736.641] -- 0:00:57
      81000 -- (-739.322) (-737.011) (-739.401) [-738.657] * (-736.670) (-739.824) [-739.383] (-742.386) -- 0:00:56
      81500 -- (-738.556) (-738.769) [-739.474] (-737.336) * (-742.875) [-738.221] (-741.631) (-739.489) -- 0:00:56
      82000 -- (-740.206) (-737.947) [-740.775] (-739.574) * (-740.119) (-738.684) (-740.810) [-739.216] -- 0:00:55
      82500 -- (-738.719) (-739.227) [-737.498] (-736.680) * (-735.776) (-738.105) (-738.683) [-736.180] -- 0:00:55
      83000 -- (-736.932) (-737.278) (-737.739) [-737.903] * (-735.891) [-736.469] (-738.258) (-735.982) -- 0:00:55
      83500 -- (-736.736) (-745.660) (-740.922) [-736.331] * (-736.611) [-738.185] (-738.625) (-736.196) -- 0:00:54
      84000 -- (-737.110) [-737.442] (-736.287) (-736.297) * [-736.042] (-739.373) (-740.452) (-738.408) -- 0:00:54
      84500 -- (-736.123) (-736.314) [-739.708] (-736.149) * [-736.337] (-739.733) (-739.133) (-737.540) -- 0:00:54
      85000 -- (-735.833) (-739.478) (-736.239) [-737.430] * [-735.817] (-737.559) (-736.878) (-738.145) -- 0:00:53

      Average standard deviation of split frequencies: 0.024941

      85500 -- (-737.643) (-737.253) [-737.303] (-739.691) * (-735.849) (-738.138) (-735.921) [-737.294] -- 0:00:53
      86000 -- [-741.996] (-739.382) (-740.004) (-737.787) * [-737.048] (-741.101) (-737.806) (-737.634) -- 0:00:53
      86500 -- (-738.440) (-741.707) [-736.625] (-737.075) * [-737.903] (-737.735) (-739.485) (-737.394) -- 0:00:52
      87000 -- (-738.170) [-736.966] (-736.634) (-737.062) * [-738.397] (-738.292) (-737.202) (-736.632) -- 0:00:52
      87500 -- (-735.976) [-736.151] (-738.262) (-738.048) * (-740.288) [-738.939] (-739.358) (-736.828) -- 0:00:52
      88000 -- (-737.606) (-739.096) [-739.688] (-737.006) * (-738.855) (-737.822) [-738.342] (-736.428) -- 0:00:51
      88500 -- (-736.857) (-738.578) (-736.582) [-737.669] * (-743.156) [-736.161] (-737.642) (-736.209) -- 0:00:51
      89000 -- (-736.513) (-737.372) (-735.689) [-736.551] * (-738.235) (-738.240) [-736.525] (-737.680) -- 0:00:51
      89500 -- [-737.726] (-736.604) (-737.282) (-736.103) * (-737.418) (-736.774) (-738.859) [-736.711] -- 0:00:50
      90000 -- (-737.894) (-735.930) (-737.725) [-736.751] * (-736.912) (-738.610) [-737.429] (-744.339) -- 0:00:50

      Average standard deviation of split frequencies: 0.021071

      90500 -- [-739.395] (-737.339) (-739.807) (-738.221) * [-737.423] (-737.577) (-736.992) (-739.824) -- 0:00:50
      91000 -- (-737.733) (-737.419) (-736.109) [-737.549] * (-736.269) (-736.780) (-737.065) [-739.976] -- 0:00:49
      91500 -- (-737.620) [-737.045] (-738.118) (-742.587) * [-736.692] (-738.215) (-741.350) (-740.476) -- 0:00:49
      92000 -- (-738.068) (-737.683) [-736.158] (-736.742) * (-742.764) (-739.190) (-736.437) [-738.158] -- 0:00:49
      92500 -- [-738.384] (-739.358) (-738.699) (-736.993) * (-741.724) (-743.293) (-738.519) [-736.958] -- 0:00:49
      93000 -- (-737.792) [-736.612] (-737.732) (-738.632) * (-737.049) [-737.078] (-735.916) (-737.358) -- 0:00:48
      93500 -- [-738.978] (-736.964) (-736.783) (-736.185) * (-739.108) (-738.689) [-737.676] (-736.525) -- 0:00:48
      94000 -- (-737.919) (-740.636) [-737.165] (-736.303) * (-738.969) (-739.289) (-735.789) [-739.545] -- 0:00:48
      94500 -- [-736.595] (-742.362) (-736.950) (-737.434) * (-736.574) (-740.268) [-737.664] (-741.985) -- 0:00:47
      95000 -- [-736.827] (-739.951) (-736.531) (-735.958) * (-736.846) (-738.982) [-738.505] (-740.570) -- 0:00:47

      Average standard deviation of split frequencies: 0.023325

      95500 -- (-736.916) (-739.822) (-736.718) [-736.050] * (-737.780) [-737.790] (-736.624) (-735.808) -- 0:00:47
      96000 -- [-736.074] (-737.304) (-738.210) (-741.598) * (-741.465) (-738.333) (-739.184) [-736.179] -- 0:00:47
      96500 -- [-738.500] (-737.848) (-739.485) (-743.018) * (-738.050) [-740.198] (-739.563) (-735.873) -- 0:00:46
      97000 -- (-741.315) [-736.924] (-742.643) (-741.464) * (-741.672) [-740.413] (-736.699) (-735.742) -- 0:00:55
      97500 -- (-743.218) (-737.182) (-737.898) [-737.548] * [-739.255] (-747.863) (-738.510) (-737.272) -- 0:00:55
      98000 -- (-742.856) (-737.483) (-737.169) [-741.108] * (-737.653) (-739.302) [-738.242] (-741.642) -- 0:00:55
      98500 -- (-741.343) (-736.048) (-736.544) [-742.735] * (-739.174) [-742.064] (-738.940) (-736.208) -- 0:00:54
      99000 -- (-737.099) (-741.170) (-736.803) [-741.748] * (-738.618) (-736.299) [-736.276] (-736.764) -- 0:00:54
      99500 -- (-738.833) (-739.005) [-738.656] (-739.340) * (-737.396) (-736.127) [-738.653] (-735.946) -- 0:00:54
      100000 -- (-740.936) (-740.696) [-737.735] (-737.686) * (-741.925) (-736.279) [-738.169] (-736.231) -- 0:00:54

      Average standard deviation of split frequencies: 0.023168

      100500 -- [-738.855] (-739.421) (-741.272) (-738.429) * (-736.985) (-736.591) [-737.641] (-739.874) -- 0:00:53
      101000 -- (-737.905) [-739.861] (-740.082) (-737.491) * (-737.776) (-737.670) (-738.200) [-738.551] -- 0:00:53
      101500 -- (-742.160) (-736.310) [-738.241] (-736.655) * (-737.930) [-737.240] (-741.533) (-739.422) -- 0:00:53
      102000 -- (-737.336) (-736.047) [-736.172] (-737.206) * (-737.511) [-736.845] (-737.419) (-737.813) -- 0:00:52
      102500 -- [-740.376] (-736.555) (-737.626) (-736.203) * (-737.381) (-736.095) (-737.857) [-738.550] -- 0:00:52
      103000 -- [-738.860] (-737.178) (-735.671) (-736.080) * (-738.033) (-735.838) (-737.810) [-737.426] -- 0:00:52
      103500 -- (-738.846) (-741.099) (-738.856) [-740.595] * (-735.983) [-737.283] (-736.360) (-736.568) -- 0:00:51
      104000 -- (-738.783) (-737.956) [-739.556] (-737.565) * (-739.386) (-738.479) [-739.386] (-736.101) -- 0:00:51
      104500 -- (-737.453) (-738.095) (-741.148) [-737.435] * (-736.577) (-744.063) [-737.662] (-737.558) -- 0:00:51
      105000 -- (-737.524) [-736.334] (-737.208) (-735.678) * [-736.733] (-738.758) (-740.495) (-741.346) -- 0:00:51

      Average standard deviation of split frequencies: 0.023126

      105500 -- (-738.742) [-738.457] (-736.043) (-738.212) * (-736.298) (-736.406) (-738.890) [-736.164] -- 0:00:50
      106000 -- (-740.836) (-735.718) [-741.749] (-737.748) * (-736.760) [-738.144] (-738.715) (-737.985) -- 0:00:50
      106500 -- [-736.563] (-735.872) (-737.062) (-737.833) * (-736.027) (-736.749) [-739.082] (-738.149) -- 0:00:50
      107000 -- (-737.000) [-738.852] (-745.324) (-738.410) * [-735.834] (-740.476) (-740.227) (-738.815) -- 0:00:50
      107500 -- (-736.582) (-740.240) (-739.507) [-736.370] * (-739.260) [-740.166] (-738.544) (-737.219) -- 0:00:49
      108000 -- (-737.163) (-741.361) [-737.115] (-737.560) * (-739.920) [-740.602] (-738.252) (-738.237) -- 0:00:49
      108500 -- (-737.097) (-739.536) (-736.284) [-739.534] * (-737.269) (-741.485) [-738.522] (-740.862) -- 0:00:49
      109000 -- (-736.681) (-738.131) (-737.909) [-735.887] * (-738.189) (-739.046) [-738.485] (-740.115) -- 0:00:49
      109500 -- (-741.678) (-742.335) [-736.234] (-736.274) * (-736.083) (-737.309) (-738.428) [-738.259] -- 0:00:48
      110000 -- (-737.150) [-737.198] (-738.726) (-738.388) * [-738.698] (-736.837) (-737.050) (-740.585) -- 0:00:48

      Average standard deviation of split frequencies: 0.022644

      110500 -- (-736.515) [-735.867] (-739.868) (-738.423) * (-737.101) [-737.538] (-744.223) (-736.542) -- 0:00:48
      111000 -- (-737.370) (-737.875) [-736.996] (-737.963) * (-737.581) [-738.774] (-736.863) (-737.132) -- 0:00:48
      111500 -- (-741.501) (-735.857) (-735.746) [-737.432] * [-737.623] (-742.240) (-736.617) (-736.831) -- 0:00:47
      112000 -- (-738.856) [-736.003] (-736.010) (-737.409) * (-738.251) (-737.792) (-738.212) [-735.791] -- 0:00:47
      112500 -- [-738.661] (-738.695) (-737.301) (-738.681) * (-738.204) (-738.938) (-740.568) [-739.242] -- 0:00:47
      113000 -- [-736.115] (-739.012) (-737.445) (-740.160) * (-736.740) [-736.617] (-740.799) (-736.853) -- 0:00:47
      113500 -- (-736.718) (-741.384) (-737.984) [-739.556] * (-739.579) (-736.603) [-738.918] (-738.457) -- 0:00:46
      114000 -- (-735.905) (-739.129) [-736.680] (-738.946) * [-737.434] (-737.102) (-738.645) (-738.113) -- 0:00:54
      114500 -- (-740.377) (-737.038) [-736.605] (-737.705) * (-739.558) (-737.217) [-736.865] (-739.113) -- 0:00:54
      115000 -- [-739.419] (-738.772) (-737.477) (-738.266) * (-738.773) (-739.418) [-739.124] (-740.367) -- 0:00:53

      Average standard deviation of split frequencies: 0.019891

      115500 -- (-737.261) (-738.938) (-737.015) [-741.811] * (-737.349) (-740.078) (-737.013) [-737.221] -- 0:00:53
      116000 -- [-741.059] (-738.443) (-737.958) (-737.968) * (-739.550) [-738.386] (-738.996) (-739.242) -- 0:00:53
      116500 -- [-738.972] (-736.694) (-741.127) (-738.014) * (-736.352) (-739.048) [-735.818] (-738.728) -- 0:00:53
      117000 -- (-741.271) (-739.288) [-736.817] (-737.034) * [-738.476] (-738.762) (-736.096) (-737.431) -- 0:00:52
      117500 -- (-740.407) (-743.315) (-740.080) [-740.090] * (-741.314) (-744.166) (-738.564) [-738.983] -- 0:00:52
      118000 -- (-738.894) (-741.482) [-739.296] (-738.922) * [-741.080] (-742.167) (-736.406) (-737.762) -- 0:00:52
      118500 -- (-738.682) (-738.050) (-736.661) [-739.260] * (-738.250) (-738.598) (-738.459) [-739.530] -- 0:00:52
      119000 -- (-738.547) (-739.887) (-737.166) [-738.929] * [-739.924] (-737.491) (-738.775) (-736.935) -- 0:00:51
      119500 -- (-739.319) (-738.487) (-739.014) [-735.621] * (-739.726) (-737.045) (-738.116) [-738.422] -- 0:00:51
      120000 -- [-736.520] (-736.492) (-739.300) (-736.502) * (-737.469) [-736.437] (-737.739) (-741.038) -- 0:00:51

      Average standard deviation of split frequencies: 0.016061

      120500 -- (-741.310) (-736.803) (-743.304) [-736.893] * (-736.888) (-736.979) [-738.463] (-736.623) -- 0:00:51
      121000 -- [-735.630] (-737.625) (-738.561) (-739.025) * (-737.795) (-736.660) (-735.801) [-737.744] -- 0:00:50
      121500 -- (-737.171) (-739.775) (-738.898) [-736.228] * (-737.588) (-736.801) (-736.519) [-737.911] -- 0:00:50
      122000 -- (-741.380) (-738.029) (-737.709) [-735.694] * (-736.315) (-736.163) [-736.394] (-738.258) -- 0:00:50
      122500 -- (-743.456) (-738.072) (-738.214) [-736.457] * (-736.446) [-736.605] (-740.058) (-739.407) -- 0:00:50
      123000 -- [-741.290] (-739.419) (-737.774) (-737.779) * (-735.870) (-744.369) (-741.110) [-739.051] -- 0:00:49
      123500 -- (-738.726) (-737.551) (-737.717) [-741.456] * (-738.633) (-740.866) (-740.852) [-738.778] -- 0:00:49
      124000 -- (-736.998) (-737.873) (-742.052) [-738.617] * [-736.074] (-737.530) (-738.945) (-736.369) -- 0:00:49
      124500 -- (-736.770) (-739.257) (-740.997) [-737.393] * [-736.050] (-743.167) (-739.368) (-737.329) -- 0:00:49
      125000 -- (-737.292) [-737.993] (-740.295) (-737.056) * (-738.992) [-738.668] (-739.878) (-738.194) -- 0:00:49

      Average standard deviation of split frequencies: 0.015526

      125500 -- (-736.385) [-738.858] (-737.631) (-738.576) * [-741.020] (-736.220) (-740.184) (-738.273) -- 0:00:48
      126000 -- (-736.940) (-737.245) [-737.705] (-741.815) * (-740.915) (-736.180) [-739.715] (-745.346) -- 0:00:48
      126500 -- [-738.199] (-736.615) (-737.277) (-737.677) * (-740.844) (-738.667) [-740.617] (-738.199) -- 0:00:48
      127000 -- (-738.429) [-736.506] (-737.618) (-739.227) * (-738.128) (-739.287) (-737.416) [-737.485] -- 0:00:48
      127500 -- (-736.212) (-737.143) [-736.812] (-738.167) * [-743.664] (-739.811) (-737.179) (-739.923) -- 0:00:47
      128000 -- (-737.452) [-737.378] (-737.050) (-737.712) * (-736.933) (-737.249) (-736.809) [-736.622] -- 0:00:47
      128500 -- (-736.738) (-737.151) [-737.817] (-743.085) * (-738.101) [-737.321] (-737.475) (-739.081) -- 0:00:47
      129000 -- (-739.161) (-736.976) [-741.307] (-738.736) * (-737.100) (-737.673) (-739.042) [-739.996] -- 0:00:47
      129500 -- (-739.422) [-737.496] (-737.475) (-738.069) * (-736.115) (-737.548) (-743.521) [-739.544] -- 0:00:47
      130000 -- [-737.008] (-740.864) (-737.867) (-740.050) * (-739.606) (-737.035) [-741.659] (-741.371) -- 0:00:46

      Average standard deviation of split frequencies: 0.015380

      130500 -- (-736.992) (-739.509) (-737.154) [-738.195] * (-740.862) (-737.801) (-743.961) [-737.863] -- 0:00:46
      131000 -- (-736.293) (-738.324) [-737.896] (-739.234) * (-737.077) (-738.359) (-742.333) [-737.524] -- 0:00:53
      131500 -- (-736.830) (-739.797) (-741.303) [-739.659] * (-738.173) [-737.413] (-736.626) (-737.030) -- 0:00:52
      132000 -- [-740.018] (-738.907) (-738.006) (-738.054) * [-738.233] (-736.685) (-738.006) (-737.571) -- 0:00:52
      132500 -- (-738.713) [-738.477] (-738.264) (-737.607) * [-738.415] (-737.291) (-736.795) (-739.352) -- 0:00:52
      133000 -- [-738.586] (-741.451) (-737.529) (-737.150) * (-737.622) [-735.924] (-738.599) (-736.084) -- 0:00:52
      133500 -- (-739.856) (-739.911) [-741.330] (-738.226) * (-737.028) (-737.520) (-742.487) [-736.383] -- 0:00:51
      134000 -- (-738.192) (-740.750) (-737.481) [-741.600] * (-738.957) (-741.614) (-741.475) [-737.929] -- 0:00:51
      134500 -- (-740.463) (-738.168) (-737.962) [-736.903] * (-738.678) (-737.992) (-736.249) [-736.982] -- 0:00:51
      135000 -- (-741.070) (-738.823) (-739.549) [-737.003] * (-739.576) (-738.743) [-740.115] (-739.270) -- 0:00:51

      Average standard deviation of split frequencies: 0.014412

      135500 -- (-737.272) (-738.533) [-736.574] (-737.269) * [-740.176] (-735.609) (-738.393) (-740.278) -- 0:00:51
      136000 -- (-737.204) (-737.341) [-736.116] (-738.926) * (-737.687) [-736.703] (-736.971) (-739.990) -- 0:00:50
      136500 -- (-736.629) (-739.570) (-737.110) [-737.464] * (-736.760) (-738.503) [-737.186] (-738.276) -- 0:00:50
      137000 -- [-735.850] (-738.529) (-738.374) (-737.853) * (-738.213) (-738.673) (-738.544) [-736.479] -- 0:00:50
      137500 -- (-736.444) [-736.715] (-740.179) (-739.910) * (-738.344) (-737.015) [-741.935] (-736.544) -- 0:00:50
      138000 -- (-739.555) (-738.097) (-738.314) [-738.211] * (-739.431) (-736.494) (-741.504) [-736.580] -- 0:00:49
      138500 -- (-739.235) (-738.219) (-740.931) [-738.332] * (-737.762) (-739.017) [-741.531] (-737.599) -- 0:00:49
      139000 -- [-739.549] (-737.317) (-736.911) (-736.618) * (-736.653) [-737.212] (-737.377) (-737.193) -- 0:00:49
      139500 -- [-737.188] (-738.290) (-737.292) (-736.535) * (-736.629) (-740.547) (-736.695) [-736.588] -- 0:00:49
      140000 -- [-736.458] (-737.447) (-741.310) (-736.819) * (-737.689) (-736.920) (-737.319) [-737.943] -- 0:00:49

      Average standard deviation of split frequencies: 0.013237

      140500 -- (-737.068) [-739.019] (-736.414) (-736.748) * [-739.325] (-736.028) (-738.086) (-737.451) -- 0:00:48
      141000 -- (-739.453) [-737.475] (-735.628) (-736.024) * (-738.276) (-738.563) [-736.685] (-737.165) -- 0:00:48
      141500 -- (-737.396) [-737.858] (-740.298) (-736.770) * [-736.772] (-736.193) (-736.684) (-738.665) -- 0:00:48
      142000 -- (-736.752) [-738.242] (-741.094) (-736.802) * (-738.578) [-736.876] (-737.557) (-736.229) -- 0:00:48
      142500 -- (-736.417) (-737.963) [-736.011] (-737.730) * [-739.126] (-738.088) (-737.302) (-736.090) -- 0:00:48
      143000 -- (-735.630) [-736.680] (-735.608) (-740.867) * [-740.787] (-736.048) (-737.246) (-736.700) -- 0:00:47
      143500 -- (-736.555) (-737.051) [-738.296] (-738.119) * (-739.340) [-736.615] (-737.216) (-738.248) -- 0:00:47
      144000 -- [-736.184] (-737.743) (-742.044) (-736.578) * (-742.195) (-738.046) [-737.061] (-737.152) -- 0:00:47
      144500 -- [-737.390] (-739.817) (-736.359) (-738.253) * (-741.357) [-737.153] (-737.630) (-737.061) -- 0:00:47
      145000 -- (-737.650) (-737.485) [-737.238] (-736.506) * [-741.703] (-739.350) (-736.721) (-736.757) -- 0:00:47

      Average standard deviation of split frequencies: 0.011624

      145500 -- [-737.181] (-737.345) (-736.174) (-739.932) * (-738.040) [-737.538] (-737.453) (-736.825) -- 0:00:46
      146000 -- (-736.326) [-737.334] (-735.916) (-738.335) * (-738.956) (-737.834) [-737.467] (-739.837) -- 0:00:46
      146500 -- (-739.050) (-738.328) (-735.854) [-740.146] * (-741.185) (-736.526) (-737.873) [-736.343] -- 0:00:46
      147000 -- (-739.661) (-737.962) [-736.080] (-742.375) * (-739.325) (-737.887) [-738.742] (-738.701) -- 0:00:46
      147500 -- (-737.031) (-740.169) (-737.147) [-736.386] * [-737.568] (-737.208) (-738.597) (-737.103) -- 0:00:46
      148000 -- (-736.551) [-740.296] (-739.517) (-736.267) * (-744.026) (-736.087) (-739.892) [-737.225] -- 0:00:51
      148500 -- (-736.574) [-738.175] (-737.344) (-736.507) * [-736.866] (-736.648) (-740.820) (-743.925) -- 0:00:51
      149000 -- (-738.025) [-738.447] (-737.838) (-736.972) * (-737.265) (-737.696) (-738.238) [-738.326] -- 0:00:51
      149500 -- (-740.259) [-739.717] (-738.717) (-742.689) * (-739.450) (-736.368) [-735.861] (-744.191) -- 0:00:51
      150000 -- (-740.722) (-736.674) (-737.218) [-735.642] * [-739.072] (-739.263) (-736.399) (-741.013) -- 0:00:51

      Average standard deviation of split frequencies: 0.014236

      150500 -- (-741.012) (-736.147) (-738.772) [-738.158] * (-742.018) [-736.940] (-739.307) (-736.066) -- 0:00:50
      151000 -- (-738.761) (-742.164) (-738.717) [-737.170] * [-739.619] (-738.918) (-740.133) (-739.329) -- 0:00:50
      151500 -- (-739.020) (-738.109) [-736.713] (-739.455) * [-738.870] (-736.765) (-738.664) (-738.005) -- 0:00:50
      152000 -- [-737.834] (-740.617) (-736.877) (-740.168) * (-737.927) (-737.689) [-737.517] (-738.090) -- 0:00:50
      152500 -- (-739.109) (-738.462) (-739.931) [-737.466] * (-739.042) (-737.217) (-737.458) [-736.990] -- 0:00:50
      153000 -- (-744.180) (-736.772) (-740.970) [-738.253] * (-737.215) (-737.893) [-738.527] (-739.437) -- 0:00:49
      153500 -- (-741.469) (-740.440) [-737.047] (-735.934) * [-735.926] (-737.330) (-739.385) (-740.830) -- 0:00:49
      154000 -- (-737.613) (-739.807) [-739.336] (-736.209) * (-737.188) (-738.619) (-737.969) [-742.925] -- 0:00:49
      154500 -- (-738.874) (-738.131) [-737.793] (-739.781) * (-738.770) (-738.011) (-736.770) [-736.693] -- 0:00:49
      155000 -- (-736.487) [-737.392] (-737.097) (-739.713) * (-735.940) (-736.525) [-737.271] (-738.001) -- 0:00:49

      Average standard deviation of split frequencies: 0.013996

      155500 -- (-739.217) (-737.025) [-736.672] (-737.778) * [-740.604] (-736.514) (-738.688) (-740.988) -- 0:00:48
      156000 -- (-741.904) [-736.988] (-737.180) (-737.413) * (-738.268) [-738.081] (-743.161) (-738.131) -- 0:00:48
      156500 -- [-736.662] (-736.356) (-738.430) (-737.088) * (-736.733) [-737.441] (-744.206) (-737.785) -- 0:00:48
      157000 -- [-736.941] (-737.291) (-740.677) (-738.168) * [-738.792] (-743.352) (-737.369) (-738.180) -- 0:00:48
      157500 -- (-740.493) [-739.242] (-739.596) (-740.141) * (-736.742) (-737.926) (-739.719) [-736.982] -- 0:00:48
      158000 -- (-737.274) (-739.905) [-743.881] (-739.440) * (-739.735) [-738.147] (-740.165) (-736.521) -- 0:00:47
      158500 -- (-737.530) (-737.559) [-736.491] (-736.443) * [-745.974] (-737.410) (-744.200) (-736.187) -- 0:00:47
      159000 -- (-736.342) (-737.304) [-736.542] (-738.399) * [-740.946] (-738.819) (-741.328) (-737.629) -- 0:00:47
      159500 -- (-735.945) [-738.264] (-736.989) (-739.120) * (-740.355) (-736.543) (-737.984) [-737.661] -- 0:00:47
      160000 -- (-736.977) (-735.877) (-736.977) [-737.201] * (-738.670) (-736.976) [-739.378] (-742.363) -- 0:00:47

      Average standard deviation of split frequencies: 0.015811

      160500 -- (-736.561) (-737.879) [-738.630] (-737.677) * (-738.029) [-738.284] (-740.206) (-742.282) -- 0:00:47
      161000 -- [-736.593] (-742.290) (-737.390) (-738.263) * [-739.064] (-739.142) (-739.932) (-736.192) -- 0:00:46
      161500 -- (-736.649) (-738.290) [-735.705] (-738.109) * (-736.522) (-739.588) (-738.704) [-739.293] -- 0:00:46
      162000 -- [-740.501] (-739.540) (-737.601) (-738.502) * (-736.987) [-739.270] (-737.857) (-736.882) -- 0:00:46
      162500 -- (-741.733) (-736.441) (-737.416) [-736.186] * (-737.602) [-736.593] (-736.954) (-738.918) -- 0:00:46
      163000 -- [-738.641] (-737.546) (-739.884) (-736.871) * [-736.145] (-738.285) (-738.011) (-740.529) -- 0:00:46
      163500 -- (-737.138) (-736.158) (-739.160) [-736.320] * [-738.799] (-739.490) (-738.218) (-738.177) -- 0:00:46
      164000 -- (-737.124) (-737.520) [-737.177] (-739.195) * (-737.567) (-743.585) [-737.262] (-737.961) -- 0:00:45
      164500 -- (-741.301) [-735.767] (-737.246) (-738.920) * (-737.012) (-738.024) [-741.325] (-742.750) -- 0:00:45
      165000 -- (-736.020) (-741.719) [-737.325] (-735.977) * (-736.149) (-736.497) [-740.171] (-739.134) -- 0:00:50

      Average standard deviation of split frequencies: 0.014199

      165500 -- (-736.662) (-737.859) (-742.840) [-739.156] * (-742.008) (-736.430) (-742.229) [-738.235] -- 0:00:50
      166000 -- (-744.759) [-737.395] (-740.236) (-738.935) * (-737.572) (-737.993) [-737.804] (-739.478) -- 0:00:50
      166500 -- (-740.347) [-739.498] (-739.609) (-739.472) * (-736.782) (-741.434) [-736.610] (-736.997) -- 0:00:50
      167000 -- (-740.271) [-739.869] (-740.167) (-736.723) * [-739.050] (-738.700) (-736.613) (-738.203) -- 0:00:49
      167500 -- [-738.920] (-737.762) (-738.082) (-739.809) * [-741.086] (-738.843) (-738.364) (-739.653) -- 0:00:49
      168000 -- (-741.324) [-737.998] (-736.752) (-737.912) * (-743.340) (-740.044) (-738.938) [-738.381] -- 0:00:49
      168500 -- [-741.902] (-740.009) (-738.861) (-737.541) * [-738.326] (-737.043) (-741.468) (-739.502) -- 0:00:49
      169000 -- [-737.474] (-738.608) (-739.510) (-736.774) * (-737.044) (-742.110) (-739.470) [-737.491] -- 0:00:49
      169500 -- [-738.712] (-740.385) (-735.793) (-737.245) * (-739.308) [-737.686] (-738.807) (-736.522) -- 0:00:48
      170000 -- (-737.872) (-740.094) [-737.364] (-738.396) * (-741.635) [-737.355] (-739.606) (-736.425) -- 0:00:48

      Average standard deviation of split frequencies: 0.017590

      170500 -- (-738.589) [-738.420] (-736.676) (-738.593) * (-740.330) (-739.004) [-736.629] (-736.860) -- 0:00:48
      171000 -- (-737.979) (-737.550) [-737.423] (-736.686) * (-736.704) (-737.275) [-739.988] (-738.130) -- 0:00:48
      171500 -- (-737.830) (-738.530) (-739.579) [-736.926] * (-736.880) [-738.809] (-738.198) (-737.984) -- 0:00:48
      172000 -- (-738.631) (-736.438) (-743.396) [-744.916] * [-736.788] (-737.889) (-739.830) (-738.686) -- 0:00:48
      172500 -- (-738.040) [-736.178] (-739.305) (-737.073) * (-737.611) (-742.446) [-742.044] (-743.415) -- 0:00:47
      173000 -- [-737.832] (-736.418) (-736.876) (-737.858) * [-735.833] (-739.518) (-735.813) (-739.051) -- 0:00:47
      173500 -- [-739.755] (-737.163) (-736.353) (-737.970) * (-737.165) [-737.538] (-736.995) (-738.624) -- 0:00:47
      174000 -- (-738.716) [-738.011] (-738.338) (-738.256) * (-737.184) [-737.646] (-736.906) (-736.639) -- 0:00:47
      174500 -- (-737.895) [-736.794] (-737.229) (-738.769) * (-740.120) (-736.870) [-736.241] (-737.326) -- 0:00:47
      175000 -- (-737.439) (-736.497) [-739.707] (-739.074) * [-740.756] (-738.101) (-736.421) (-735.922) -- 0:00:47

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-741.254) (-737.981) [-735.851] (-736.387) * [-738.048] (-739.490) (-737.788) (-736.944) -- 0:00:46
      176000 -- [-739.085] (-737.594) (-736.212) (-740.251) * (-736.476) [-739.365] (-737.237) (-740.583) -- 0:00:46
      176500 -- (-737.843) (-738.403) [-737.241] (-738.147) * (-737.448) [-737.097] (-737.079) (-739.132) -- 0:00:46
      177000 -- [-738.912] (-738.744) (-739.113) (-738.052) * (-737.131) (-739.678) (-737.034) [-737.558] -- 0:00:46
      177500 -- (-742.158) (-739.213) (-738.567) [-735.961] * (-746.580) (-736.362) [-738.717] (-738.929) -- 0:00:46
      178000 -- [-742.138] (-740.134) (-740.406) (-741.457) * (-739.942) [-736.509] (-736.093) (-737.046) -- 0:00:46
      178500 -- (-737.984) [-740.931] (-739.125) (-736.556) * [-739.791] (-735.746) (-739.263) (-744.187) -- 0:00:46
      179000 -- (-737.990) (-736.444) [-736.829] (-737.536) * [-737.150] (-736.669) (-735.938) (-741.404) -- 0:00:45
      179500 -- (-739.199) [-737.695] (-741.525) (-738.509) * [-736.508] (-736.170) (-737.721) (-738.200) -- 0:00:45
      180000 -- (-744.036) [-736.855] (-740.732) (-736.440) * (-736.229) [-739.584] (-736.478) (-738.451) -- 0:00:45

      Average standard deviation of split frequencies: 0.013870

      180500 -- [-739.711] (-737.383) (-735.631) (-736.688) * (-736.068) (-738.701) [-736.801] (-736.938) -- 0:00:45
      181000 -- (-739.371) (-738.033) [-737.432] (-739.186) * (-737.415) (-737.273) [-737.337] (-735.952) -- 0:00:45
      181500 -- (-739.250) (-738.014) [-739.153] (-738.108) * [-740.541] (-738.939) (-736.457) (-737.073) -- 0:00:49
      182000 -- (-746.720) (-736.394) [-738.812] (-737.699) * (-738.244) (-739.688) [-740.210] (-736.617) -- 0:00:49
      182500 -- (-747.018) (-737.422) [-737.593] (-740.091) * (-736.680) (-741.398) (-739.169) [-736.455] -- 0:00:49
      183000 -- (-744.328) [-738.847] (-738.527) (-738.573) * (-739.149) (-738.437) (-738.112) [-737.247] -- 0:00:49
      183500 -- (-740.956) [-738.880] (-737.976) (-737.198) * (-739.011) (-738.990) [-741.507] (-737.088) -- 0:00:48
      184000 -- (-741.205) [-736.815] (-738.676) (-736.741) * (-739.885) (-736.344) (-737.159) [-739.077] -- 0:00:48
      184500 -- (-738.492) (-736.862) (-738.147) [-737.740] * (-738.577) (-737.355) [-736.985] (-739.118) -- 0:00:48
      185000 -- (-741.921) (-737.929) [-737.573] (-737.758) * (-736.165) [-737.465] (-739.069) (-736.818) -- 0:00:48

      Average standard deviation of split frequencies: 0.013559

      185500 -- (-737.890) (-737.389) (-736.295) [-739.821] * [-736.228] (-739.448) (-737.998) (-735.911) -- 0:00:48
      186000 -- (-737.564) (-737.430) (-736.597) [-738.665] * (-738.864) (-740.006) [-740.158] (-735.791) -- 0:00:48
      186500 -- [-736.360] (-737.531) (-735.745) (-738.889) * [-736.308] (-738.451) (-737.130) (-736.435) -- 0:00:47
      187000 -- (-736.174) (-737.598) (-737.861) [-740.438] * (-737.831) (-741.700) (-738.576) [-737.345] -- 0:00:47
      187500 -- (-737.982) (-737.133) (-740.422) [-741.560] * (-737.772) (-739.389) (-737.539) [-736.917] -- 0:00:47
      188000 -- (-736.852) (-739.742) (-739.820) [-738.097] * [-737.650] (-738.809) (-738.381) (-736.138) -- 0:00:47
      188500 -- [-736.320] (-739.474) (-737.149) (-740.012) * (-735.843) (-738.234) [-736.599] (-736.721) -- 0:00:47
      189000 -- (-738.728) [-736.482] (-736.316) (-737.257) * (-736.666) (-740.001) (-736.907) [-736.517] -- 0:00:47
      189500 -- (-738.693) (-736.689) [-735.868] (-736.431) * (-740.483) (-737.992) [-737.307] (-737.310) -- 0:00:47
      190000 -- (-738.514) (-739.529) [-738.409] (-738.693) * (-738.988) (-736.164) (-739.995) [-740.000] -- 0:00:46

      Average standard deviation of split frequencies: 0.012232

      190500 -- (-741.117) (-737.866) (-739.282) [-740.823] * (-737.630) (-735.607) [-737.159] (-742.827) -- 0:00:46
      191000 -- [-739.326] (-747.427) (-739.106) (-739.582) * [-737.094] (-737.716) (-736.637) (-739.941) -- 0:00:46
      191500 -- (-742.882) [-740.582] (-740.300) (-741.851) * (-737.260) [-736.985] (-736.756) (-738.521) -- 0:00:46
      192000 -- [-737.724] (-739.633) (-737.290) (-736.964) * [-736.094] (-736.319) (-736.883) (-737.018) -- 0:00:46
      192500 -- (-736.188) [-738.615] (-736.579) (-737.053) * [-738.794] (-736.497) (-735.834) (-741.263) -- 0:00:46
      193000 -- (-737.607) (-737.685) (-737.981) [-735.642] * (-737.329) (-736.822) [-739.419] (-742.062) -- 0:00:45
      193500 -- (-739.322) (-741.241) [-738.578] (-735.845) * (-737.501) [-740.242] (-740.320) (-739.402) -- 0:00:45
      194000 -- (-739.523) [-738.437] (-737.985) (-736.104) * (-735.560) (-740.280) [-736.203] (-740.875) -- 0:00:45
      194500 -- (-739.340) [-738.659] (-738.096) (-738.397) * (-738.332) (-738.663) [-743.594] (-737.916) -- 0:00:45
      195000 -- (-738.400) (-738.565) [-736.430] (-737.625) * [-735.723] (-738.691) (-738.872) (-740.426) -- 0:00:45

      Average standard deviation of split frequencies: 0.014431

      195500 -- [-737.883] (-740.738) (-737.773) (-737.194) * (-736.861) [-737.884] (-738.541) (-737.826) -- 0:00:45
      196000 -- [-737.992] (-748.840) (-740.611) (-740.767) * (-740.023) (-737.914) [-738.111] (-736.895) -- 0:00:45
      196500 -- (-737.458) (-737.396) (-736.857) [-741.101] * (-739.560) [-736.853] (-736.170) (-738.057) -- 0:00:44
      197000 -- (-736.182) (-739.386) (-736.186) [-736.404] * [-740.977] (-738.133) (-736.285) (-741.931) -- 0:00:44
      197500 -- (-737.480) [-739.274] (-735.865) (-736.488) * (-740.377) (-740.741) (-738.563) [-736.884] -- 0:00:44
      198000 -- (-738.098) [-736.417] (-737.342) (-737.221) * [-736.236] (-739.485) (-739.195) (-738.121) -- 0:00:48
      198500 -- (-737.686) (-737.988) (-737.153) [-737.259] * [-736.084] (-737.858) (-742.524) (-737.272) -- 0:00:48
      199000 -- [-738.197] (-737.585) (-737.545) (-743.372) * (-735.744) (-738.226) (-738.836) [-738.046] -- 0:00:48
      199500 -- (-737.078) (-738.894) [-736.527] (-737.552) * (-737.006) [-739.752] (-737.234) (-736.245) -- 0:00:48
      200000 -- (-737.716) (-740.005) [-735.874] (-741.043) * (-736.002) [-739.738] (-736.622) (-735.994) -- 0:00:48

      Average standard deviation of split frequencies: 0.017063

      200500 -- (-737.908) (-736.851) [-738.908] (-738.768) * [-740.126] (-739.371) (-736.222) (-735.945) -- 0:00:47
      201000 -- [-736.396] (-736.493) (-737.170) (-736.494) * (-740.395) (-739.365) (-736.107) [-738.116] -- 0:00:47
      201500 -- [-736.732] (-737.537) (-737.053) (-739.107) * (-738.908) (-739.516) (-737.706) [-737.374] -- 0:00:47
      202000 -- (-736.255) [-736.976] (-742.526) (-738.491) * (-736.578) (-737.377) [-736.916] (-739.756) -- 0:00:47
      202500 -- (-737.441) (-736.140) (-737.896) [-738.790] * (-737.551) (-736.727) (-738.841) [-738.344] -- 0:00:47
      203000 -- (-739.130) (-737.172) [-739.398] (-741.658) * (-737.076) (-735.949) (-738.828) [-738.587] -- 0:00:47
      203500 -- (-740.278) (-738.909) [-740.420] (-741.196) * [-736.516] (-738.986) (-739.077) (-737.821) -- 0:00:46
      204000 -- [-741.140] (-737.789) (-738.866) (-736.157) * (-738.512) [-739.427] (-738.808) (-737.998) -- 0:00:46
      204500 -- (-739.200) [-735.945] (-738.345) (-736.757) * (-739.616) (-736.877) (-739.716) [-742.746] -- 0:00:46
      205000 -- (-736.083) [-736.051] (-737.268) (-738.016) * [-744.590] (-740.171) (-738.451) (-738.214) -- 0:00:46

      Average standard deviation of split frequencies: 0.016139

      205500 -- (-737.780) (-738.767) [-739.097] (-737.128) * (-740.526) [-739.751] (-736.577) (-737.029) -- 0:00:46
      206000 -- [-738.583] (-740.835) (-735.886) (-736.765) * (-740.492) (-736.228) (-736.332) [-737.284] -- 0:00:46
      206500 -- (-737.805) (-738.306) (-739.814) [-742.982] * (-740.367) (-737.352) (-736.509) [-736.609] -- 0:00:46
      207000 -- (-737.592) (-739.022) [-740.432] (-739.448) * (-740.359) (-737.387) (-736.385) [-737.796] -- 0:00:45
      207500 -- (-737.355) [-740.187] (-736.208) (-741.465) * (-739.488) (-736.468) (-736.639) [-737.010] -- 0:00:45
      208000 -- [-736.189] (-736.090) (-740.572) (-736.494) * (-738.751) (-741.371) (-737.488) [-737.962] -- 0:00:45
      208500 -- (-738.561) (-737.515) (-742.492) [-735.936] * [-737.482] (-738.617) (-736.245) (-738.677) -- 0:00:45
      209000 -- (-740.582) (-739.196) (-736.872) [-737.693] * (-737.552) (-736.358) (-736.762) [-738.025] -- 0:00:45
      209500 -- (-737.389) (-738.416) (-736.486) [-740.180] * [-737.618] (-737.979) (-738.723) (-737.988) -- 0:00:45
      210000 -- (-739.680) (-742.287) (-737.244) [-738.749] * [-737.466] (-741.288) (-740.604) (-740.474) -- 0:00:45

      Average standard deviation of split frequencies: 0.014722

      210500 -- [-738.814] (-738.457) (-737.401) (-737.577) * (-737.775) [-737.470] (-736.196) (-738.167) -- 0:00:45
      211000 -- (-738.188) (-736.835) (-737.954) [-737.637] * (-739.779) (-741.916) [-742.370] (-741.779) -- 0:00:44
      211500 -- (-739.409) (-739.863) (-737.727) [-736.008] * (-738.120) (-737.115) [-737.072] (-738.644) -- 0:00:44
      212000 -- [-739.838] (-737.927) (-737.079) (-737.411) * (-736.382) [-737.520] (-736.649) (-744.031) -- 0:00:44
      212500 -- (-736.503) [-738.957] (-739.148) (-739.239) * (-736.925) (-737.585) [-736.929] (-738.603) -- 0:00:44
      213000 -- (-739.493) [-738.565] (-736.532) (-740.157) * (-737.653) [-740.266] (-738.346) (-737.064) -- 0:00:44
      213500 -- (-738.972) [-736.813] (-736.663) (-741.531) * (-737.479) (-739.043) (-737.636) [-735.730] -- 0:00:44
      214000 -- (-738.254) (-739.604) [-735.811] (-740.056) * (-736.491) (-738.924) [-738.017] (-739.479) -- 0:00:44
      214500 -- (-738.151) (-736.265) (-735.931) [-737.919] * (-736.502) [-737.965] (-737.689) (-738.065) -- 0:00:47
      215000 -- (-738.328) (-738.444) (-738.106) [-737.752] * (-736.646) (-738.792) (-740.759) [-736.152] -- 0:00:47

      Average standard deviation of split frequencies: 0.013439

      215500 -- (-742.244) (-736.484) (-739.212) [-737.239] * [-739.175] (-736.268) (-737.279) (-736.111) -- 0:00:47
      216000 -- (-741.215) (-739.187) [-737.234] (-738.694) * (-737.184) [-736.540] (-739.069) (-736.858) -- 0:00:47
      216500 -- (-737.342) (-738.666) (-741.460) [-736.163] * (-737.183) (-738.290) [-736.581] (-737.489) -- 0:00:47
      217000 -- (-738.766) [-738.065] (-740.853) (-737.711) * (-738.962) (-736.725) (-740.455) [-739.127] -- 0:00:46
      217500 -- (-740.112) [-739.005] (-740.176) (-740.853) * (-737.529) (-736.135) [-738.293] (-738.566) -- 0:00:46
      218000 -- (-739.005) [-739.171] (-737.645) (-736.797) * (-741.612) (-737.820) (-737.604) [-739.029] -- 0:00:46
      218500 -- (-744.747) (-736.217) [-735.869] (-736.596) * (-737.080) (-741.703) [-737.764] (-740.388) -- 0:00:46
      219000 -- (-737.852) [-736.943] (-737.386) (-738.225) * (-736.825) (-740.756) [-738.478] (-738.530) -- 0:00:46
      219500 -- (-737.360) [-742.513] (-740.308) (-737.176) * [-737.068] (-739.080) (-738.430) (-737.079) -- 0:00:46
      220000 -- (-739.578) [-737.564] (-742.650) (-738.967) * (-735.700) (-737.335) [-736.976] (-736.421) -- 0:00:46

      Average standard deviation of split frequencies: 0.013492

      220500 -- [-736.987] (-737.707) (-737.960) (-737.559) * (-737.903) (-736.085) (-739.260) [-737.928] -- 0:00:45
      221000 -- [-736.931] (-739.271) (-736.526) (-736.857) * [-736.153] (-736.862) (-737.358) (-738.980) -- 0:00:45
      221500 -- (-739.045) (-740.316) [-736.051] (-739.143) * (-739.093) (-737.518) (-741.453) [-738.281] -- 0:00:45
      222000 -- (-742.418) (-736.657) [-737.185] (-737.162) * (-738.082) (-738.681) [-739.386] (-741.385) -- 0:00:45
      222500 -- (-737.996) (-738.189) (-737.044) [-740.203] * (-738.795) (-738.677) (-740.392) [-736.664] -- 0:00:45
      223000 -- (-737.758) (-741.144) [-738.208] (-738.683) * (-739.520) (-736.972) [-741.362] (-740.143) -- 0:00:45
      223500 -- [-737.025] (-740.526) (-737.087) (-737.493) * (-740.279) (-737.286) [-739.162] (-740.159) -- 0:00:45
      224000 -- (-735.943) (-738.766) [-738.218] (-738.814) * [-738.784] (-738.778) (-747.993) (-739.086) -- 0:00:45
      224500 -- (-744.489) [-736.845] (-739.123) (-740.586) * (-737.767) (-739.517) (-740.454) [-737.381] -- 0:00:44
      225000 -- (-739.111) [-737.594] (-737.828) (-737.604) * [-738.613] (-738.245) (-737.447) (-738.681) -- 0:00:44

      Average standard deviation of split frequencies: 0.014381

      225500 -- (-747.852) (-736.979) [-736.207] (-736.877) * [-737.936] (-737.820) (-738.165) (-739.351) -- 0:00:44
      226000 -- (-741.349) (-738.134) (-744.034) [-739.481] * (-739.778) (-739.590) (-737.443) [-739.187] -- 0:00:44
      226500 -- (-740.525) (-739.208) (-738.895) [-740.446] * (-737.450) [-737.424] (-737.634) (-739.867) -- 0:00:44
      227000 -- (-738.151) [-738.468] (-739.590) (-735.693) * (-736.966) (-736.980) (-736.656) [-740.913] -- 0:00:44
      227500 -- [-739.412] (-738.484) (-738.548) (-741.016) * [-738.200] (-738.139) (-739.332) (-737.652) -- 0:00:44
      228000 -- [-737.937] (-736.467) (-738.537) (-739.655) * (-737.071) (-737.477) [-737.382] (-739.334) -- 0:00:44
      228500 -- (-741.555) (-736.769) [-739.281] (-737.444) * (-736.227) (-735.894) (-739.947) [-736.983] -- 0:00:43
      229000 -- (-746.798) (-737.141) [-736.001] (-737.244) * (-735.909) (-738.641) (-738.456) [-736.971] -- 0:00:43
      229500 -- (-740.599) [-736.008] (-736.416) (-737.834) * [-741.115] (-737.400) (-741.572) (-735.685) -- 0:00:43
      230000 -- (-738.244) (-736.340) [-736.413] (-739.025) * (-738.248) (-736.120) [-737.682] (-737.951) -- 0:00:43

      Average standard deviation of split frequencies: 0.014951

      230500 -- (-738.241) (-737.487) [-738.131] (-738.305) * [-743.334] (-736.284) (-739.594) (-736.988) -- 0:00:43
      231000 -- (-737.705) (-739.453) [-736.086] (-737.847) * [-735.843] (-737.635) (-740.386) (-739.973) -- 0:00:43
      231500 -- (-737.321) [-739.050] (-735.958) (-736.491) * (-738.046) (-736.627) [-737.628] (-737.261) -- 0:00:46
      232000 -- [-737.024] (-739.688) (-737.071) (-736.565) * (-736.608) (-736.789) [-739.745] (-737.076) -- 0:00:46
      232500 -- (-736.205) [-738.606] (-735.968) (-738.158) * (-738.099) (-735.574) [-736.742] (-737.264) -- 0:00:46
      233000 -- (-737.107) (-735.844) (-743.213) [-736.998] * (-738.115) (-736.339) (-735.945) [-737.054] -- 0:00:46
      233500 -- (-739.261) [-735.895] (-742.357) (-737.515) * (-736.311) (-738.435) (-738.636) [-737.787] -- 0:00:45
      234000 -- (-737.974) (-741.650) (-736.765) [-739.636] * (-736.810) (-737.630) [-737.524] (-736.446) -- 0:00:45
      234500 -- (-739.489) (-741.568) (-738.641) [-737.464] * (-735.737) (-738.318) [-736.110] (-739.112) -- 0:00:45
      235000 -- (-736.240) (-740.664) (-741.024) [-739.887] * (-737.495) [-736.674] (-743.738) (-738.167) -- 0:00:45

      Average standard deviation of split frequencies: 0.015203

      235500 -- (-735.886) (-737.403) [-736.932] (-739.983) * [-737.471] (-737.802) (-736.637) (-736.756) -- 0:00:45
      236000 -- (-737.263) [-737.336] (-736.714) (-737.764) * (-736.954) (-740.729) (-740.255) [-738.452] -- 0:00:45
      236500 -- (-737.736) (-740.806) [-738.432] (-736.793) * [-736.044] (-740.524) (-737.578) (-740.820) -- 0:00:45
      237000 -- [-736.178] (-738.855) (-744.382) (-736.327) * (-737.994) (-737.851) (-738.993) [-737.067] -- 0:00:45
      237500 -- (-738.045) (-737.869) (-739.170) [-739.755] * (-739.822) (-741.267) [-736.037] (-737.714) -- 0:00:44
      238000 -- (-737.091) (-739.622) (-738.744) [-740.250] * (-736.813) (-742.684) [-736.467] (-737.148) -- 0:00:44
      238500 -- (-736.739) (-737.756) [-736.896] (-740.441) * (-738.141) (-739.890) (-736.321) [-736.431] -- 0:00:44
      239000 -- (-738.380) (-738.703) [-736.757] (-736.117) * [-737.154] (-737.114) (-736.108) (-736.817) -- 0:00:44
      239500 -- (-736.776) (-736.978) [-739.440] (-740.526) * (-739.778) [-736.574] (-736.114) (-736.118) -- 0:00:44
      240000 -- [-735.950] (-739.282) (-737.856) (-738.222) * (-738.385) [-737.765] (-738.251) (-740.131) -- 0:00:44

      Average standard deviation of split frequencies: 0.014433

      240500 -- (-736.292) (-740.046) [-736.141] (-737.817) * (-738.070) [-739.057] (-736.833) (-741.688) -- 0:00:44
      241000 -- (-741.106) [-736.752] (-735.494) (-737.929) * (-743.873) (-737.555) [-736.303] (-744.182) -- 0:00:44
      241500 -- (-741.275) (-736.400) [-737.168] (-737.356) * [-738.561] (-738.876) (-736.535) (-739.594) -- 0:00:43
      242000 -- (-747.368) [-735.519] (-736.894) (-736.718) * [-738.762] (-739.234) (-736.557) (-746.282) -- 0:00:43
      242500 -- (-737.260) (-737.683) [-739.677] (-738.349) * (-736.942) [-738.621] (-736.141) (-738.408) -- 0:00:43
      243000 -- (-743.017) (-736.591) (-740.469) [-738.926] * (-736.107) (-738.662) (-735.871) [-737.397] -- 0:00:43
      243500 -- (-739.749) (-739.506) [-737.288] (-739.056) * (-736.038) (-740.149) [-735.796] (-735.987) -- 0:00:43
      244000 -- (-738.416) [-738.025] (-739.418) (-738.250) * (-736.216) (-738.627) (-739.075) [-736.205] -- 0:00:43
      244500 -- (-739.978) (-738.573) (-739.880) [-737.689] * (-739.231) [-738.493] (-738.140) (-738.016) -- 0:00:43
      245000 -- (-738.597) [-738.410] (-737.271) (-737.779) * (-737.518) (-738.057) (-737.573) [-737.998] -- 0:00:43

      Average standard deviation of split frequencies: 0.013918

      245500 -- (-741.039) (-736.795) (-737.605) [-740.562] * (-737.197) (-737.749) (-738.353) [-738.588] -- 0:00:43
      246000 -- [-738.238] (-735.949) (-738.097) (-739.324) * [-738.962] (-736.264) (-741.562) (-738.806) -- 0:00:42
      246500 -- (-736.815) (-743.248) (-739.323) [-737.207] * (-743.017) [-736.248] (-739.072) (-739.510) -- 0:00:42
      247000 -- (-737.317) [-738.970] (-738.405) (-737.106) * (-744.906) (-737.097) [-738.055] (-736.198) -- 0:00:42
      247500 -- (-737.709) (-740.262) (-737.999) [-737.016] * [-738.023] (-736.321) (-738.683) (-738.612) -- 0:00:45
      248000 -- (-737.829) [-737.182] (-741.306) (-736.341) * (-736.963) [-736.562] (-738.606) (-739.536) -- 0:00:45
      248500 -- (-736.762) (-738.574) [-736.613] (-737.505) * (-736.738) (-736.589) [-739.723] (-737.954) -- 0:00:45
      249000 -- (-737.951) (-738.387) [-736.435] (-741.684) * (-737.652) (-741.863) (-738.323) [-737.905] -- 0:00:45
      249500 -- (-736.369) (-736.478) (-739.094) [-737.346] * (-739.389) [-739.637] (-738.839) (-738.174) -- 0:00:45
      250000 -- [-737.505] (-736.210) (-739.007) (-736.847) * [-737.111] (-740.097) (-741.574) (-737.226) -- 0:00:45

      Average standard deviation of split frequencies: 0.013758

      250500 -- [-739.665] (-736.907) (-738.902) (-738.107) * (-736.998) (-735.604) (-737.977) [-736.806] -- 0:00:44
      251000 -- (-737.971) [-737.581] (-740.300) (-738.717) * (-738.585) (-740.039) (-741.596) [-736.087] -- 0:00:44
      251500 -- (-740.414) [-739.100] (-738.777) (-737.396) * (-741.888) [-737.740] (-743.104) (-737.442) -- 0:00:44
      252000 -- (-742.758) (-739.293) [-738.683] (-739.060) * (-738.175) (-738.405) [-738.298] (-736.535) -- 0:00:44
      252500 -- [-736.749] (-738.480) (-739.292) (-739.768) * [-735.654] (-740.196) (-738.118) (-738.309) -- 0:00:44
      253000 -- [-736.493] (-738.654) (-738.821) (-741.092) * (-738.079) [-736.355] (-740.147) (-742.601) -- 0:00:44
      253500 -- [-737.633] (-742.168) (-738.762) (-737.377) * [-739.793] (-736.905) (-744.013) (-738.650) -- 0:00:44
      254000 -- (-742.914) (-739.382) (-737.377) [-739.708] * (-739.966) (-743.417) (-739.071) [-742.439] -- 0:00:44
      254500 -- (-741.002) (-741.793) (-736.387) [-737.971] * (-738.663) [-738.412] (-736.341) (-739.607) -- 0:00:43
      255000 -- (-738.938) (-742.191) (-736.376) [-740.689] * (-738.320) [-737.544] (-737.243) (-739.087) -- 0:00:43

      Average standard deviation of split frequencies: 0.014828

      255500 -- (-738.540) (-739.195) [-737.956] (-738.066) * (-736.601) (-739.186) [-738.014] (-737.200) -- 0:00:43
      256000 -- (-738.036) [-737.628] (-737.460) (-736.618) * (-741.039) (-737.246) [-739.898] (-737.773) -- 0:00:43
      256500 -- (-736.756) (-739.063) [-738.444] (-736.051) * (-739.277) (-737.494) (-745.504) [-737.502] -- 0:00:43
      257000 -- (-736.697) (-737.404) (-737.891) [-736.493] * (-737.358) (-736.690) (-740.654) [-737.091] -- 0:00:43
      257500 -- (-739.175) (-739.067) (-738.832) [-738.857] * (-739.918) [-738.452] (-742.428) (-737.504) -- 0:00:43
      258000 -- (-740.306) (-737.759) [-736.572] (-736.371) * (-736.311) [-738.563] (-740.715) (-740.160) -- 0:00:43
      258500 -- [-743.595] (-738.064) (-738.530) (-736.763) * [-736.425] (-736.979) (-738.605) (-741.048) -- 0:00:43
      259000 -- (-738.799) [-737.688] (-736.502) (-738.215) * (-736.571) (-740.347) [-737.317] (-740.831) -- 0:00:42
      259500 -- (-737.252) (-738.703) [-739.147] (-738.595) * [-737.926] (-740.731) (-738.809) (-740.917) -- 0:00:42
      260000 -- (-737.446) (-738.845) [-735.982] (-739.978) * [-738.345] (-742.564) (-740.282) (-745.894) -- 0:00:42

      Average standard deviation of split frequencies: 0.015271

      260500 -- (-739.935) [-740.931] (-735.976) (-738.832) * [-737.746] (-739.900) (-738.097) (-737.619) -- 0:00:42
      261000 -- (-735.948) (-744.583) [-737.093] (-739.180) * (-737.650) [-736.137] (-736.447) (-738.911) -- 0:00:42
      261500 -- (-742.799) (-739.233) [-737.391] (-738.861) * [-736.352] (-737.006) (-739.806) (-738.167) -- 0:00:42
      262000 -- (-738.492) (-738.007) [-740.682] (-739.655) * [-738.746] (-740.166) (-740.316) (-739.448) -- 0:00:42
      262500 -- (-739.799) (-737.504) [-740.858] (-740.413) * (-738.416) (-738.102) (-739.226) [-739.888] -- 0:00:44
      263000 -- (-736.209) (-737.428) [-736.667] (-739.089) * (-737.804) (-742.958) [-736.772] (-738.793) -- 0:00:44
      263500 -- (-739.733) [-736.010] (-736.147) (-741.505) * [-737.891] (-740.912) (-737.483) (-741.796) -- 0:00:44
      264000 -- (-737.192) [-735.819] (-739.279) (-738.832) * (-736.849) (-736.832) [-737.314] (-738.718) -- 0:00:44
      264500 -- (-738.520) [-738.590] (-737.192) (-739.352) * (-737.658) (-738.559) [-742.185] (-737.370) -- 0:00:44
      265000 -- (-739.047) (-740.007) (-736.276) [-737.894] * (-737.696) [-737.826] (-736.662) (-736.179) -- 0:00:44

      Average standard deviation of split frequencies: 0.015950

      265500 -- [-737.692] (-739.602) (-737.351) (-738.975) * (-739.423) [-740.032] (-736.745) (-739.277) -- 0:00:44
      266000 -- (-738.086) (-736.440) (-741.793) [-738.845] * (-741.713) (-736.730) (-736.357) [-736.808] -- 0:00:44
      266500 -- [-737.513] (-738.908) (-737.642) (-738.630) * (-737.325) [-738.038] (-737.452) (-737.149) -- 0:00:44
      267000 -- [-741.423] (-736.935) (-738.586) (-741.167) * (-738.040) (-736.296) [-740.017] (-736.622) -- 0:00:43
      267500 -- [-740.110] (-737.461) (-738.042) (-738.804) * (-738.285) (-738.547) [-738.099] (-737.762) -- 0:00:43
      268000 -- (-740.621) (-736.519) (-737.122) [-736.558] * (-738.502) [-739.919] (-738.065) (-745.217) -- 0:00:43
      268500 -- [-738.789] (-736.498) (-740.895) (-741.528) * (-744.200) [-737.347] (-737.132) (-739.736) -- 0:00:43
      269000 -- [-737.119] (-738.475) (-737.578) (-741.612) * (-739.357) [-737.127] (-735.806) (-742.843) -- 0:00:43
      269500 -- [-738.132] (-742.045) (-739.261) (-737.058) * (-736.650) (-735.572) [-737.182] (-737.488) -- 0:00:43
      270000 -- (-739.693) (-739.762) (-738.775) [-738.912] * [-737.297] (-739.218) (-738.580) (-736.455) -- 0:00:43

      Average standard deviation of split frequencies: 0.017504

      270500 -- [-738.786] (-740.508) (-740.621) (-738.098) * (-738.615) [-737.549] (-742.309) (-736.779) -- 0:00:43
      271000 -- (-738.448) (-738.773) (-740.081) [-740.214] * (-740.353) (-737.787) (-739.602) [-737.456] -- 0:00:43
      271500 -- [-736.196] (-746.980) (-740.127) (-737.439) * (-737.204) (-739.999) (-736.870) [-736.637] -- 0:00:42
      272000 -- [-737.523] (-743.227) (-740.380) (-736.715) * (-736.391) [-735.812] (-736.929) (-736.261) -- 0:00:42
      272500 -- (-738.265) (-741.494) (-739.286) [-736.135] * [-736.309] (-736.316) (-739.553) (-736.815) -- 0:00:42
      273000 -- (-740.348) [-739.043] (-742.377) (-737.461) * (-741.226) [-735.982] (-738.386) (-739.638) -- 0:00:42
      273500 -- (-738.270) [-737.810] (-739.490) (-737.621) * [-740.536] (-736.847) (-737.860) (-738.600) -- 0:00:42
      274000 -- [-737.465] (-738.584) (-735.900) (-736.456) * (-739.224) (-736.311) (-736.764) [-741.563] -- 0:00:42
      274500 -- (-736.205) (-739.038) (-737.755) [-737.840] * (-740.543) [-737.975] (-737.057) (-738.008) -- 0:00:42
      275000 -- (-736.956) (-737.107) (-737.050) [-737.945] * (-735.761) (-737.097) (-736.757) [-736.919] -- 0:00:42

      Average standard deviation of split frequencies: 0.018019

      275500 -- [-736.970] (-736.233) (-738.195) (-738.660) * [-736.396] (-738.715) (-737.426) (-738.272) -- 0:00:42
      276000 -- (-738.587) [-737.203] (-736.427) (-737.443) * [-737.808] (-737.666) (-738.240) (-740.688) -- 0:00:41
      276500 -- [-736.886] (-737.177) (-741.458) (-738.269) * [-739.722] (-744.301) (-737.457) (-735.794) -- 0:00:41
      277000 -- (-738.493) (-739.743) [-737.392] (-737.027) * [-740.874] (-736.802) (-737.334) (-736.955) -- 0:00:41
      277500 -- (-735.870) (-739.091) (-739.830) [-738.870] * (-739.784) [-735.878] (-736.905) (-736.849) -- 0:00:41
      278000 -- (-735.697) (-738.805) (-736.741) [-740.798] * (-738.326) (-736.957) [-738.869] (-739.292) -- 0:00:44
      278500 -- [-739.615] (-739.981) (-737.367) (-736.251) * (-737.096) (-737.058) (-740.120) [-739.024] -- 0:00:44
      279000 -- [-736.666] (-740.901) (-740.567) (-736.697) * (-736.049) (-737.309) (-736.039) [-736.834] -- 0:00:43
      279500 -- [-739.525] (-736.921) (-737.855) (-739.883) * (-740.997) (-737.397) (-737.460) [-738.497] -- 0:00:43
      280000 -- (-743.961) (-737.784) (-741.853) [-736.574] * (-738.822) (-735.875) (-737.337) [-739.849] -- 0:00:43

      Average standard deviation of split frequencies: 0.016880

      280500 -- [-740.161] (-742.120) (-741.083) (-739.422) * (-740.074) (-737.886) [-737.681] (-737.344) -- 0:00:43
      281000 -- (-741.251) (-738.646) [-739.729] (-736.331) * (-739.764) (-738.804) [-736.496] (-739.942) -- 0:00:43
      281500 -- [-737.255] (-738.036) (-738.239) (-736.692) * (-737.790) (-742.151) [-737.964] (-741.037) -- 0:00:43
      282000 -- (-741.849) (-737.266) (-740.724) [-735.970] * (-738.135) [-738.294] (-737.139) (-740.763) -- 0:00:43
      282500 -- (-737.414) (-737.470) [-736.711] (-736.513) * (-738.362) [-735.784] (-737.005) (-740.526) -- 0:00:43
      283000 -- (-736.058) (-740.911) (-737.940) [-737.882] * [-736.860] (-737.334) (-736.836) (-737.754) -- 0:00:43
      283500 -- (-737.377) (-737.874) [-736.408] (-741.998) * (-737.439) [-736.710] (-737.224) (-736.503) -- 0:00:42
      284000 -- (-738.661) (-736.952) [-738.770] (-740.716) * (-736.046) [-736.201] (-743.866) (-736.548) -- 0:00:42
      284500 -- (-741.814) (-737.414) (-738.193) [-737.192] * [-738.340] (-739.159) (-741.072) (-737.255) -- 0:00:42
      285000 -- (-735.730) [-737.918] (-736.521) (-737.406) * [-736.656] (-739.234) (-737.765) (-737.707) -- 0:00:42

      Average standard deviation of split frequencies: 0.016136

      285500 -- [-736.281] (-741.759) (-738.845) (-737.786) * (-737.735) [-736.314] (-739.397) (-741.032) -- 0:00:42
      286000 -- [-735.823] (-743.446) (-737.766) (-737.750) * (-737.038) (-738.577) [-738.233] (-738.661) -- 0:00:42
      286500 -- (-736.990) [-740.015] (-737.902) (-737.788) * (-747.263) (-742.259) [-735.699] (-744.780) -- 0:00:42
      287000 -- (-740.846) (-740.097) [-737.186] (-738.520) * (-747.532) (-745.093) [-739.024] (-735.779) -- 0:00:42
      287500 -- (-738.085) [-737.921] (-737.298) (-736.562) * (-740.391) (-743.980) (-738.430) [-736.566] -- 0:00:42
      288000 -- [-737.261] (-742.004) (-737.283) (-736.273) * [-736.996] (-737.130) (-737.813) (-736.772) -- 0:00:42
      288500 -- (-740.558) (-737.889) [-738.623] (-736.150) * (-741.833) (-739.893) (-740.247) [-736.456] -- 0:00:41
      289000 -- (-738.012) (-738.812) [-736.330] (-740.020) * (-740.010) (-738.906) [-737.967] (-736.918) -- 0:00:41
      289500 -- (-737.438) (-741.034) [-737.178] (-739.814) * (-738.709) [-739.339] (-736.450) (-738.501) -- 0:00:41
      290000 -- (-736.220) (-739.594) [-736.597] (-740.873) * (-738.318) (-736.423) (-741.462) [-738.638] -- 0:00:41

      Average standard deviation of split frequencies: 0.016218

      290500 -- (-739.004) (-739.323) (-739.775) [-738.203] * (-738.127) [-735.913] (-740.802) (-737.196) -- 0:00:41
      291000 -- (-740.905) [-737.074] (-739.315) (-738.261) * (-739.158) [-736.925] (-737.230) (-739.625) -- 0:00:41
      291500 -- (-738.679) (-736.877) [-740.701] (-736.154) * (-736.746) (-738.452) [-737.741] (-744.843) -- 0:00:41
      292000 -- (-736.513) (-736.496) [-738.900] (-739.152) * (-739.987) (-739.588) [-739.841] (-742.095) -- 0:00:41
      292500 -- (-736.506) (-736.660) (-738.843) [-736.480] * (-737.283) [-737.458] (-739.039) (-739.553) -- 0:00:41
      293000 -- (-739.656) (-735.685) (-738.354) [-737.546] * (-740.310) (-736.679) (-735.902) [-738.717] -- 0:00:41
      293500 -- [-737.217] (-736.113) (-746.585) (-735.861) * (-737.074) (-737.107) [-739.080] (-739.772) -- 0:00:43
      294000 -- (-735.762) (-736.286) [-740.814] (-736.156) * (-739.929) [-736.946] (-740.153) (-737.138) -- 0:00:43
      294500 -- (-735.754) (-736.134) (-741.869) [-738.485] * [-745.777] (-737.873) (-739.178) (-737.645) -- 0:00:43
      295000 -- (-737.318) [-736.511] (-742.731) (-736.245) * [-739.156] (-738.012) (-737.406) (-738.236) -- 0:00:43

      Average standard deviation of split frequencies: 0.015507

      295500 -- [-737.848] (-737.732) (-736.050) (-736.156) * [-736.953] (-741.764) (-740.112) (-739.242) -- 0:00:42
      296000 -- [-736.294] (-738.833) (-737.494) (-738.367) * (-735.962) (-739.370) (-736.577) [-738.607] -- 0:00:42
      296500 -- [-741.923] (-738.366) (-739.115) (-736.945) * (-737.065) [-736.569] (-738.048) (-738.418) -- 0:00:42
      297000 -- [-738.706] (-737.407) (-738.531) (-737.476) * (-736.933) [-736.485] (-739.698) (-738.883) -- 0:00:42
      297500 -- (-737.513) (-738.970) [-737.173] (-737.543) * [-736.916] (-737.125) (-737.329) (-737.077) -- 0:00:42
      298000 -- (-736.705) (-736.718) [-737.881] (-738.186) * (-738.287) (-740.097) [-738.716] (-736.103) -- 0:00:42
      298500 -- [-740.460] (-738.948) (-738.085) (-737.328) * [-737.444] (-738.031) (-736.817) (-737.955) -- 0:00:42
      299000 -- [-742.102] (-741.632) (-738.854) (-737.422) * (-737.759) [-739.458] (-738.700) (-740.136) -- 0:00:42
      299500 -- (-737.467) (-738.830) [-735.911] (-739.056) * [-739.706] (-738.823) (-738.787) (-738.175) -- 0:00:42
      300000 -- (-736.190) (-737.397) [-736.320] (-738.154) * (-744.744) (-737.512) (-737.201) [-737.389] -- 0:00:42

      Average standard deviation of split frequencies: 0.014808

      300500 -- (-736.865) (-740.698) (-735.696) [-737.570] * (-740.170) [-739.308] (-740.280) (-741.229) -- 0:00:41
      301000 -- [-736.063] (-736.878) (-737.608) (-736.726) * [-737.427] (-742.456) (-737.764) (-740.303) -- 0:00:41
      301500 -- (-742.962) [-738.256] (-737.232) (-736.178) * (-737.427) (-737.635) [-737.926] (-739.454) -- 0:00:41
      302000 -- (-746.118) [-740.551] (-740.950) (-736.652) * (-736.557) (-738.068) [-737.043] (-739.777) -- 0:00:41
      302500 -- (-739.425) [-736.544] (-735.877) (-737.750) * [-736.456] (-737.031) (-736.590) (-739.841) -- 0:00:41
      303000 -- [-739.276] (-742.914) (-736.685) (-735.968) * [-737.994] (-738.960) (-736.818) (-739.842) -- 0:00:41
      303500 -- (-741.105) [-737.932] (-736.726) (-736.442) * (-736.631) (-737.044) [-736.217] (-737.017) -- 0:00:41
      304000 -- (-738.034) [-741.239] (-737.204) (-737.854) * (-737.687) (-738.683) (-737.842) [-739.128] -- 0:00:41
      304500 -- (-736.485) [-741.750] (-736.604) (-737.659) * (-738.839) [-739.384] (-738.230) (-742.924) -- 0:00:41
      305000 -- [-736.663] (-740.615) (-739.345) (-736.520) * (-737.132) (-738.765) [-740.154] (-740.238) -- 0:00:41

      Average standard deviation of split frequencies: 0.015405

      305500 -- (-737.042) (-741.861) [-743.556] (-736.631) * (-739.654) (-739.907) [-735.779] (-740.189) -- 0:00:40
      306000 -- (-736.709) (-739.845) (-743.300) [-737.268] * (-738.004) (-742.574) [-743.666] (-736.415) -- 0:00:40
      306500 -- (-740.042) (-737.038) [-735.776] (-738.079) * [-737.683] (-740.277) (-741.840) (-738.743) -- 0:00:40
      307000 -- (-739.469) [-736.172] (-737.784) (-737.816) * (-738.925) [-740.651] (-738.934) (-738.830) -- 0:00:40
      307500 -- (-738.689) (-736.847) (-735.878) [-739.708] * (-738.443) (-737.929) [-738.087] (-737.549) -- 0:00:40
      308000 -- (-736.905) (-738.525) (-740.967) [-738.082] * (-738.216) [-737.693] (-737.676) (-736.139) -- 0:00:40
      308500 -- (-736.595) (-741.265) [-738.096] (-739.233) * (-740.131) [-739.136] (-740.177) (-736.997) -- 0:00:40
      309000 -- (-739.463) [-737.834] (-737.195) (-737.421) * (-737.458) [-736.736] (-738.611) (-736.624) -- 0:00:40
      309500 -- (-741.159) (-739.396) (-741.725) [-737.638] * (-736.663) (-738.124) (-738.457) [-736.006] -- 0:00:40
      310000 -- [-741.486] (-738.403) (-738.301) (-738.505) * (-737.205) [-739.385] (-738.982) (-739.436) -- 0:00:40

      Average standard deviation of split frequencies: 0.014192

      310500 -- (-741.297) (-743.633) [-738.171] (-737.490) * (-736.576) [-743.494] (-739.719) (-739.401) -- 0:00:42
      311000 -- (-738.394) (-740.027) (-736.567) [-737.117] * (-741.391) (-738.801) [-736.779] (-740.420) -- 0:00:42
      311500 -- (-738.571) (-740.800) (-745.187) [-736.912] * [-737.376] (-740.613) (-737.301) (-737.339) -- 0:00:41
      312000 -- [-737.821] (-740.669) (-738.382) (-737.042) * (-737.287) [-738.801] (-736.104) (-740.385) -- 0:00:41
      312500 -- (-737.745) (-737.448) (-738.123) [-737.730] * (-736.196) (-738.559) [-736.156] (-743.370) -- 0:00:41
      313000 -- (-740.807) (-738.490) [-738.982] (-739.208) * (-735.788) (-737.215) (-737.397) [-737.377] -- 0:00:41
      313500 -- (-739.756) [-737.786] (-737.822) (-740.940) * (-738.573) [-735.973] (-739.006) (-742.144) -- 0:00:41
      314000 -- (-735.697) (-738.667) [-738.144] (-737.160) * (-736.955) (-738.959) (-741.255) [-737.099] -- 0:00:41
      314500 -- [-738.946] (-740.336) (-737.830) (-739.924) * (-738.041) (-740.547) [-738.557] (-736.407) -- 0:00:41
      315000 -- (-739.848) (-738.637) [-736.768] (-736.308) * (-736.534) [-736.771] (-735.824) (-736.372) -- 0:00:41

      Average standard deviation of split frequencies: 0.014255

      315500 -- (-741.333) (-738.670) [-735.909] (-737.922) * (-737.616) [-739.814] (-737.087) (-738.533) -- 0:00:41
      316000 -- (-736.382) (-737.323) [-738.042] (-738.285) * [-736.886] (-736.947) (-741.111) (-737.028) -- 0:00:41
      316500 -- (-743.704) (-738.794) [-736.657] (-735.969) * (-736.873) [-738.786] (-740.105) (-739.566) -- 0:00:41
      317000 -- (-740.007) (-739.799) (-737.134) [-736.242] * (-739.417) (-736.542) [-738.693] (-741.219) -- 0:00:40
      317500 -- (-740.519) [-740.333] (-746.275) (-737.716) * (-740.060) [-738.154] (-740.605) (-738.210) -- 0:00:40
      318000 -- (-742.444) [-738.315] (-737.099) (-737.933) * [-740.459] (-736.911) (-739.778) (-737.624) -- 0:00:40
      318500 -- [-740.306] (-738.316) (-738.364) (-737.287) * [-737.966] (-742.325) (-738.933) (-737.304) -- 0:00:40
      319000 -- (-736.930) [-738.080] (-737.996) (-739.068) * (-736.919) (-739.395) (-742.622) [-736.533] -- 0:00:40
      319500 -- (-736.293) (-740.577) (-736.583) [-738.541] * [-736.942] (-736.826) (-740.895) (-737.298) -- 0:00:40
      320000 -- (-735.657) (-736.621) (-737.548) [-739.891] * (-736.732) [-737.020] (-739.320) (-740.948) -- 0:00:40

      Average standard deviation of split frequencies: 0.014623

      320500 -- [-737.154] (-739.150) (-736.986) (-740.065) * (-738.977) [-737.232] (-737.203) (-740.025) -- 0:00:40
      321000 -- [-737.447] (-737.454) (-737.366) (-739.777) * (-738.012) (-737.482) (-737.357) [-737.656] -- 0:00:40
      321500 -- [-736.816] (-737.236) (-738.080) (-740.751) * (-737.202) (-745.586) [-736.621] (-736.530) -- 0:00:40
      322000 -- [-736.918] (-737.819) (-736.138) (-739.261) * (-738.885) [-737.398] (-739.636) (-737.563) -- 0:00:40
      322500 -- [-736.830] (-737.516) (-736.923) (-737.464) * (-737.167) [-736.976] (-738.044) (-739.631) -- 0:00:39
      323000 -- [-738.452] (-739.199) (-739.988) (-736.742) * [-737.824] (-741.262) (-739.967) (-742.284) -- 0:00:39
      323500 -- [-736.128] (-738.032) (-737.307) (-738.334) * (-736.588) [-740.934] (-738.988) (-743.537) -- 0:00:39
      324000 -- (-736.262) (-739.534) (-742.378) [-737.310] * (-736.101) [-739.215] (-740.165) (-737.927) -- 0:00:39
      324500 -- (-735.897) [-739.559] (-738.814) (-747.025) * (-739.284) [-739.971] (-736.551) (-741.975) -- 0:00:39
      325000 -- [-736.125] (-741.487) (-738.426) (-738.202) * (-739.015) (-738.875) [-739.892] (-740.917) -- 0:00:39

      Average standard deviation of split frequencies: 0.014605

      325500 -- (-736.155) (-739.497) [-737.421] (-739.761) * [-736.641] (-737.131) (-737.960) (-737.231) -- 0:00:39
      326000 -- [-739.564] (-742.882) (-748.202) (-737.301) * (-736.560) (-740.392) (-737.725) [-737.503] -- 0:00:39
      326500 -- (-738.139) [-735.806] (-742.063) (-738.749) * (-738.448) [-736.867] (-739.271) (-738.260) -- 0:00:39
      327000 -- [-738.727] (-738.448) (-739.593) (-736.401) * (-737.122) (-741.085) (-738.136) [-736.021] -- 0:00:41
      327500 -- (-737.839) (-738.852) (-736.719) [-736.866] * (-737.386) (-736.260) [-736.362] (-736.278) -- 0:00:41
      328000 -- (-737.840) (-739.536) (-738.869) [-737.725] * [-736.180] (-737.586) (-737.264) (-737.631) -- 0:00:40
      328500 -- (-740.277) (-737.485) [-738.625] (-738.813) * [-736.655] (-745.029) (-737.661) (-737.869) -- 0:00:40
      329000 -- [-738.149] (-739.116) (-738.336) (-742.049) * (-737.936) [-743.341] (-741.591) (-737.583) -- 0:00:40
      329500 -- (-737.323) (-740.335) [-735.724] (-736.451) * (-737.838) (-739.075) (-742.847) [-739.195] -- 0:00:40
      330000 -- (-737.349) (-737.524) [-736.572] (-737.469) * [-738.843] (-738.548) (-742.451) (-739.105) -- 0:00:40

      Average standard deviation of split frequencies: 0.014031

      330500 -- (-738.021) [-739.014] (-735.475) (-737.005) * (-738.970) (-738.483) (-739.745) [-737.725] -- 0:00:40
      331000 -- [-737.717] (-739.967) (-735.650) (-737.692) * (-740.183) [-739.700] (-737.840) (-737.886) -- 0:00:40
      331500 -- (-739.938) (-745.827) (-736.582) [-736.619] * (-737.103) (-738.712) (-740.881) [-736.412] -- 0:00:40
      332000 -- (-736.628) [-738.132] (-743.002) (-737.535) * (-739.307) (-738.486) [-740.109] (-741.926) -- 0:00:40
      332500 -- (-741.768) (-740.903) (-737.080) [-739.564] * (-736.768) [-737.295] (-740.734) (-742.935) -- 0:00:40
      333000 -- (-736.501) (-736.386) [-737.529] (-739.149) * (-736.439) [-738.130] (-736.915) (-742.590) -- 0:00:40
      333500 -- (-736.829) [-737.092] (-736.989) (-736.947) * (-737.620) (-736.594) [-736.625] (-737.086) -- 0:00:39
      334000 -- (-737.835) (-736.920) (-738.001) [-740.348] * (-737.795) [-736.744] (-736.765) (-736.165) -- 0:00:39
      334500 -- [-736.433] (-737.166) (-739.954) (-738.032) * (-738.389) [-738.030] (-736.161) (-735.599) -- 0:00:39
      335000 -- [-736.687] (-741.447) (-738.416) (-736.642) * (-738.349) (-737.164) [-735.482] (-740.419) -- 0:00:39

      Average standard deviation of split frequencies: 0.014842

      335500 -- (-740.273) (-737.881) (-737.430) [-738.051] * (-738.495) (-736.782) (-737.091) [-738.963] -- 0:00:39
      336000 -- (-737.326) (-738.296) (-739.900) [-738.865] * (-741.508) [-737.226] (-737.093) (-740.066) -- 0:00:39
      336500 -- [-739.819] (-736.267) (-736.806) (-737.602) * [-737.303] (-738.122) (-737.793) (-739.145) -- 0:00:39
      337000 -- (-739.401) [-742.473] (-736.407) (-738.557) * [-741.754] (-738.751) (-736.581) (-739.890) -- 0:00:39
      337500 -- (-736.040) [-737.525] (-735.963) (-739.158) * (-737.969) [-737.229] (-736.479) (-737.370) -- 0:00:39
      338000 -- [-737.266] (-738.220) (-736.118) (-735.822) * (-741.219) (-739.670) [-737.477] (-739.353) -- 0:00:39
      338500 -- (-736.816) (-737.508) [-740.500] (-739.552) * (-738.939) (-739.739) (-738.743) [-738.322] -- 0:00:39
      339000 -- (-737.589) (-736.976) [-739.924] (-737.274) * (-736.162) [-739.982] (-743.301) (-736.427) -- 0:00:38
      339500 -- [-736.777] (-740.430) (-740.202) (-736.722) * (-738.358) [-738.954] (-739.506) (-738.159) -- 0:00:38
      340000 -- (-737.073) (-736.246) (-740.725) [-739.196] * (-738.361) (-737.571) [-737.700] (-736.875) -- 0:00:38

      Average standard deviation of split frequencies: 0.014001

      340500 -- (-738.040) (-739.537) [-738.017] (-740.481) * (-741.414) [-735.772] (-738.792) (-742.226) -- 0:00:38
      341000 -- (-738.158) (-738.079) (-737.875) [-737.646] * (-741.477) (-736.656) [-738.545] (-737.302) -- 0:00:38
      341500 -- [-736.117] (-738.555) (-737.447) (-746.542) * (-744.121) (-738.692) (-742.253) [-739.026] -- 0:00:38
      342000 -- (-737.630) [-738.794] (-736.690) (-738.106) * (-742.862) [-737.866] (-739.685) (-737.832) -- 0:00:38
      342500 -- (-736.394) [-740.168] (-737.109) (-737.951) * [-737.887] (-736.992) (-738.771) (-738.299) -- 0:00:38
      343000 -- (-738.490) (-740.065) [-740.036] (-738.326) * (-737.616) (-737.238) (-739.033) [-738.299] -- 0:00:38
      343500 -- (-735.925) [-736.825] (-736.677) (-739.125) * [-737.734] (-738.334) (-738.658) (-741.230) -- 0:00:40
      344000 -- [-736.528] (-738.820) (-737.052) (-741.287) * [-736.292] (-742.897) (-737.541) (-736.627) -- 0:00:40
      344500 -- [-742.094] (-735.600) (-740.038) (-739.885) * (-736.290) [-742.573] (-742.364) (-736.357) -- 0:00:39
      345000 -- (-738.142) (-735.803) (-736.416) [-736.785] * (-737.201) (-739.562) [-739.259] (-737.117) -- 0:00:39

      Average standard deviation of split frequencies: 0.014055

      345500 -- (-737.304) [-737.336] (-737.529) (-735.917) * [-739.350] (-735.728) (-739.583) (-737.310) -- 0:00:39
      346000 -- (-742.192) [-737.339] (-737.135) (-736.157) * (-740.337) [-736.493] (-739.841) (-737.369) -- 0:00:39
      346500 -- (-736.471) [-737.161] (-740.070) (-737.027) * (-742.202) (-737.831) (-742.974) [-737.325] -- 0:00:39
      347000 -- (-736.172) [-736.598] (-737.837) (-736.822) * (-741.002) (-737.386) (-739.628) [-739.162] -- 0:00:39
      347500 -- [-735.790] (-736.198) (-740.098) (-738.021) * [-746.311] (-738.624) (-739.012) (-739.122) -- 0:00:39
      348000 -- (-736.665) [-737.159] (-744.306) (-737.007) * (-740.742) (-737.452) [-736.907] (-736.478) -- 0:00:39
      348500 -- (-736.699) [-737.217] (-739.818) (-736.683) * (-740.903) [-737.743] (-737.980) (-741.472) -- 0:00:39
      349000 -- [-737.422] (-737.017) (-739.374) (-737.443) * (-737.742) [-742.754] (-739.817) (-742.450) -- 0:00:39
      349500 -- (-740.693) [-736.171] (-739.001) (-736.975) * (-736.100) [-742.650] (-737.409) (-739.151) -- 0:00:39
      350000 -- [-737.205] (-736.135) (-737.747) (-739.853) * (-737.109) (-737.251) (-739.773) [-738.236] -- 0:00:39

      Average standard deviation of split frequencies: 0.013514

      350500 -- (-736.014) [-737.978] (-735.946) (-738.203) * (-748.593) (-739.573) [-741.143] (-737.925) -- 0:00:38
      351000 -- (-740.533) (-739.638) (-737.076) [-737.966] * (-742.854) [-738.651] (-737.644) (-735.745) -- 0:00:38
      351500 -- (-744.849) [-737.168] (-738.460) (-738.711) * (-736.593) (-737.743) (-739.536) [-737.118] -- 0:00:38
      352000 -- (-740.180) (-737.034) [-738.022] (-737.234) * (-739.865) [-737.748] (-737.102) (-738.424) -- 0:00:38
      352500 -- (-741.178) (-737.094) [-736.165] (-738.870) * [-737.998] (-737.315) (-736.253) (-737.701) -- 0:00:38
      353000 -- (-737.477) (-738.465) (-736.322) [-738.492] * (-737.818) (-741.764) [-738.269] (-738.169) -- 0:00:38
      353500 -- (-742.276) (-737.685) [-739.029] (-739.690) * (-737.580) (-736.702) (-740.684) [-740.497] -- 0:00:38
      354000 -- (-742.968) (-738.806) [-739.656] (-737.271) * (-739.220) (-736.240) (-740.350) [-740.989] -- 0:00:38
      354500 -- [-737.930] (-741.414) (-745.202) (-736.898) * (-735.856) [-736.314] (-742.508) (-736.927) -- 0:00:38
      355000 -- (-737.903) [-739.416] (-743.401) (-740.658) * (-736.663) (-737.205) [-738.428] (-738.753) -- 0:00:38

      Average standard deviation of split frequencies: 0.013102

      355500 -- (-737.365) [-737.873] (-740.249) (-742.062) * (-736.559) (-736.159) (-740.906) [-735.770] -- 0:00:38
      356000 -- (-737.639) (-735.976) [-738.726] (-741.165) * (-735.901) (-736.910) (-739.327) [-738.991] -- 0:00:37
      356500 -- (-737.898) (-736.123) (-738.924) [-739.773] * (-736.354) (-743.013) [-736.501] (-736.806) -- 0:00:37
      357000 -- (-738.149) [-737.516] (-740.911) (-744.972) * [-736.258] (-738.193) (-737.147) (-736.504) -- 0:00:37
      357500 -- (-740.408) (-738.044) [-736.289] (-739.840) * (-738.765) (-738.221) (-738.581) [-736.432] -- 0:00:37
      358000 -- (-738.036) (-737.574) [-738.025] (-737.980) * (-739.659) (-737.098) (-737.381) [-737.326] -- 0:00:37
      358500 -- (-737.538) [-736.258] (-738.099) (-738.063) * (-737.096) (-743.334) (-740.594) [-737.310] -- 0:00:37
      359000 -- (-737.264) (-738.541) (-738.723) [-739.256] * (-737.646) (-743.575) [-738.953] (-741.749) -- 0:00:37
      359500 -- [-736.400] (-736.683) (-737.641) (-738.152) * (-736.596) (-738.894) [-739.882] (-735.808) -- 0:00:37
      360000 -- (-737.327) (-743.049) (-737.356) [-736.724] * (-742.938) (-740.653) (-738.992) [-740.916] -- 0:00:37

      Average standard deviation of split frequencies: 0.013277

      360500 -- (-738.187) [-737.050] (-736.610) (-737.817) * (-738.258) (-741.467) (-738.282) [-737.341] -- 0:00:39
      361000 -- [-737.262] (-736.302) (-740.669) (-739.345) * (-736.919) (-737.939) [-737.811] (-737.025) -- 0:00:38
      361500 -- (-737.773) [-738.659] (-735.926) (-738.152) * (-736.150) (-737.403) (-738.062) [-736.187] -- 0:00:38
      362000 -- [-741.354] (-740.362) (-740.284) (-737.726) * (-738.994) [-737.753] (-738.737) (-738.100) -- 0:00:38
      362500 -- [-737.686] (-737.590) (-738.581) (-738.670) * (-739.510) (-735.623) [-738.955] (-737.793) -- 0:00:38
      363000 -- (-738.238) (-736.915) [-739.328] (-738.332) * [-736.151] (-739.382) (-742.594) (-738.381) -- 0:00:38
      363500 -- (-742.624) (-737.034) (-739.849) [-737.821] * (-737.397) [-742.944] (-741.057) (-735.907) -- 0:00:38
      364000 -- [-737.576] (-739.378) (-737.084) (-736.734) * [-737.810] (-742.188) (-737.493) (-735.958) -- 0:00:38
      364500 -- (-739.832) (-737.368) [-738.373] (-737.849) * (-737.070) (-738.154) [-737.286] (-738.417) -- 0:00:38
      365000 -- [-738.750] (-739.346) (-737.112) (-736.418) * [-736.631] (-738.690) (-737.856) (-736.169) -- 0:00:38

      Average standard deviation of split frequencies: 0.013897

      365500 -- (-738.033) (-736.874) [-739.906] (-736.953) * (-736.601) (-736.972) [-738.871] (-738.650) -- 0:00:38
      366000 -- (-739.049) [-737.182] (-736.210) (-735.718) * (-736.521) (-736.241) [-737.101] (-738.296) -- 0:00:38
      366500 -- (-738.810) (-738.894) [-737.318] (-736.801) * (-737.383) (-735.996) [-742.477] (-737.627) -- 0:00:38
      367000 -- (-741.774) (-736.711) (-739.972) [-737.104] * (-736.328) [-736.515] (-744.254) (-737.957) -- 0:00:37
      367500 -- (-736.406) (-736.134) (-738.350) [-739.336] * (-738.294) (-736.560) [-736.531] (-736.910) -- 0:00:37
      368000 -- (-738.011) [-736.802] (-740.577) (-736.754) * [-738.461] (-741.633) (-739.736) (-739.442) -- 0:00:37
      368500 -- (-738.876) (-737.207) [-738.846] (-740.233) * (-736.545) (-738.856) (-742.206) [-740.524] -- 0:00:37
      369000 -- [-737.392] (-738.754) (-736.533) (-736.664) * (-736.415) (-740.201) [-736.125] (-737.122) -- 0:00:37
      369500 -- (-736.978) (-737.283) (-739.460) [-737.037] * (-738.464) (-738.019) [-743.521] (-736.313) -- 0:00:37
      370000 -- (-739.204) (-737.830) [-736.267] (-737.654) * (-738.021) (-736.130) [-736.528] (-738.283) -- 0:00:37

      Average standard deviation of split frequencies: 0.014793

      370500 -- (-737.304) [-740.972] (-739.343) (-737.346) * (-739.880) [-737.095] (-739.057) (-738.648) -- 0:00:37
      371000 -- (-736.972) [-736.903] (-738.902) (-735.742) * (-739.007) [-736.307] (-739.167) (-739.145) -- 0:00:37
      371500 -- (-735.741) (-740.404) [-738.933] (-738.817) * [-742.748] (-737.489) (-741.086) (-738.235) -- 0:00:37
      372000 -- (-738.422) [-740.116] (-738.687) (-737.944) * (-741.178) (-738.244) [-735.958] (-743.441) -- 0:00:37
      372500 -- (-737.816) (-736.675) (-736.746) [-738.291] * [-739.967] (-736.757) (-737.763) (-738.719) -- 0:00:37
      373000 -- (-739.435) [-736.723] (-738.226) (-736.156) * [-737.573] (-737.946) (-737.589) (-739.541) -- 0:00:36
      373500 -- (-736.887) (-739.644) [-738.017] (-739.719) * (-741.478) (-741.507) [-737.424] (-738.929) -- 0:00:36
      374000 -- (-736.050) (-740.312) [-738.028] (-743.170) * (-737.641) (-737.179) [-738.154] (-739.698) -- 0:00:36
      374500 -- (-736.587) [-738.995] (-738.211) (-737.614) * [-738.291] (-740.298) (-737.653) (-736.258) -- 0:00:36
      375000 -- (-737.387) [-736.586] (-739.222) (-739.278) * (-737.622) (-741.736) (-738.813) [-737.742] -- 0:00:36

      Average standard deviation of split frequencies: 0.016229

      375500 -- (-737.199) [-736.457] (-741.332) (-736.035) * (-739.322) (-739.823) (-741.348) [-737.543] -- 0:00:36
      376000 -- (-738.875) (-737.717) (-738.816) [-737.434] * (-735.889) (-738.952) [-737.346] (-735.541) -- 0:00:36
      376500 -- (-738.404) (-738.270) (-737.015) [-739.140] * (-736.556) (-740.001) [-736.408] (-735.631) -- 0:00:36
      377000 -- (-736.711) (-738.142) [-737.763] (-742.763) * (-736.768) (-740.038) [-737.325] (-738.375) -- 0:00:38
      377500 -- (-738.131) (-736.166) [-740.046] (-737.465) * (-737.164) [-738.635] (-744.317) (-737.205) -- 0:00:37
      378000 -- (-738.372) (-738.024) (-738.837) [-737.596] * (-739.177) (-737.780) [-739.447] (-736.390) -- 0:00:37
      378500 -- (-739.081) [-737.915] (-739.547) (-736.603) * (-738.231) (-738.541) (-739.073) [-736.580] -- 0:00:37
      379000 -- (-736.283) [-736.129] (-746.506) (-739.477) * (-735.923) (-741.874) [-736.530] (-743.114) -- 0:00:37
      379500 -- (-736.340) [-736.625] (-741.129) (-742.230) * [-736.445] (-737.305) (-738.367) (-737.302) -- 0:00:37
      380000 -- [-735.884] (-740.674) (-737.728) (-737.324) * (-737.272) (-737.474) [-738.623] (-736.274) -- 0:00:37

      Average standard deviation of split frequencies: 0.017131

      380500 -- (-736.780) [-736.473] (-739.060) (-738.475) * (-737.391) (-737.265) (-736.231) [-738.041] -- 0:00:37
      381000 -- [-737.200] (-736.129) (-737.459) (-736.933) * (-737.383) (-735.851) (-737.235) [-736.187] -- 0:00:37
      381500 -- (-737.302) [-738.913] (-735.854) (-737.108) * (-738.466) (-735.705) [-737.006] (-741.761) -- 0:00:37
      382000 -- [-737.208] (-737.177) (-738.771) (-737.599) * (-736.821) (-740.626) [-742.508] (-738.418) -- 0:00:37
      382500 -- (-740.025) [-736.314] (-736.603) (-739.137) * (-737.492) [-739.317] (-740.234) (-738.759) -- 0:00:37
      383000 -- (-737.701) (-738.745) (-738.602) [-737.598] * (-737.487) (-735.801) (-736.951) [-736.091] -- 0:00:37
      383500 -- [-736.560] (-742.023) (-737.445) (-737.300) * (-738.734) (-738.803) (-738.946) [-737.905] -- 0:00:36
      384000 -- [-739.115] (-738.273) (-737.075) (-737.422) * [-738.376] (-739.959) (-738.441) (-739.541) -- 0:00:36
      384500 -- (-738.584) (-738.839) [-736.664] (-739.378) * (-740.022) (-737.679) [-737.658] (-742.416) -- 0:00:36
      385000 -- [-739.255] (-739.209) (-736.396) (-739.606) * (-739.969) (-736.508) (-736.793) [-736.623] -- 0:00:36

      Average standard deviation of split frequencies: 0.017165

      385500 -- (-737.156) (-736.465) (-736.403) [-736.170] * [-740.730] (-737.109) (-737.382) (-739.824) -- 0:00:36
      386000 -- (-738.199) (-737.134) (-736.891) [-736.006] * [-738.817] (-736.966) (-737.850) (-739.550) -- 0:00:36
      386500 -- [-741.183] (-736.930) (-738.390) (-738.306) * (-737.330) (-736.879) (-735.889) [-737.614] -- 0:00:36
      387000 -- (-737.179) [-736.723] (-737.173) (-738.750) * (-738.407) (-737.326) [-739.784] (-736.564) -- 0:00:36
      387500 -- (-737.050) [-736.678] (-740.298) (-737.750) * [-739.053] (-740.381) (-739.767) (-736.795) -- 0:00:36
      388000 -- (-738.200) (-741.279) (-737.305) [-741.162] * (-741.047) [-740.542] (-738.366) (-739.989) -- 0:00:36
      388500 -- (-737.125) [-737.999] (-739.745) (-738.330) * [-740.301] (-737.624) (-737.950) (-738.554) -- 0:00:36
      389000 -- (-736.268) (-743.609) [-737.231] (-736.477) * (-739.405) (-740.892) [-738.950] (-745.093) -- 0:00:36
      389500 -- (-737.697) (-738.549) (-738.659) [-738.167] * (-741.440) [-737.785] (-737.267) (-741.448) -- 0:00:36
      390000 -- (-736.857) [-736.020] (-738.904) (-737.248) * (-736.697) [-736.698] (-739.593) (-741.254) -- 0:00:35

      Average standard deviation of split frequencies: 0.016759

      390500 -- [-737.919] (-736.561) (-736.035) (-736.024) * (-736.665) (-736.306) (-742.854) [-740.707] -- 0:00:35
      391000 -- [-738.604] (-736.519) (-736.542) (-741.609) * [-736.040] (-737.835) (-742.476) (-738.113) -- 0:00:35
      391500 -- (-739.603) [-738.368] (-741.560) (-739.130) * (-739.455) (-739.512) (-736.971) [-738.366] -- 0:00:35
      392000 -- (-739.815) (-736.179) (-740.886) [-736.167] * (-738.450) (-738.700) [-736.938] (-741.339) -- 0:00:35
      392500 -- [-737.636] (-736.786) (-741.365) (-736.922) * (-738.209) (-736.222) (-741.625) [-740.958] -- 0:00:35
      393000 -- (-736.688) (-736.381) (-737.041) [-739.375] * (-739.729) (-737.515) (-737.935) [-737.851] -- 0:00:35
      393500 -- (-738.098) [-736.397] (-738.870) (-739.242) * [-739.757] (-736.180) (-737.194) (-745.662) -- 0:00:35
      394000 -- (-737.266) [-736.440] (-740.051) (-736.058) * (-738.732) (-739.360) (-737.544) [-739.575] -- 0:00:36
      394500 -- (-737.041) [-738.592] (-741.862) (-735.851) * (-737.806) (-739.660) [-736.934] (-739.361) -- 0:00:36
      395000 -- [-736.322] (-737.366) (-739.296) (-741.732) * (-738.016) [-736.160] (-738.371) (-737.861) -- 0:00:36

      Average standard deviation of split frequencies: 0.017506

      395500 -- (-736.015) (-737.596) [-737.134] (-738.020) * (-737.119) (-737.317) [-736.350] (-743.487) -- 0:00:36
      396000 -- (-737.623) [-740.975] (-741.676) (-739.075) * (-736.380) (-736.109) [-740.454] (-737.680) -- 0:00:36
      396500 -- (-736.195) (-738.152) [-739.631] (-738.103) * (-737.714) (-736.815) [-737.317] (-739.616) -- 0:00:36
      397000 -- (-737.627) (-737.790) (-738.222) [-736.194] * [-737.459] (-738.464) (-737.531) (-738.534) -- 0:00:36
      397500 -- [-736.687] (-740.760) (-737.664) (-736.345) * (-736.271) [-739.326] (-737.742) (-736.987) -- 0:00:36
      398000 -- (-737.264) (-740.595) (-739.660) [-737.754] * (-741.059) (-737.839) (-741.177) [-736.679] -- 0:00:36
      398500 -- (-737.715) [-738.102] (-735.646) (-740.785) * (-738.562) (-740.234) (-738.406) [-736.311] -- 0:00:36
      399000 -- [-737.961] (-737.172) (-739.769) (-741.150) * [-738.608] (-743.900) (-738.633) (-735.600) -- 0:00:36
      399500 -- [-738.198] (-738.124) (-738.538) (-737.813) * (-738.263) (-741.428) (-736.941) [-735.712] -- 0:00:36
      400000 -- (-735.868) (-737.019) [-737.807] (-739.687) * (-737.581) [-740.767] (-738.745) (-736.984) -- 0:00:36

      Average standard deviation of split frequencies: 0.017717

      400500 -- (-737.778) (-740.184) (-736.732) [-740.281] * (-743.073) (-744.261) (-736.825) [-735.635] -- 0:00:35
      401000 -- (-738.419) [-736.540] (-736.665) (-737.145) * (-736.051) (-736.962) [-737.543] (-739.496) -- 0:00:35
      401500 -- (-736.427) [-736.599] (-738.104) (-738.020) * (-736.224) (-737.259) [-737.203] (-737.416) -- 0:00:35
      402000 -- (-736.876) [-738.281] (-738.096) (-740.358) * [-737.904] (-735.991) (-738.320) (-736.096) -- 0:00:35
      402500 -- (-738.333) (-737.139) [-737.323] (-738.151) * (-737.976) (-737.084) (-739.199) [-738.327] -- 0:00:35
      403000 -- (-737.532) [-736.971] (-736.787) (-738.498) * [-741.873] (-737.464) (-737.691) (-739.970) -- 0:00:35
      403500 -- (-738.606) (-736.485) (-739.272) [-735.845] * (-737.741) [-735.952] (-739.756) (-739.638) -- 0:00:35
      404000 -- (-738.484) (-736.331) [-739.245] (-736.607) * [-737.824] (-736.860) (-736.346) (-741.543) -- 0:00:35
      404500 -- (-738.491) [-739.040] (-736.429) (-737.192) * [-737.195] (-737.971) (-737.650) (-737.358) -- 0:00:35
      405000 -- [-736.726] (-736.466) (-737.461) (-738.197) * (-735.874) [-739.878] (-737.621) (-741.513) -- 0:00:35

      Average standard deviation of split frequencies: 0.017348

      405500 -- (-738.491) (-741.223) [-735.855] (-740.203) * (-736.328) [-736.187] (-739.526) (-746.415) -- 0:00:35
      406000 -- [-739.523] (-741.650) (-737.177) (-736.394) * (-737.848) [-736.493] (-737.281) (-740.133) -- 0:00:35
      406500 -- (-739.050) [-738.012] (-735.601) (-736.238) * [-741.015] (-738.434) (-736.978) (-738.553) -- 0:00:35
      407000 -- (-743.283) (-736.887) [-735.645] (-736.003) * (-741.996) (-738.890) (-736.689) [-738.474] -- 0:00:34
      407500 -- (-742.679) (-738.708) (-737.495) [-736.378] * (-741.488) (-738.369) [-740.878] (-738.452) -- 0:00:34
      408000 -- (-742.209) (-736.287) [-736.830] (-737.857) * (-741.225) (-738.382) (-738.426) [-738.203] -- 0:00:34
      408500 -- (-736.168) (-736.744) (-736.194) [-736.212] * (-741.862) (-737.830) [-736.194] (-737.590) -- 0:00:34
      409000 -- (-737.138) (-736.748) (-736.200) [-736.253] * (-738.610) [-739.101] (-740.158) (-738.075) -- 0:00:34
      409500 -- (-738.268) (-737.960) (-738.800) [-736.129] * [-736.816] (-736.234) (-736.412) (-738.404) -- 0:00:34
      410000 -- [-737.348] (-736.929) (-746.865) (-737.263) * [-737.168] (-737.682) (-736.304) (-737.083) -- 0:00:34

      Average standard deviation of split frequencies: 0.017421

      410500 -- (-738.958) [-743.213] (-737.640) (-737.735) * (-737.280) [-738.868] (-738.028) (-736.004) -- 0:00:35
      411000 -- (-741.408) (-736.339) (-737.008) [-738.005] * (-738.219) (-738.579) [-737.453] (-738.253) -- 0:00:35
      411500 -- (-741.893) (-739.058) (-736.811) [-736.195] * (-740.028) (-738.538) [-739.212] (-740.732) -- 0:00:35
      412000 -- (-742.645) (-742.899) [-737.314] (-736.182) * [-738.022] (-737.191) (-737.555) (-736.574) -- 0:00:35
      412500 -- [-738.624] (-739.101) (-736.797) (-736.182) * (-737.763) [-736.497] (-736.419) (-736.733) -- 0:00:35
      413000 -- (-740.963) [-739.763] (-736.648) (-737.917) * (-738.811) [-735.986] (-736.560) (-737.122) -- 0:00:35
      413500 -- (-742.000) (-737.764) (-738.926) [-735.680] * [-737.250] (-737.509) (-736.578) (-740.319) -- 0:00:35
      414000 -- (-737.807) (-741.429) [-737.971] (-738.418) * (-738.835) (-740.542) [-737.017] (-739.085) -- 0:00:35
      414500 -- (-736.848) (-739.375) (-736.565) [-738.109] * (-736.272) (-736.559) (-738.965) [-746.661] -- 0:00:35
      415000 -- (-737.682) (-740.659) [-736.638] (-738.996) * [-736.284] (-737.712) (-738.800) (-738.217) -- 0:00:35

      Average standard deviation of split frequencies: 0.017264

      415500 -- [-739.642] (-736.822) (-737.813) (-736.227) * (-735.908) [-736.585] (-739.553) (-736.949) -- 0:00:35
      416000 -- (-739.456) (-736.912) (-742.077) [-737.847] * [-737.475] (-738.574) (-736.350) (-738.059) -- 0:00:35
      416500 -- [-737.479] (-736.373) (-738.875) (-735.715) * (-735.883) (-736.588) (-736.327) [-738.350] -- 0:00:35
      417000 -- [-742.066] (-736.998) (-737.934) (-735.719) * (-737.461) (-738.125) (-737.465) [-737.354] -- 0:00:34
      417500 -- (-738.496) (-737.437) (-736.413) [-736.223] * (-736.758) [-738.134] (-738.009) (-739.802) -- 0:00:34
      418000 -- (-737.346) [-737.709] (-737.631) (-737.223) * (-736.897) (-737.438) [-737.729] (-735.989) -- 0:00:34
      418500 -- (-739.643) [-735.923] (-737.294) (-736.663) * (-738.510) [-737.223] (-738.971) (-737.016) -- 0:00:34
      419000 -- (-736.465) [-738.124] (-736.197) (-736.401) * [-737.508] (-738.945) (-742.748) (-739.996) -- 0:00:34
      419500 -- (-740.566) (-743.855) (-736.430) [-736.927] * (-738.537) [-736.168] (-744.570) (-740.986) -- 0:00:34
      420000 -- (-737.640) (-736.658) [-736.852] (-739.801) * [-735.687] (-738.629) (-741.562) (-737.016) -- 0:00:34

      Average standard deviation of split frequencies: 0.017370

      420500 -- (-736.792) [-736.795] (-737.812) (-743.480) * (-742.022) (-740.121) (-738.519) [-738.067] -- 0:00:34
      421000 -- (-741.786) (-737.543) [-739.918] (-736.425) * (-741.546) (-742.060) [-737.059] (-746.001) -- 0:00:34
      421500 -- (-737.857) (-737.655) [-739.141] (-737.566) * (-739.336) (-737.302) [-737.279] (-739.529) -- 0:00:34
      422000 -- [-738.186] (-739.986) (-737.426) (-735.778) * (-741.491) [-735.623] (-737.399) (-740.998) -- 0:00:34
      422500 -- (-738.438) (-737.711) (-737.176) [-738.741] * [-740.548] (-739.437) (-736.732) (-738.463) -- 0:00:34
      423000 -- (-740.341) (-736.679) [-736.715] (-736.894) * [-737.535] (-738.315) (-737.187) (-737.212) -- 0:00:34
      423500 -- (-737.230) (-737.463) [-741.411] (-739.579) * (-736.900) (-736.320) (-737.123) [-738.832] -- 0:00:34
      424000 -- (-741.663) (-738.032) [-739.037] (-737.829) * [-737.177] (-738.103) (-735.806) (-736.808) -- 0:00:33
      424500 -- (-738.075) (-736.671) (-738.108) [-737.279] * [-736.793] (-738.288) (-738.928) (-736.886) -- 0:00:33
      425000 -- [-737.150] (-736.676) (-737.933) (-742.972) * [-735.669] (-738.815) (-739.954) (-743.894) -- 0:00:33

      Average standard deviation of split frequencies: 0.017705

      425500 -- (-736.527) (-736.259) [-737.137] (-736.898) * [-740.735] (-743.711) (-743.032) (-739.519) -- 0:00:33
      426000 -- (-736.239) (-740.832) (-736.569) [-738.143] * (-737.455) (-738.159) (-744.890) [-737.470] -- 0:00:33
      426500 -- (-737.585) (-739.128) (-740.614) [-735.887] * (-737.110) [-738.657] (-737.109) (-737.403) -- 0:00:33
      427000 -- (-739.307) (-738.229) [-740.750] (-736.734) * [-737.860] (-739.648) (-739.141) (-737.763) -- 0:00:33
      427500 -- (-738.332) (-738.839) [-737.738] (-739.368) * (-736.740) (-737.027) [-739.148] (-736.942) -- 0:00:34
      428000 -- (-739.274) (-745.154) [-738.366] (-741.289) * (-738.681) (-737.011) [-736.433] (-739.094) -- 0:00:34
      428500 -- (-738.187) [-739.071] (-737.502) (-737.457) * (-739.576) (-740.444) (-737.184) [-739.323] -- 0:00:34
      429000 -- (-742.098) (-739.407) [-740.071] (-739.088) * (-737.340) [-736.319] (-738.042) (-737.050) -- 0:00:34
      429500 -- (-740.784) [-738.768] (-740.131) (-738.317) * (-737.271) (-737.785) [-736.814] (-736.162) -- 0:00:34
      430000 -- (-739.792) [-736.937] (-736.118) (-736.711) * (-738.194) (-737.367) (-736.659) [-736.908] -- 0:00:34

      Average standard deviation of split frequencies: 0.017642

      430500 -- (-737.247) (-736.319) (-741.562) [-741.110] * (-736.345) (-737.166) (-740.483) [-735.897] -- 0:00:34
      431000 -- (-738.306) (-736.265) [-736.871] (-739.976) * (-740.105) (-739.689) (-737.078) [-735.607] -- 0:00:34
      431500 -- (-738.171) (-737.108) (-737.273) [-739.050] * [-737.427] (-743.806) (-738.360) (-736.049) -- 0:00:34
      432000 -- (-736.339) [-735.989] (-737.915) (-741.588) * (-736.686) (-737.393) [-739.495] (-735.972) -- 0:00:34
      432500 -- [-738.184] (-740.119) (-739.787) (-737.227) * (-736.497) (-741.100) (-741.673) [-738.447] -- 0:00:34
      433000 -- [-738.162] (-740.910) (-746.057) (-739.159) * (-736.168) [-737.139] (-736.485) (-739.240) -- 0:00:34
      433500 -- (-738.964) (-739.140) [-739.490] (-738.040) * (-742.032) [-739.805] (-737.057) (-738.308) -- 0:00:33
      434000 -- [-739.681] (-739.282) (-737.656) (-739.293) * (-738.929) (-737.809) [-736.341] (-737.306) -- 0:00:33
      434500 -- (-737.880) (-737.410) [-736.819] (-738.307) * [-736.438] (-738.297) (-736.446) (-736.930) -- 0:00:33
      435000 -- (-736.037) [-736.540] (-736.639) (-739.050) * [-737.758] (-740.196) (-739.181) (-738.152) -- 0:00:33

      Average standard deviation of split frequencies: 0.016790

      435500 -- (-737.334) [-738.272] (-739.330) (-740.523) * (-736.705) [-737.815] (-738.733) (-736.998) -- 0:00:33
      436000 -- (-739.219) (-738.462) (-737.289) [-738.285] * [-737.341] (-738.628) (-746.893) (-741.239) -- 0:00:33
      436500 -- (-735.969) (-739.521) (-737.860) [-736.356] * (-737.739) (-737.921) [-738.934] (-736.877) -- 0:00:33
      437000 -- (-738.411) (-737.992) (-736.517) [-738.337] * (-737.298) [-737.590] (-740.426) (-736.933) -- 0:00:33
      437500 -- (-738.073) [-736.674] (-737.034) (-736.691) * (-737.411) (-738.925) [-737.275] (-736.774) -- 0:00:33
      438000 -- (-737.143) [-738.213] (-738.277) (-739.187) * (-738.318) (-738.541) (-736.097) [-739.647] -- 0:00:33
      438500 -- [-737.773] (-742.815) (-736.817) (-740.450) * (-739.056) [-739.493] (-737.223) (-738.065) -- 0:00:33
      439000 -- (-736.250) (-738.293) [-736.211] (-740.034) * (-737.702) [-737.442] (-737.456) (-738.155) -- 0:00:33
      439500 -- (-739.429) (-737.720) [-736.281] (-739.383) * (-738.736) [-736.930] (-736.596) (-740.877) -- 0:00:33
      440000 -- (-744.730) (-736.285) (-737.576) [-738.564] * (-735.954) (-739.078) [-738.905] (-737.188) -- 0:00:33

      Average standard deviation of split frequencies: 0.016424

      440500 -- (-743.949) [-740.023] (-736.558) (-741.326) * (-737.508) (-744.219) (-738.799) [-737.530] -- 0:00:33
      441000 -- (-744.032) (-742.817) (-736.160) [-738.252] * (-739.865) [-738.270] (-737.485) (-738.379) -- 0:00:32
      441500 -- (-739.770) [-737.811] (-736.446) (-740.145) * (-737.039) [-738.853] (-739.365) (-740.663) -- 0:00:32
      442000 -- (-737.157) (-737.165) [-738.659] (-740.222) * (-736.647) (-740.189) (-739.034) [-736.370] -- 0:00:32
      442500 -- (-736.463) [-735.555] (-742.046) (-740.102) * (-738.702) [-737.191] (-736.166) (-738.085) -- 0:00:32
      443000 -- (-736.516) (-741.019) (-744.514) [-739.048] * (-738.571) (-736.213) (-739.537) [-736.216] -- 0:00:32
      443500 -- [-736.992] (-741.004) (-735.876) (-741.384) * [-735.741] (-737.296) (-740.093) (-737.720) -- 0:00:32
      444000 -- (-743.473) (-741.315) [-740.400] (-741.420) * [-735.808] (-737.494) (-738.533) (-737.957) -- 0:00:32
      444500 -- (-739.115) (-739.162) (-736.732) [-740.930] * (-736.319) (-740.914) (-739.348) [-736.714] -- 0:00:33
      445000 -- (-738.751) [-737.501] (-738.944) (-738.672) * [-737.358] (-739.633) (-736.297) (-736.300) -- 0:00:33

      Average standard deviation of split frequencies: 0.015326

      445500 -- (-737.962) [-737.909] (-737.880) (-738.565) * (-739.440) (-736.263) (-740.112) [-736.178] -- 0:00:33
      446000 -- (-740.260) [-743.682] (-736.955) (-736.087) * (-738.439) [-736.910] (-736.785) (-736.280) -- 0:00:33
      446500 -- (-740.636) (-738.862) [-738.059] (-736.720) * (-742.180) [-739.009] (-736.795) (-736.371) -- 0:00:33
      447000 -- [-738.421] (-740.396) (-739.644) (-736.689) * [-736.645] (-738.509) (-737.141) (-737.498) -- 0:00:33
      447500 -- (-736.919) [-737.848] (-737.184) (-737.946) * (-739.690) (-738.878) (-738.479) [-736.480] -- 0:00:33
      448000 -- (-737.633) [-736.952] (-736.007) (-739.903) * (-737.463) (-741.731) (-738.277) [-740.152] -- 0:00:33
      448500 -- (-739.037) (-738.189) (-737.014) [-737.692] * (-737.141) (-740.360) [-738.421] (-738.491) -- 0:00:33
      449000 -- [-737.665] (-736.750) (-738.268) (-739.935) * (-738.661) (-742.261) (-739.047) [-739.485] -- 0:00:33
      449500 -- (-741.352) [-740.033] (-738.365) (-738.506) * [-737.841] (-737.763) (-737.515) (-738.833) -- 0:00:33
      450000 -- (-737.888) (-739.369) [-737.874] (-737.671) * [-737.908] (-737.464) (-738.136) (-738.619) -- 0:00:33

      Average standard deviation of split frequencies: 0.015051

      450500 -- (-740.847) (-740.746) (-739.259) [-736.788] * (-738.319) (-737.303) [-735.854] (-739.852) -- 0:00:32
      451000 -- (-739.577) (-744.436) [-740.367] (-735.787) * (-741.748) (-736.087) (-738.236) [-736.043] -- 0:00:32
      451500 -- (-737.761) (-738.611) [-736.831] (-735.785) * (-741.915) [-740.537] (-739.830) (-736.090) -- 0:00:32
      452000 -- (-736.354) [-736.708] (-739.707) (-737.963) * (-737.537) (-746.790) (-738.442) [-738.016] -- 0:00:32
      452500 -- [-737.493] (-736.933) (-743.993) (-736.896) * (-735.962) [-738.078] (-738.716) (-737.028) -- 0:00:32
      453000 -- [-737.496] (-741.150) (-739.033) (-735.917) * (-735.829) (-738.660) (-740.332) [-737.164] -- 0:00:32
      453500 -- [-737.538] (-738.706) (-739.887) (-738.728) * [-735.489] (-737.970) (-738.498) (-738.045) -- 0:00:32
      454000 -- (-739.219) [-739.014] (-739.348) (-739.950) * (-736.746) [-739.144] (-745.252) (-740.158) -- 0:00:32
      454500 -- [-740.880] (-739.687) (-739.067) (-738.949) * (-738.789) [-737.090] (-737.213) (-736.835) -- 0:00:32
      455000 -- (-737.056) (-741.632) [-737.468] (-740.988) * [-739.965] (-738.510) (-738.720) (-742.071) -- 0:00:32

      Average standard deviation of split frequencies: 0.015794

      455500 -- (-736.676) (-736.066) (-740.448) [-739.093] * (-735.992) [-736.988] (-739.421) (-736.155) -- 0:00:32
      456000 -- (-742.041) (-737.046) (-736.344) [-738.067] * [-740.223] (-741.728) (-738.071) (-737.485) -- 0:00:32
      456500 -- [-738.656] (-736.817) (-740.285) (-739.265) * [-739.583] (-740.823) (-739.792) (-737.829) -- 0:00:32
      457000 -- [-737.401] (-736.420) (-736.727) (-740.832) * (-738.080) (-738.992) [-737.204] (-739.709) -- 0:00:32
      457500 -- (-737.118) (-738.495) [-737.699] (-740.912) * (-737.182) (-737.243) [-736.387] (-739.318) -- 0:00:32
      458000 -- (-738.523) (-740.700) [-738.760] (-738.202) * (-736.584) (-737.709) (-738.147) [-737.539] -- 0:00:31
      458500 -- [-740.620] (-737.411) (-737.292) (-737.623) * (-737.192) [-737.576] (-737.809) (-737.806) -- 0:00:31
      459000 -- (-738.865) [-739.375] (-738.894) (-736.240) * (-736.975) (-740.013) [-738.039] (-741.626) -- 0:00:31
      459500 -- [-736.635] (-736.184) (-739.108) (-737.589) * (-736.187) [-738.862] (-740.348) (-739.163) -- 0:00:31
      460000 -- (-736.484) [-736.373] (-737.178) (-737.334) * (-738.249) [-739.119] (-738.617) (-739.865) -- 0:00:31

      Average standard deviation of split frequencies: 0.016313

      460500 -- (-736.392) [-738.601] (-743.725) (-737.199) * (-737.009) (-735.808) (-740.035) [-739.216] -- 0:00:31
      461000 -- [-736.164] (-739.641) (-739.038) (-735.946) * [-738.479] (-735.738) (-741.343) (-741.374) -- 0:00:32
      461500 -- (-736.381) [-738.461] (-736.895) (-737.330) * (-738.484) [-737.389] (-736.949) (-741.843) -- 0:00:32
      462000 -- (-739.582) (-738.094) (-737.137) [-739.135] * (-738.994) [-737.388] (-738.981) (-740.871) -- 0:00:32
      462500 -- (-737.205) (-740.517) [-738.679] (-738.445) * (-737.546) (-736.612) (-736.935) [-737.199] -- 0:00:32
      463000 -- (-736.837) (-736.600) (-739.468) [-735.549] * (-738.543) [-738.295] (-739.094) (-740.151) -- 0:00:32
      463500 -- (-736.177) (-737.257) [-738.320] (-737.842) * (-742.613) (-739.622) [-736.376] (-740.418) -- 0:00:32
      464000 -- (-738.829) [-738.636] (-737.877) (-740.090) * (-737.071) [-736.018] (-737.835) (-743.708) -- 0:00:32
      464500 -- (-736.431) [-737.640] (-736.269) (-740.687) * (-737.856) (-737.847) [-741.748] (-737.209) -- 0:00:32
      465000 -- [-738.462] (-738.367) (-736.553) (-743.627) * (-736.362) (-736.125) (-739.153) [-737.575] -- 0:00:32

      Average standard deviation of split frequencies: 0.015769

      465500 -- (-738.931) (-737.665) (-736.568) [-738.794] * (-737.717) (-738.421) (-738.078) [-744.624] -- 0:00:32
      466000 -- (-738.280) (-738.913) (-738.143) [-737.790] * (-738.915) (-737.523) (-735.952) [-740.261] -- 0:00:32
      466500 -- (-737.772) (-738.022) [-740.267] (-736.965) * [-738.396] (-738.701) (-738.545) (-737.483) -- 0:00:32
      467000 -- [-736.623] (-744.293) (-737.691) (-736.610) * [-737.608] (-737.006) (-737.055) (-738.715) -- 0:00:31
      467500 -- (-737.014) [-739.277] (-738.079) (-741.905) * (-737.325) (-737.430) (-745.349) [-736.595] -- 0:00:31
      468000 -- (-740.710) [-738.180] (-737.117) (-737.639) * (-739.860) [-737.417] (-737.250) (-735.531) -- 0:00:31
      468500 -- (-737.067) [-736.848] (-735.744) (-742.927) * [-736.096] (-740.690) (-737.983) (-739.428) -- 0:00:31
      469000 -- (-739.403) (-737.881) (-736.304) [-737.123] * [-736.775] (-738.003) (-741.987) (-737.709) -- 0:00:31
      469500 -- [-738.319] (-738.755) (-736.704) (-739.880) * [-739.453] (-737.552) (-738.766) (-742.242) -- 0:00:31
      470000 -- [-738.269] (-737.221) (-739.227) (-736.499) * (-738.216) (-740.737) (-737.460) [-736.981] -- 0:00:31

      Average standard deviation of split frequencies: 0.016202

      470500 -- [-743.830] (-736.238) (-739.562) (-736.997) * (-736.024) (-738.525) [-740.126] (-736.096) -- 0:00:31
      471000 -- (-737.777) (-738.546) [-740.693] (-739.355) * (-740.371) (-736.644) (-740.901) [-736.977] -- 0:00:31
      471500 -- (-738.344) (-737.382) (-736.060) [-738.037] * [-736.549] (-736.635) (-739.892) (-736.894) -- 0:00:31
      472000 -- [-739.223] (-737.046) (-740.363) (-741.648) * (-736.657) (-737.759) (-738.505) [-742.301] -- 0:00:31
      472500 -- (-738.045) (-737.056) (-738.879) [-737.254] * [-737.251] (-735.563) (-735.900) (-736.527) -- 0:00:31
      473000 -- (-738.955) [-736.164] (-742.048) (-737.444) * (-736.490) (-735.649) [-735.853] (-736.743) -- 0:00:31
      473500 -- (-745.142) (-738.935) (-735.944) [-738.363] * [-736.879] (-736.014) (-736.243) (-736.391) -- 0:00:31
      474000 -- [-737.001] (-737.859) (-738.486) (-736.133) * [-737.159] (-735.761) (-740.288) (-736.465) -- 0:00:31
      474500 -- (-737.381) [-737.535] (-746.110) (-737.623) * (-738.635) [-736.346] (-737.425) (-737.495) -- 0:00:31
      475000 -- [-737.331] (-740.411) (-738.755) (-736.705) * (-739.415) [-738.960] (-739.016) (-740.592) -- 0:00:30

      Average standard deviation of split frequencies: 0.015787

      475500 -- (-736.315) (-738.049) (-737.021) [-736.390] * (-735.682) (-737.861) (-739.197) [-739.793] -- 0:00:30
      476000 -- (-738.821) (-737.627) [-736.303] (-739.898) * (-737.032) (-738.158) [-738.539] (-740.767) -- 0:00:30
      476500 -- (-738.031) [-737.610] (-737.257) (-736.018) * (-736.843) (-737.706) (-737.690) [-740.048] -- 0:00:30
      477000 -- (-736.387) (-741.491) [-736.328] (-737.578) * (-738.460) (-739.243) (-739.282) [-738.031] -- 0:00:30
      477500 -- (-737.514) (-736.133) [-736.770] (-739.045) * (-738.295) (-738.755) (-738.352) [-736.818] -- 0:00:31
      478000 -- (-739.829) (-737.522) [-737.649] (-735.989) * [-739.459] (-737.876) (-739.607) (-737.807) -- 0:00:31
      478500 -- (-737.410) (-735.533) [-737.599] (-736.338) * [-738.171] (-737.506) (-737.237) (-737.580) -- 0:00:31
      479000 -- (-740.643) (-736.374) (-749.107) [-736.634] * (-738.684) (-737.920) (-741.727) [-736.289] -- 0:00:31
      479500 -- (-739.504) (-741.076) (-739.582) [-739.148] * (-740.414) (-737.496) (-745.076) [-736.036] -- 0:00:31
      480000 -- (-737.147) (-738.492) (-742.077) [-737.700] * (-736.647) [-737.194] (-737.599) (-737.823) -- 0:00:31

      Average standard deviation of split frequencies: 0.015519

      480500 -- (-740.407) [-739.309] (-737.687) (-736.699) * (-737.885) [-735.898] (-737.708) (-738.456) -- 0:00:31
      481000 -- (-738.813) (-740.227) [-739.028] (-737.320) * (-737.267) (-738.545) [-736.829] (-735.721) -- 0:00:31
      481500 -- (-738.519) [-736.705] (-737.769) (-736.745) * (-737.903) [-737.598] (-735.979) (-738.316) -- 0:00:31
      482000 -- (-738.164) (-741.091) (-739.780) [-736.641] * [-738.441] (-736.653) (-738.388) (-738.914) -- 0:00:31
      482500 -- (-738.234) (-736.585) [-737.536] (-742.695) * (-738.139) (-740.957) [-736.180] (-738.882) -- 0:00:31
      483000 -- [-740.527] (-735.937) (-736.158) (-735.939) * (-735.824) (-741.312) [-736.295] (-736.608) -- 0:00:31
      483500 -- [-736.778] (-735.630) (-737.920) (-736.103) * [-737.543] (-738.244) (-740.119) (-736.925) -- 0:00:30
      484000 -- (-737.086) [-738.941] (-741.787) (-736.037) * (-740.810) (-740.549) (-740.514) [-736.782] -- 0:00:30
      484500 -- (-740.659) (-737.117) (-738.380) [-736.933] * (-739.012) (-737.502) (-739.784) [-736.048] -- 0:00:30
      485000 -- (-738.321) [-735.933] (-737.461) (-742.621) * (-740.610) [-738.270] (-737.361) (-736.974) -- 0:00:30

      Average standard deviation of split frequencies: 0.015862

      485500 -- [-737.095] (-736.651) (-738.393) (-738.916) * [-738.295] (-741.365) (-736.511) (-737.280) -- 0:00:30
      486000 -- (-736.449) [-738.046] (-736.240) (-738.498) * (-743.038) (-740.384) (-737.795) [-739.679] -- 0:00:30
      486500 -- (-736.309) [-736.366] (-735.764) (-738.548) * (-739.208) (-741.652) (-735.642) [-737.053] -- 0:00:30
      487000 -- (-738.646) [-738.577] (-736.700) (-738.776) * (-739.803) (-736.351) [-735.760] (-737.983) -- 0:00:30
      487500 -- (-739.053) [-737.717] (-737.414) (-738.005) * (-739.827) (-736.868) (-738.378) [-738.683] -- 0:00:30
      488000 -- (-737.745) (-740.285) [-742.429] (-736.720) * (-739.210) (-740.402) (-738.358) [-740.396] -- 0:00:30
      488500 -- (-738.372) (-736.838) [-737.350] (-737.979) * [-736.051] (-736.034) (-743.319) (-736.020) -- 0:00:30
      489000 -- (-737.510) (-737.415) [-736.363] (-737.222) * [-739.489] (-736.672) (-739.225) (-736.020) -- 0:00:30
      489500 -- [-741.372] (-737.096) (-738.167) (-737.740) * [-736.614] (-738.179) (-745.602) (-736.299) -- 0:00:30
      490000 -- (-737.599) (-738.097) (-736.727) [-737.450] * [-736.935] (-738.543) (-740.709) (-738.464) -- 0:00:30

      Average standard deviation of split frequencies: 0.015937

      490500 -- (-739.107) (-738.653) (-736.623) [-736.419] * [-737.678] (-738.246) (-736.705) (-739.027) -- 0:00:30
      491000 -- [-738.275] (-739.421) (-739.551) (-738.528) * (-736.844) (-738.728) [-738.429] (-740.531) -- 0:00:30
      491500 -- (-739.911) [-739.296] (-738.091) (-736.727) * (-735.820) (-737.987) [-735.895] (-738.678) -- 0:00:30
      492000 -- (-744.063) [-737.758] (-738.973) (-739.155) * [-742.139] (-743.435) (-737.887) (-738.930) -- 0:00:29
      492500 -- (-737.861) [-738.094] (-743.096) (-738.700) * (-737.668) [-738.887] (-736.483) (-738.070) -- 0:00:29
      493000 -- (-737.958) (-741.091) (-743.939) [-741.006] * (-736.897) (-738.883) (-740.022) [-735.862] -- 0:00:29
      493500 -- [-739.467] (-737.438) (-737.297) (-740.398) * (-737.045) (-737.410) (-738.859) [-736.840] -- 0:00:29
      494000 -- [-737.728] (-738.441) (-737.104) (-737.326) * (-736.971) (-738.626) [-735.659] (-737.048) -- 0:00:29
      494500 -- (-744.565) [-737.901] (-739.212) (-738.293) * (-740.368) (-738.644) [-737.411] (-738.282) -- 0:00:30
      495000 -- (-740.797) [-738.610] (-738.108) (-738.388) * [-739.392] (-737.645) (-737.144) (-738.108) -- 0:00:30

      Average standard deviation of split frequencies: 0.015877

      495500 -- (-739.431) [-737.025] (-738.978) (-741.731) * (-736.873) [-736.765] (-737.071) (-741.031) -- 0:00:30
      496000 -- (-737.052) (-736.004) (-737.556) [-738.995] * (-738.188) (-738.323) [-736.252] (-736.926) -- 0:00:30
      496500 -- (-740.249) (-737.912) (-737.216) [-737.971] * (-740.279) (-739.769) [-735.799] (-741.390) -- 0:00:30
      497000 -- (-737.760) [-738.982] (-739.307) (-735.635) * (-739.601) [-739.147] (-736.371) (-738.886) -- 0:00:30
      497500 -- (-737.050) [-737.432] (-737.255) (-735.899) * (-735.677) (-738.181) (-736.430) [-736.602] -- 0:00:30
      498000 -- (-739.640) (-740.474) [-735.954] (-738.077) * (-739.944) [-740.916] (-738.692) (-738.003) -- 0:00:30
      498500 -- (-737.776) (-737.749) (-738.149) [-736.001] * (-737.561) (-738.052) [-737.658] (-735.993) -- 0:00:30
      499000 -- (-743.112) (-736.340) [-737.788] (-737.017) * (-736.040) (-737.423) [-737.929] (-737.257) -- 0:00:30
      499500 -- [-740.674] (-737.355) (-737.174) (-738.535) * (-738.379) [-737.692] (-738.647) (-736.812) -- 0:00:30
      500000 -- (-741.199) [-737.241] (-736.240) (-738.854) * (-737.538) (-740.511) [-740.498] (-737.310) -- 0:00:30

      Average standard deviation of split frequencies: 0.015065

      500500 -- (-736.645) [-736.301] (-737.033) (-735.997) * [-737.538] (-736.933) (-737.178) (-737.974) -- 0:00:29
      501000 -- (-736.333) (-737.493) (-737.795) [-736.360] * (-737.576) (-739.693) [-737.481] (-737.319) -- 0:00:29
      501500 -- (-737.579) (-737.750) [-737.135] (-736.861) * (-738.055) [-737.303] (-737.797) (-736.521) -- 0:00:29
      502000 -- (-739.274) (-738.134) (-737.055) [-737.232] * (-738.541) [-736.282] (-736.711) (-736.671) -- 0:00:29
      502500 -- [-737.129] (-737.638) (-737.791) (-736.713) * [-737.936] (-736.828) (-744.529) (-737.102) -- 0:00:29
      503000 -- (-736.410) [-738.568] (-745.327) (-737.009) * (-739.027) [-739.447] (-743.349) (-739.802) -- 0:00:29
      503500 -- (-736.964) [-738.568] (-740.410) (-736.119) * (-741.358) (-740.324) (-738.179) [-736.958] -- 0:00:29
      504000 -- (-738.221) [-738.568] (-739.509) (-737.413) * (-738.519) (-738.754) [-739.304] (-741.977) -- 0:00:29
      504500 -- (-738.667) [-736.412] (-738.206) (-743.092) * (-739.603) (-741.209) [-736.200] (-736.129) -- 0:00:29
      505000 -- (-736.563) [-736.662] (-736.867) (-743.038) * (-738.715) (-737.414) [-736.927] (-738.262) -- 0:00:29

      Average standard deviation of split frequencies: 0.015673

      505500 -- (-740.915) (-738.774) [-736.027] (-737.070) * (-736.117) (-740.010) [-736.543] (-738.800) -- 0:00:29
      506000 -- (-736.334) (-736.821) [-736.945] (-735.701) * (-737.651) (-739.286) (-736.555) [-738.568] -- 0:00:29
      506500 -- (-736.338) [-737.417] (-740.036) (-736.925) * (-737.289) [-736.651] (-737.070) (-742.455) -- 0:00:29
      507000 -- [-736.510] (-737.516) (-739.094) (-736.313) * (-737.270) [-736.803] (-744.598) (-738.699) -- 0:00:29
      507500 -- (-736.735) (-738.839) [-736.026] (-736.798) * (-740.619) [-736.583] (-741.513) (-744.923) -- 0:00:29
      508000 -- (-739.608) (-738.041) [-736.056] (-737.757) * (-743.660) [-736.332] (-743.849) (-738.566) -- 0:00:29
      508500 -- [-738.865] (-745.287) (-735.602) (-738.392) * (-739.192) (-738.063) [-737.682] (-737.988) -- 0:00:28
      509000 -- [-737.446] (-743.298) (-736.441) (-738.790) * (-736.978) [-738.123] (-741.838) (-739.509) -- 0:00:28
      509500 -- (-737.170) [-740.352] (-738.590) (-736.955) * (-738.441) (-740.342) (-736.034) [-735.864] -- 0:00:28
      510000 -- (-736.138) (-736.825) [-737.969] (-737.153) * (-740.976) (-737.170) (-737.619) [-737.971] -- 0:00:28

      Average standard deviation of split frequencies: 0.015476

      510500 -- [-736.454] (-736.690) (-736.451) (-739.516) * (-740.341) [-740.596] (-738.495) (-739.508) -- 0:00:28
      511000 -- (-737.886) [-740.673] (-736.448) (-737.682) * [-736.759] (-739.948) (-741.210) (-738.762) -- 0:00:29
      511500 -- (-736.946) (-736.716) (-737.454) [-737.066] * (-738.525) (-737.150) [-737.329] (-737.850) -- 0:00:29
      512000 -- [-736.233] (-736.385) (-736.115) (-736.750) * (-741.207) (-738.093) (-737.275) [-737.557] -- 0:00:29
      512500 -- (-736.222) (-737.194) (-735.800) [-737.738] * [-742.982] (-738.707) (-741.526) (-735.751) -- 0:00:29
      513000 -- (-736.873) [-737.363] (-737.047) (-735.746) * (-739.103) (-741.489) [-736.062] (-736.952) -- 0:00:29
      513500 -- (-737.022) (-735.738) [-736.240] (-737.734) * (-737.994) [-737.140] (-739.089) (-737.781) -- 0:00:29
      514000 -- (-737.190) (-737.245) [-737.352] (-736.759) * [-736.400] (-740.598) (-738.750) (-741.565) -- 0:00:29
      514500 -- (-736.743) (-742.341) [-736.461] (-737.144) * (-740.347) (-744.374) [-738.439] (-741.646) -- 0:00:29
      515000 -- (-739.428) (-740.486) (-736.069) [-737.283] * [-738.429] (-741.074) (-743.972) (-737.971) -- 0:00:29

      Average standard deviation of split frequencies: 0.016122

      515500 -- (-738.449) (-738.537) [-737.483] (-736.612) * (-739.799) (-741.050) [-744.239] (-740.213) -- 0:00:29
      516000 -- (-738.632) [-736.125] (-738.107) (-736.109) * [-736.399] (-737.373) (-739.026) (-739.889) -- 0:00:29
      516500 -- (-740.821) (-738.021) (-738.511) [-736.378] * (-737.744) [-737.494] (-740.654) (-738.082) -- 0:00:29
      517000 -- (-738.035) [-737.129] (-738.550) (-736.580) * [-739.314] (-739.627) (-741.359) (-738.928) -- 0:00:28
      517500 -- (-740.681) (-738.811) (-736.626) [-736.428] * (-740.003) [-738.925] (-738.520) (-739.993) -- 0:00:28
      518000 -- (-738.583) [-740.886] (-737.335) (-737.008) * (-737.695) (-740.556) (-740.401) [-736.766] -- 0:00:28
      518500 -- [-738.629] (-739.721) (-738.355) (-736.268) * (-737.715) (-738.307) (-743.444) [-738.076] -- 0:00:28
      519000 -- (-741.654) (-737.160) (-741.199) [-736.664] * (-737.651) (-740.884) (-737.743) [-736.240] -- 0:00:28
      519500 -- (-738.895) (-739.760) [-738.942] (-738.114) * [-739.579] (-736.555) (-740.594) (-737.303) -- 0:00:28
      520000 -- (-738.984) (-738.482) [-742.397] (-737.251) * (-737.223) (-736.312) (-740.338) [-738.444] -- 0:00:28

      Average standard deviation of split frequencies: 0.015764

      520500 -- [-737.536] (-741.594) (-739.235) (-735.754) * [-738.076] (-738.893) (-738.560) (-739.643) -- 0:00:28
      521000 -- (-737.401) (-737.189) [-740.383] (-737.190) * [-737.206] (-739.785) (-738.180) (-738.990) -- 0:00:28
      521500 -- (-736.025) [-736.366] (-741.961) (-736.232) * (-738.701) (-741.047) (-738.625) [-736.057] -- 0:00:28
      522000 -- [-736.578] (-736.724) (-738.472) (-741.924) * (-741.627) [-738.224] (-743.679) (-737.525) -- 0:00:28
      522500 -- (-736.059) (-736.948) [-736.037] (-736.731) * (-740.489) (-737.801) (-738.577) [-741.249] -- 0:00:28
      523000 -- (-736.802) [-736.627] (-738.659) (-737.244) * [-737.995] (-739.795) (-742.514) (-740.136) -- 0:00:28
      523500 -- (-737.617) [-735.725] (-738.777) (-736.119) * [-738.563] (-737.315) (-738.642) (-741.108) -- 0:00:28
      524000 -- [-737.156] (-739.111) (-739.416) (-736.286) * [-737.995] (-737.899) (-738.459) (-738.148) -- 0:00:28
      524500 -- (-740.103) [-736.174] (-736.229) (-736.303) * [-736.507] (-738.533) (-738.386) (-737.992) -- 0:00:28
      525000 -- (-736.512) (-737.933) (-737.677) [-737.175] * (-735.945) (-739.591) (-737.796) [-737.245] -- 0:00:28

      Average standard deviation of split frequencies: 0.015833

      525500 -- (-739.168) [-738.778] (-739.941) (-736.798) * (-743.882) (-739.596) (-738.135) [-736.928] -- 0:00:27
      526000 -- (-737.024) [-737.669] (-738.140) (-736.877) * (-743.852) [-736.310] (-743.083) (-736.839) -- 0:00:27
      526500 -- [-739.024] (-737.267) (-741.143) (-736.997) * (-739.326) [-737.642] (-739.037) (-737.362) -- 0:00:27
      527000 -- [-736.543] (-739.613) (-737.483) (-738.210) * (-741.380) (-741.421) (-736.962) [-736.650] -- 0:00:27
      527500 -- (-736.886) (-738.004) [-740.727] (-743.333) * (-740.146) (-739.172) (-736.403) [-739.653] -- 0:00:27
      528000 -- (-738.840) (-741.477) [-736.441] (-737.499) * (-740.540) (-737.886) [-738.113] (-739.652) -- 0:00:28
      528500 -- (-737.467) (-739.175) (-738.118) [-737.596] * (-739.689) [-735.964] (-736.734) (-740.207) -- 0:00:28
      529000 -- (-739.347) (-738.861) (-737.574) [-738.691] * [-736.086] (-736.612) (-736.215) (-738.205) -- 0:00:28
      529500 -- (-736.796) (-740.222) (-737.014) [-736.915] * [-736.670] (-737.056) (-739.725) (-738.514) -- 0:00:28
      530000 -- (-738.095) (-737.260) (-739.382) [-740.308] * [-738.963] (-738.475) (-740.371) (-738.020) -- 0:00:28

      Average standard deviation of split frequencies: 0.015663

      530500 -- (-736.962) (-736.275) (-740.045) [-738.672] * (-740.647) (-737.604) [-736.586] (-739.158) -- 0:00:28
      531000 -- (-736.207) [-738.875] (-738.284) (-739.396) * (-738.541) (-737.824) (-736.269) [-736.944] -- 0:00:28
      531500 -- (-736.634) (-736.178) (-737.376) [-738.020] * (-742.729) (-741.607) (-737.974) [-737.511] -- 0:00:28
      532000 -- (-737.193) (-737.066) (-736.772) [-736.578] * (-737.216) (-737.920) (-737.153) [-737.249] -- 0:00:28
      532500 -- (-737.921) (-736.097) (-737.502) [-736.294] * (-739.012) (-736.337) (-739.608) [-736.617] -- 0:00:28
      533000 -- [-738.309] (-737.768) (-739.243) (-736.527) * (-740.360) (-740.260) (-741.451) [-739.283] -- 0:00:28
      533500 -- (-739.089) (-736.787) [-740.018] (-737.628) * [-738.082] (-739.371) (-737.066) (-738.829) -- 0:00:27
      534000 -- (-737.265) (-736.596) (-736.458) [-738.510] * (-741.145) (-740.729) (-736.804) [-736.950] -- 0:00:27
      534500 -- (-739.423) (-738.737) (-737.586) [-738.717] * [-742.006] (-737.837) (-737.899) (-736.866) -- 0:00:27
      535000 -- [-737.711] (-740.285) (-738.490) (-736.995) * (-737.452) (-739.333) [-739.998] (-739.195) -- 0:00:27

      Average standard deviation of split frequencies: 0.016247

      535500 -- (-739.064) [-740.646] (-741.516) (-738.328) * (-736.741) (-738.180) (-739.147) [-737.256] -- 0:00:27
      536000 -- [-737.581] (-737.487) (-739.229) (-738.523) * (-736.895) [-737.741] (-737.767) (-741.935) -- 0:00:27
      536500 -- (-738.777) (-737.602) [-739.283] (-740.980) * (-736.669) (-738.962) [-739.016] (-738.524) -- 0:00:27
      537000 -- (-737.922) [-736.724] (-739.517) (-737.316) * [-737.964] (-738.402) (-736.628) (-735.980) -- 0:00:27
      537500 -- (-740.751) (-736.663) [-738.737] (-740.222) * (-739.376) (-735.701) (-740.914) [-737.445] -- 0:00:27
      538000 -- [-737.721] (-735.775) (-741.515) (-738.344) * (-737.309) (-735.646) (-737.114) [-741.059] -- 0:00:27
      538500 -- (-737.153) (-737.034) (-739.126) [-736.849] * [-739.353] (-736.755) (-738.692) (-738.430) -- 0:00:27
      539000 -- (-737.791) (-737.462) (-736.635) [-736.303] * (-739.884) (-737.658) (-737.313) [-738.188] -- 0:00:27
      539500 -- [-737.504] (-736.715) (-739.153) (-737.214) * (-736.436) (-736.208) [-740.149] (-741.155) -- 0:00:27
      540000 -- (-738.946) (-736.820) (-737.913) [-739.709] * (-737.310) [-736.134] (-737.343) (-745.178) -- 0:00:27

      Average standard deviation of split frequencies: 0.016178

      540500 -- (-738.386) [-735.694] (-742.627) (-738.123) * (-737.884) [-736.831] (-736.382) (-739.124) -- 0:00:27
      541000 -- (-739.288) (-737.048) (-738.312) [-739.043] * (-736.513) (-740.189) (-737.101) [-736.908] -- 0:00:27
      541500 -- [-736.731] (-738.840) (-740.684) (-745.018) * (-737.486) [-738.162] (-738.444) (-739.144) -- 0:00:27
      542000 -- (-736.923) (-737.024) [-738.199] (-743.138) * (-738.184) (-738.085) [-735.570] (-737.250) -- 0:00:27
      542500 -- (-737.301) (-743.129) (-737.114) [-738.766] * (-737.255) [-738.877] (-736.969) (-737.250) -- 0:00:26
      543000 -- (-739.268) [-737.076] (-740.848) (-736.697) * (-737.087) [-736.123] (-739.538) (-737.495) -- 0:00:26
      543500 -- (-737.950) [-738.620] (-745.435) (-736.469) * (-740.597) (-735.809) [-737.865] (-736.187) -- 0:00:26
      544000 -- (-737.287) (-736.877) (-742.101) [-737.866] * (-736.250) (-738.818) (-737.549) [-736.972] -- 0:00:26
      544500 -- (-735.777) (-738.331) (-740.744) [-737.776] * (-736.653) (-737.062) (-738.129) [-737.720] -- 0:00:27
      545000 -- [-739.270] (-739.858) (-738.598) (-736.690) * (-735.982) (-737.922) (-738.448) [-736.271] -- 0:00:27

      Average standard deviation of split frequencies: 0.016404

      545500 -- (-737.158) [-738.205] (-740.245) (-738.730) * [-740.235] (-736.502) (-737.034) (-737.745) -- 0:00:27
      546000 -- (-737.938) (-736.803) (-739.087) [-739.134] * [-739.620] (-739.026) (-741.001) (-738.962) -- 0:00:27
      546500 -- (-740.946) (-738.210) [-736.532] (-735.982) * (-736.438) (-736.287) [-738.087] (-739.061) -- 0:00:27
      547000 -- (-740.229) (-743.684) [-736.412] (-738.974) * (-736.562) [-736.590] (-745.429) (-739.644) -- 0:00:27
      547500 -- (-737.256) (-738.417) (-737.056) [-740.077] * [-737.463] (-735.898) (-741.079) (-736.733) -- 0:00:27
      548000 -- [-738.809] (-736.287) (-739.530) (-739.843) * (-735.873) [-737.182] (-738.148) (-743.774) -- 0:00:27
      548500 -- (-739.728) (-735.727) (-737.076) [-740.702] * (-737.699) [-738.045] (-739.028) (-739.466) -- 0:00:27
      549000 -- (-738.009) (-736.330) [-737.936] (-743.378) * (-736.517) [-736.507] (-738.088) (-739.924) -- 0:00:27
      549500 -- (-736.808) (-738.059) (-737.451) [-736.007] * (-739.825) (-739.781) [-737.977] (-737.579) -- 0:00:27
      550000 -- (-736.804) (-739.959) (-736.203) [-736.295] * (-738.159) [-737.324] (-739.625) (-738.671) -- 0:00:27

      Average standard deviation of split frequencies: 0.015409

      550500 -- (-736.994) [-738.606] (-737.939) (-738.541) * (-737.009) (-746.362) (-738.676) [-737.598] -- 0:00:26
      551000 -- (-736.395) (-736.113) [-736.950] (-739.397) * [-737.070] (-740.678) (-738.803) (-737.311) -- 0:00:26
      551500 -- (-737.963) (-736.217) [-736.652] (-735.728) * (-739.023) (-736.855) [-738.612] (-738.493) -- 0:00:26
      552000 -- (-737.912) [-737.064] (-738.661) (-737.054) * (-742.172) (-737.376) (-740.664) [-738.387] -- 0:00:26
      552500 -- (-738.921) (-740.117) (-738.496) [-739.866] * (-737.732) [-737.615] (-740.431) (-738.456) -- 0:00:26
      553000 -- (-737.069) (-736.523) [-738.269] (-739.652) * (-736.478) [-736.991] (-740.409) (-738.511) -- 0:00:26
      553500 -- [-738.193] (-736.034) (-739.278) (-737.243) * [-736.586] (-736.153) (-738.296) (-738.111) -- 0:00:26
      554000 -- (-736.381) (-736.607) (-736.422) [-736.839] * [-737.286] (-737.264) (-738.122) (-742.652) -- 0:00:26
      554500 -- (-736.132) (-736.614) (-736.442) [-738.383] * (-737.883) (-736.638) (-740.319) [-737.144] -- 0:00:26
      555000 -- (-737.243) (-737.627) [-738.703] (-737.610) * (-737.980) (-738.090) (-739.519) [-736.612] -- 0:00:26

      Average standard deviation of split frequencies: 0.015012

      555500 -- (-736.570) [-737.774] (-737.796) (-737.596) * (-738.178) [-739.349] (-739.122) (-736.234) -- 0:00:26
      556000 -- (-738.259) (-742.597) [-738.140] (-739.235) * (-736.916) [-735.873] (-737.135) (-740.239) -- 0:00:26
      556500 -- [-741.828] (-739.878) (-737.283) (-736.691) * (-738.690) (-741.901) [-740.895] (-736.530) -- 0:00:26
      557000 -- (-741.319) (-738.462) (-736.692) [-737.129] * (-736.105) [-735.899] (-737.921) (-738.326) -- 0:00:26
      557500 -- (-736.502) (-736.896) [-738.816] (-738.163) * (-740.132) (-741.515) [-736.256] (-742.111) -- 0:00:26
      558000 -- (-737.249) [-737.045] (-737.515) (-742.932) * [-743.933] (-736.399) (-736.848) (-736.785) -- 0:00:26
      558500 -- (-737.327) (-738.500) (-743.255) [-745.321] * (-737.254) (-736.577) (-737.211) [-737.855] -- 0:00:26
      559000 -- (-736.227) (-738.622) [-739.458] (-740.558) * (-737.159) (-738.619) (-739.263) [-736.602] -- 0:00:26
      559500 -- (-737.501) [-736.358] (-737.147) (-736.355) * (-739.670) [-738.731] (-738.694) (-739.710) -- 0:00:25
      560000 -- (-739.484) [-738.048] (-736.284) (-742.213) * [-738.538] (-737.325) (-737.845) (-740.216) -- 0:00:25

      Average standard deviation of split frequencies: 0.015085

      560500 -- (-737.398) [-736.547] (-740.939) (-738.920) * (-739.337) [-737.321] (-736.522) (-737.559) -- 0:00:25
      561000 -- (-737.793) (-736.470) (-739.020) [-737.027] * (-736.864) (-737.840) [-738.194] (-737.502) -- 0:00:25
      561500 -- (-738.845) [-737.140] (-739.501) (-735.687) * [-738.839] (-740.232) (-737.622) (-737.721) -- 0:00:26
      562000 -- [-738.061] (-736.801) (-737.976) (-739.244) * (-738.128) [-739.059] (-739.311) (-736.668) -- 0:00:26
      562500 -- (-736.434) (-735.791) [-736.326] (-740.553) * (-740.136) [-738.000] (-738.061) (-739.680) -- 0:00:26
      563000 -- (-737.422) [-736.303] (-736.334) (-741.517) * (-738.280) [-738.771] (-737.733) (-737.493) -- 0:00:26
      563500 -- (-739.165) [-738.042] (-739.365) (-739.231) * (-740.141) (-738.912) [-738.862] (-736.419) -- 0:00:26
      564000 -- (-736.225) [-739.165] (-739.814) (-736.220) * (-739.187) [-737.009] (-738.394) (-737.442) -- 0:00:26
      564500 -- (-735.739) (-737.226) (-736.472) [-736.898] * [-739.959] (-736.364) (-739.924) (-736.720) -- 0:00:26
      565000 -- (-735.773) (-737.514) [-737.567] (-739.400) * (-740.921) (-741.965) (-737.504) [-739.897] -- 0:00:26

      Average standard deviation of split frequencies: 0.015041

      565500 -- (-740.036) [-736.414] (-736.821) (-738.252) * (-740.716) (-738.846) (-740.134) [-738.158] -- 0:00:26
      566000 -- [-738.373] (-739.436) (-736.960) (-736.271) * [-736.754] (-737.668) (-738.660) (-738.945) -- 0:00:26
      566500 -- (-737.819) (-738.306) (-737.144) [-739.375] * [-738.560] (-738.241) (-738.177) (-736.966) -- 0:00:26
      567000 -- [-736.582] (-739.910) (-736.539) (-736.256) * (-739.509) [-735.668] (-736.910) (-737.087) -- 0:00:25
      567500 -- (-738.250) (-739.518) [-742.314] (-738.249) * (-736.420) [-736.435] (-739.221) (-738.996) -- 0:00:25
      568000 -- (-736.960) (-736.659) (-741.157) [-737.302] * [-736.885] (-737.566) (-740.916) (-739.551) -- 0:00:25
      568500 -- [-737.478] (-736.486) (-737.391) (-739.957) * (-737.062) (-736.604) [-737.538] (-736.697) -- 0:00:25
      569000 -- (-738.792) (-736.896) (-736.977) [-735.965] * (-738.442) (-736.616) [-738.212] (-737.814) -- 0:00:25
      569500 -- (-740.054) [-738.258] (-737.838) (-738.317) * (-736.429) (-738.495) (-736.704) [-737.926] -- 0:00:25
      570000 -- (-739.458) (-740.683) (-737.953) [-736.593] * (-737.615) (-738.620) (-736.731) [-736.577] -- 0:00:25

      Average standard deviation of split frequencies: 0.015063

      570500 -- [-737.072] (-737.150) (-737.959) (-738.012) * (-736.276) [-735.691] (-740.534) (-741.198) -- 0:00:25
      571000 -- (-737.073) (-739.043) (-740.155) [-741.476] * (-737.536) (-737.592) (-739.427) [-737.187] -- 0:00:25
      571500 -- (-735.796) (-738.332) [-737.192] (-737.498) * (-738.057) (-737.043) (-738.893) [-736.477] -- 0:00:25
      572000 -- (-738.799) (-738.315) [-740.491] (-736.469) * (-740.037) [-738.214] (-737.596) (-737.341) -- 0:00:25
      572500 -- [-736.103] (-742.310) (-743.323) (-737.449) * (-737.607) (-736.898) (-739.737) [-737.395] -- 0:00:25
      573000 -- (-737.189) (-738.956) [-739.004] (-739.446) * [-739.540] (-736.886) (-738.751) (-742.254) -- 0:00:25
      573500 -- [-737.100] (-740.277) (-736.787) (-737.432) * (-740.747) (-736.212) (-739.480) [-741.855] -- 0:00:25
      574000 -- (-741.306) (-738.759) [-736.339] (-738.285) * [-739.457] (-736.841) (-735.936) (-736.872) -- 0:00:25
      574500 -- (-737.663) [-737.902] (-740.232) (-737.351) * (-738.011) (-737.745) [-736.545] (-738.598) -- 0:00:25
      575000 -- (-735.574) (-742.345) (-739.124) [-737.647] * (-738.855) (-740.006) [-737.087] (-736.633) -- 0:00:25

      Average standard deviation of split frequencies: 0.014828

      575500 -- [-737.233] (-737.801) (-739.389) (-740.832) * (-738.921) (-736.967) (-736.696) [-736.696] -- 0:00:25
      576000 -- (-737.411) (-739.810) (-738.432) [-737.752] * (-738.031) (-737.179) [-738.460] (-740.960) -- 0:00:25
      576500 -- (-738.970) [-737.539] (-738.689) (-737.433) * [-737.453] (-736.548) (-740.606) (-736.740) -- 0:00:24
      577000 -- [-737.842] (-737.116) (-738.954) (-739.133) * [-737.809] (-737.116) (-739.574) (-738.723) -- 0:00:24
      577500 -- (-738.354) (-739.910) [-737.372] (-740.482) * [-737.175] (-741.450) (-739.342) (-739.509) -- 0:00:24
      578000 -- (-738.208) (-743.316) [-737.593] (-739.630) * (-739.403) [-740.218] (-737.424) (-739.279) -- 0:00:24
      578500 -- (-737.542) (-742.825) [-735.962] (-741.244) * (-741.522) (-736.969) (-738.736) [-738.089] -- 0:00:25
      579000 -- (-736.266) (-740.015) (-740.181) [-737.259] * (-737.148) (-740.457) [-736.595] (-736.383) -- 0:00:25
      579500 -- (-737.326) (-737.081) (-739.918) [-737.202] * (-739.369) [-737.143] (-736.921) (-736.049) -- 0:00:25
      580000 -- (-741.371) [-737.260] (-737.293) (-738.998) * (-739.761) (-735.769) (-736.775) [-736.656] -- 0:00:25

      Average standard deviation of split frequencies: 0.014804

      580500 -- [-737.451] (-736.404) (-737.976) (-740.919) * (-737.690) [-745.443] (-738.695) (-736.132) -- 0:00:25
      581000 -- [-737.085] (-736.664) (-739.776) (-737.493) * (-738.333) (-736.855) [-735.729] (-736.372) -- 0:00:25
      581500 -- (-736.923) (-738.985) [-739.310] (-738.958) * (-740.776) [-736.991] (-737.467) (-735.936) -- 0:00:25
      582000 -- [-737.852] (-739.124) (-740.099) (-738.764) * [-737.772] (-736.417) (-736.635) (-737.040) -- 0:00:25
      582500 -- (-739.077) (-739.962) [-738.733] (-737.112) * (-737.611) [-737.327] (-740.194) (-736.468) -- 0:00:25
      583000 -- [-740.178] (-738.939) (-738.231) (-737.466) * (-739.146) (-738.305) (-738.929) [-737.000] -- 0:00:25
      583500 -- (-740.353) (-738.897) (-736.532) [-737.312] * [-738.529] (-745.363) (-737.802) (-739.341) -- 0:00:24
      584000 -- (-736.612) [-738.266] (-736.757) (-737.954) * (-738.337) (-736.489) [-740.029] (-736.155) -- 0:00:24
      584500 -- (-740.116) [-736.558] (-742.409) (-737.723) * [-737.123] (-740.750) (-736.203) (-736.396) -- 0:00:24
      585000 -- [-737.315] (-736.218) (-743.628) (-737.718) * [-738.620] (-739.022) (-738.575) (-741.668) -- 0:00:24

      Average standard deviation of split frequencies: 0.014527

      585500 -- (-740.758) (-740.138) [-739.925] (-742.679) * (-737.142) (-740.688) [-737.203] (-738.644) -- 0:00:24
      586000 -- (-738.077) (-737.586) [-737.569] (-740.775) * [-738.319] (-738.656) (-736.367) (-735.999) -- 0:00:24
      586500 -- [-739.090] (-739.781) (-737.345) (-737.329) * (-736.793) (-741.519) [-737.950] (-737.303) -- 0:00:24
      587000 -- (-738.373) (-737.511) [-738.476] (-737.397) * (-736.717) (-741.813) (-737.796) [-737.970] -- 0:00:24
      587500 -- (-737.972) (-737.141) [-737.879] (-736.923) * [-736.478] (-740.422) (-741.789) (-736.901) -- 0:00:24
      588000 -- (-737.960) (-737.000) [-737.484] (-738.241) * (-737.984) (-739.510) [-737.219] (-738.948) -- 0:00:24
      588500 -- (-737.945) [-737.664] (-737.124) (-739.563) * (-736.461) (-737.362) (-736.847) [-740.015] -- 0:00:24
      589000 -- (-743.206) (-739.612) (-737.264) [-735.813] * (-738.099) (-740.877) (-738.058) [-737.998] -- 0:00:24
      589500 -- (-738.492) (-736.871) [-737.343] (-738.498) * (-737.246) (-739.072) (-737.695) [-739.962] -- 0:00:24
      590000 -- (-737.305) (-739.591) [-741.148] (-738.347) * (-737.823) [-737.508] (-738.297) (-738.187) -- 0:00:24

      Average standard deviation of split frequencies: 0.014565

      590500 -- (-737.452) (-738.239) (-736.955) [-735.768] * (-736.900) (-738.934) [-738.807] (-737.753) -- 0:00:24
      591000 -- (-737.419) (-738.885) [-738.609] (-735.783) * [-737.924] (-736.105) (-739.220) (-736.485) -- 0:00:24
      591500 -- (-737.924) (-741.189) (-740.826) [-739.808] * (-738.106) (-738.047) (-739.925) [-740.191] -- 0:00:24
      592000 -- [-740.953] (-741.194) (-737.286) (-739.806) * (-738.106) (-737.766) [-737.252] (-739.519) -- 0:00:24
      592500 -- [-738.837] (-741.410) (-738.477) (-736.778) * (-738.224) (-745.685) [-739.606] (-737.645) -- 0:00:24
      593000 -- (-738.970) (-738.026) (-737.345) [-738.266] * (-737.362) (-746.654) [-737.135] (-736.055) -- 0:00:24
      593500 -- [-737.268] (-738.232) (-737.731) (-736.955) * [-738.038] (-737.045) (-741.031) (-737.351) -- 0:00:23
      594000 -- (-737.781) [-737.386] (-738.365) (-738.880) * (-739.122) [-739.152] (-737.617) (-736.389) -- 0:00:23
      594500 -- (-737.528) [-738.455] (-739.056) (-739.605) * [-738.613] (-737.163) (-737.799) (-737.531) -- 0:00:23
      595000 -- (-736.813) (-740.843) [-739.407] (-737.280) * (-745.478) (-737.225) (-739.047) [-739.763] -- 0:00:24

      Average standard deviation of split frequencies: 0.013868

      595500 -- [-737.562] (-736.152) (-737.596) (-736.154) * (-741.561) [-738.440] (-738.367) (-738.673) -- 0:00:24
      596000 -- [-743.420] (-739.523) (-738.601) (-736.561) * (-736.633) (-738.614) (-737.658) [-736.925] -- 0:00:24
      596500 -- (-737.694) (-738.530) (-740.944) [-738.526] * [-739.835] (-738.184) (-737.727) (-737.131) -- 0:00:24
      597000 -- (-737.702) [-740.229] (-737.285) (-737.023) * (-737.105) (-736.525) (-738.828) [-737.418] -- 0:00:24
      597500 -- (-738.058) [-739.116] (-736.430) (-738.953) * (-744.115) [-737.264] (-738.437) (-743.292) -- 0:00:24
      598000 -- (-737.741) [-736.348] (-736.443) (-737.075) * (-736.875) (-736.513) (-737.844) [-736.407] -- 0:00:24
      598500 -- [-736.010] (-737.807) (-739.061) (-738.269) * (-736.757) (-740.239) (-737.674) [-739.844] -- 0:00:24
      599000 -- (-738.918) (-736.364) [-739.524] (-736.289) * [-738.714] (-736.381) (-739.422) (-738.156) -- 0:00:24
      599500 -- (-738.568) [-743.428] (-739.279) (-739.432) * (-736.330) (-737.292) (-740.648) [-740.962] -- 0:00:24
      600000 -- (-740.197) (-738.160) [-738.663] (-739.454) * (-736.716) [-736.230] (-737.170) (-736.660) -- 0:00:24

      Average standard deviation of split frequencies: 0.013603

      600500 -- (-738.268) (-739.768) (-737.208) [-739.975] * (-736.042) [-738.389] (-736.267) (-736.875) -- 0:00:23
      601000 -- [-736.777] (-740.276) (-738.785) (-736.888) * (-736.387) (-738.232) [-737.747] (-744.066) -- 0:00:23
      601500 -- (-736.134) (-738.321) (-740.235) [-737.472] * (-737.594) [-737.544] (-736.854) (-736.851) -- 0:00:23
      602000 -- (-735.812) [-737.496] (-738.556) (-736.935) * (-738.713) [-739.266] (-737.626) (-736.635) -- 0:00:23
      602500 -- (-736.111) (-739.148) (-738.597) [-736.287] * (-738.733) (-736.739) (-741.033) [-736.945] -- 0:00:23
      603000 -- (-740.555) (-737.033) [-739.188] (-736.895) * [-739.141] (-737.165) (-740.381) (-737.401) -- 0:00:23
      603500 -- [-736.527] (-737.238) (-738.682) (-737.686) * (-738.505) (-736.726) (-738.252) [-739.307] -- 0:00:23
      604000 -- (-736.567) (-742.221) [-740.573] (-738.029) * [-739.533] (-737.761) (-737.545) (-737.066) -- 0:00:23
      604500 -- [-737.727] (-740.399) (-741.525) (-737.658) * (-739.923) (-736.818) [-736.114] (-737.045) -- 0:00:23
      605000 -- (-737.576) (-740.275) (-742.016) [-737.465] * [-737.266] (-737.802) (-742.134) (-738.288) -- 0:00:23

      Average standard deviation of split frequencies: 0.014106

      605500 -- (-737.346) (-740.197) [-739.682] (-744.925) * (-737.174) [-738.988] (-737.298) (-736.978) -- 0:00:23
      606000 -- [-741.519] (-738.482) (-738.784) (-740.466) * [-737.844] (-737.202) (-736.424) (-738.288) -- 0:00:23
      606500 -- (-741.156) [-738.676] (-737.370) (-737.333) * (-736.641) [-738.241] (-740.666) (-737.822) -- 0:00:23
      607000 -- [-737.589] (-737.369) (-738.372) (-740.060) * [-736.807] (-736.650) (-737.590) (-737.507) -- 0:00:23
      607500 -- (-736.365) [-737.780] (-738.057) (-739.340) * [-740.088] (-738.942) (-737.950) (-741.184) -- 0:00:23
      608000 -- (-737.115) (-739.035) [-737.898] (-736.692) * (-741.719) [-741.796] (-741.091) (-739.490) -- 0:00:23
      608500 -- (-740.395) [-737.097] (-739.872) (-736.389) * (-740.245) (-740.282) (-738.247) [-740.412] -- 0:00:23
      609000 -- (-741.984) (-737.557) (-737.501) [-736.348] * (-742.774) (-739.963) [-737.988] (-739.909) -- 0:00:23
      609500 -- (-738.900) (-738.633) [-737.671] (-739.084) * [-738.942] (-736.835) (-739.321) (-737.592) -- 0:00:23
      610000 -- (-735.914) [-737.755] (-737.253) (-736.672) * (-738.609) (-737.582) (-738.187) [-738.089] -- 0:00:23

      Average standard deviation of split frequencies: 0.013844

      610500 -- (-739.304) [-737.161] (-735.551) (-738.283) * (-741.735) (-738.287) (-737.541) [-738.435] -- 0:00:22
      611000 -- (-741.753) (-737.157) [-736.601] (-736.966) * (-739.789) [-736.859] (-738.149) (-737.244) -- 0:00:22
      611500 -- (-740.579) [-735.968] (-736.616) (-737.282) * (-740.392) [-739.463] (-737.379) (-739.541) -- 0:00:22
      612000 -- (-736.529) [-738.329] (-741.644) (-736.124) * (-737.556) (-739.253) (-736.334) [-736.227] -- 0:00:23
      612500 -- (-736.254) [-739.563] (-739.354) (-737.401) * (-736.783) (-736.920) (-736.055) [-740.718] -- 0:00:23
      613000 -- (-739.956) (-742.642) (-736.195) [-738.336] * (-736.629) (-736.924) [-738.728] (-737.794) -- 0:00:23
      613500 -- (-741.140) (-737.694) [-738.407] (-738.164) * (-740.352) (-740.627) (-739.335) [-737.584] -- 0:00:23
      614000 -- (-739.219) (-739.681) (-738.670) [-739.153] * (-736.652) [-738.065] (-739.791) (-740.438) -- 0:00:23
      614500 -- (-736.435) (-738.204) (-737.270) [-735.801] * [-736.627] (-738.963) (-736.559) (-740.230) -- 0:00:23
      615000 -- [-736.949] (-737.449) (-737.682) (-737.236) * (-736.346) (-737.119) (-736.528) [-740.313] -- 0:00:23

      Average standard deviation of split frequencies: 0.013316

      615500 -- (-738.120) (-741.080) [-736.357] (-738.027) * [-736.654] (-736.096) (-741.799) (-739.637) -- 0:00:23
      616000 -- (-738.638) (-737.087) (-736.671) [-736.433] * [-737.573] (-736.757) (-736.622) (-738.327) -- 0:00:23
      616500 -- [-737.126] (-736.910) (-742.372) (-739.873) * (-736.157) (-738.213) [-736.726] (-740.834) -- 0:00:23
      617000 -- (-739.574) [-736.800] (-735.865) (-736.955) * (-736.871) (-739.626) (-736.577) [-737.704] -- 0:00:22
      617500 -- [-735.930] (-737.201) (-737.455) (-737.464) * [-737.014] (-739.103) (-737.857) (-740.079) -- 0:00:22
      618000 -- (-736.166) (-737.056) (-736.808) [-736.512] * (-736.354) (-742.874) (-738.237) [-737.746] -- 0:00:22
      618500 -- (-739.452) (-739.226) (-738.188) [-736.632] * (-738.975) [-737.817] (-737.677) (-738.683) -- 0:00:22
      619000 -- (-736.473) (-739.767) (-742.838) [-739.137] * (-736.084) (-736.762) [-738.941] (-738.906) -- 0:00:22
      619500 -- [-736.418] (-736.849) (-736.766) (-739.425) * (-736.880) (-740.683) [-738.275] (-736.567) -- 0:00:22
      620000 -- (-741.564) (-739.386) (-738.983) [-736.556] * (-739.184) (-736.320) (-736.834) [-737.216] -- 0:00:22

      Average standard deviation of split frequencies: 0.012861

      620500 -- [-736.827] (-736.929) (-738.371) (-736.513) * (-737.891) [-738.039] (-739.024) (-736.204) -- 0:00:22
      621000 -- [-737.004] (-737.414) (-737.022) (-737.595) * [-736.113] (-741.934) (-736.471) (-737.095) -- 0:00:22
      621500 -- (-739.733) (-738.514) [-736.174] (-736.173) * (-738.131) (-737.097) [-738.562] (-740.489) -- 0:00:22
      622000 -- (-740.750) (-737.921) [-736.272] (-737.787) * (-738.453) (-738.938) [-736.160] (-738.391) -- 0:00:22
      622500 -- [-737.786] (-737.617) (-736.663) (-739.708) * [-736.196] (-740.562) (-736.362) (-735.984) -- 0:00:22
      623000 -- (-741.014) [-742.481] (-737.032) (-743.220) * (-736.348) (-737.664) (-737.316) [-737.007] -- 0:00:22
      623500 -- (-739.015) (-739.598) [-735.765] (-743.517) * (-738.622) (-738.639) [-737.127] (-738.570) -- 0:00:22
      624000 -- (-744.591) [-735.936] (-739.015) (-739.392) * (-743.963) (-737.572) (-735.850) [-737.338] -- 0:00:22
      624500 -- (-739.528) [-737.013] (-738.766) (-739.958) * (-737.562) (-740.772) (-738.256) [-736.427] -- 0:00:22
      625000 -- (-738.389) (-738.492) (-740.441) [-736.315] * [-737.986] (-738.263) (-741.720) (-738.881) -- 0:00:22

      Average standard deviation of split frequencies: 0.013461

      625500 -- [-739.287] (-737.390) (-743.293) (-737.812) * (-741.821) [-737.859] (-742.148) (-737.930) -- 0:00:22
      626000 -- (-737.390) (-736.451) [-739.308] (-736.344) * [-738.625] (-745.760) (-737.795) (-739.641) -- 0:00:22
      626500 -- (-741.574) (-735.850) (-737.165) [-736.691] * (-737.874) (-738.689) (-736.596) [-736.992] -- 0:00:22
      627000 -- [-737.660] (-736.524) (-738.351) (-735.820) * [-736.234] (-742.556) (-740.408) (-737.913) -- 0:00:22
      627500 -- (-738.789) [-739.850] (-742.263) (-737.423) * (-736.671) (-740.580) (-742.535) [-737.005] -- 0:00:21
      628000 -- (-740.083) (-742.212) (-739.919) [-737.967] * (-736.414) (-740.119) (-737.634) [-736.546] -- 0:00:21
      628500 -- [-738.351] (-738.612) (-737.858) (-737.188) * [-737.324] (-740.239) (-738.795) (-738.041) -- 0:00:22
      629000 -- (-737.188) [-738.449] (-737.068) (-738.636) * (-737.587) (-739.029) (-738.278) [-738.760] -- 0:00:22
      629500 -- [-739.348] (-743.555) (-737.740) (-738.933) * (-737.548) (-736.810) (-737.993) [-737.418] -- 0:00:22
      630000 -- (-737.483) (-739.602) [-736.756] (-738.379) * [-737.727] (-743.148) (-741.802) (-740.198) -- 0:00:22

      Average standard deviation of split frequencies: 0.013221

      630500 -- [-737.447] (-739.909) (-742.959) (-737.754) * (-740.181) (-743.922) (-740.195) [-741.201] -- 0:00:22
      631000 -- (-743.807) (-742.199) [-737.365] (-735.762) * [-740.336] (-741.047) (-739.050) (-739.248) -- 0:00:22
      631500 -- (-738.282) (-736.083) [-739.338] (-737.266) * (-739.093) (-737.094) (-736.819) [-737.565] -- 0:00:22
      632000 -- (-738.133) (-738.726) [-736.902] (-738.607) * (-739.676) [-737.365] (-737.498) (-739.222) -- 0:00:22
      632500 -- [-737.145] (-738.513) (-737.251) (-737.853) * [-736.772] (-736.238) (-741.056) (-741.230) -- 0:00:22
      633000 -- (-737.569) (-736.957) (-738.114) [-737.207] * (-739.131) (-737.583) [-738.468] (-736.135) -- 0:00:22
      633500 -- [-738.287] (-741.600) (-736.432) (-738.613) * [-739.997] (-742.846) (-738.234) (-736.104) -- 0:00:21
      634000 -- (-739.871) [-739.060] (-741.428) (-738.139) * (-740.919) [-737.787] (-739.226) (-740.998) -- 0:00:21
      634500 -- (-743.074) (-737.094) [-735.843] (-739.475) * (-742.808) [-736.634] (-737.318) (-740.131) -- 0:00:21
      635000 -- (-739.338) (-739.229) [-737.126] (-739.528) * (-737.792) [-736.629] (-737.179) (-741.065) -- 0:00:21

      Average standard deviation of split frequencies: 0.013243

      635500 -- (-742.787) [-737.300] (-737.489) (-740.290) * (-739.584) [-736.931] (-736.715) (-738.119) -- 0:00:21
      636000 -- (-738.578) (-738.507) (-739.071) [-737.697] * (-738.398) [-736.153] (-740.729) (-738.221) -- 0:00:21
      636500 -- [-737.293] (-743.726) (-739.470) (-738.590) * (-739.428) (-736.005) [-739.682] (-738.279) -- 0:00:21
      637000 -- (-737.410) [-737.221] (-735.921) (-740.771) * (-743.002) (-736.101) [-736.998] (-738.997) -- 0:00:21
      637500 -- (-738.885) [-738.751] (-739.286) (-744.739) * (-740.888) (-739.561) [-736.481] (-739.998) -- 0:00:21
      638000 -- [-736.309] (-738.583) (-738.215) (-736.858) * (-749.892) (-737.271) (-735.735) [-741.411] -- 0:00:21
      638500 -- (-738.653) [-736.701] (-739.786) (-737.768) * (-743.203) (-736.334) (-737.684) [-742.453] -- 0:00:21
      639000 -- (-737.807) (-737.138) [-739.236] (-738.574) * (-739.617) (-739.237) (-737.112) [-736.206] -- 0:00:21
      639500 -- (-737.168) (-737.328) (-739.882) [-738.448] * (-737.862) (-740.490) (-735.983) [-737.563] -- 0:00:21
      640000 -- (-735.794) (-737.855) (-739.320) [-735.942] * (-736.357) (-739.117) (-737.653) [-736.355] -- 0:00:21

      Average standard deviation of split frequencies: 0.013244

      640500 -- [-735.900] (-736.271) (-738.351) (-737.315) * (-739.616) (-737.923) [-736.404] (-736.924) -- 0:00:21
      641000 -- [-737.720] (-736.200) (-738.374) (-743.676) * (-740.751) (-739.966) [-736.590] (-739.085) -- 0:00:21
      641500 -- [-738.000] (-736.501) (-739.572) (-737.865) * (-742.946) (-742.243) [-738.137] (-739.294) -- 0:00:21
      642000 -- [-738.431] (-736.581) (-739.212) (-737.061) * (-739.788) [-738.221] (-738.611) (-740.640) -- 0:00:21
      642500 -- (-738.588) [-735.817] (-742.089) (-736.859) * (-735.666) (-737.417) [-737.439] (-737.986) -- 0:00:21
      643000 -- (-738.826) (-736.061) (-738.892) [-736.377] * (-738.902) (-736.287) (-739.296) [-737.607] -- 0:00:21
      643500 -- [-741.073] (-738.715) (-742.710) (-743.463) * (-737.127) (-736.909) [-737.447] (-737.310) -- 0:00:21
      644000 -- (-737.863) (-737.198) [-739.869] (-737.149) * (-738.741) (-736.902) [-737.383] (-738.436) -- 0:00:21
      644500 -- (-739.021) (-739.420) (-739.639) [-736.640] * (-739.310) (-737.632) (-736.000) [-736.241] -- 0:00:20
      645000 -- (-736.507) [-737.921] (-742.743) (-736.798) * (-736.750) (-736.901) (-737.503) [-735.733] -- 0:00:20

      Average standard deviation of split frequencies: 0.012649

      645500 -- [-740.437] (-743.881) (-737.796) (-736.665) * [-741.183] (-737.456) (-736.193) (-741.049) -- 0:00:21
      646000 -- (-738.405) (-747.660) [-741.224] (-735.969) * (-740.374) (-739.102) [-736.708] (-738.438) -- 0:00:21
      646500 -- (-738.237) (-742.741) (-738.277) [-738.612] * (-742.242) [-741.369] (-736.456) (-739.236) -- 0:00:21
      647000 -- (-739.630) (-745.216) [-738.960] (-735.806) * (-739.499) [-739.145] (-737.873) (-739.160) -- 0:00:21
      647500 -- [-737.707] (-738.557) (-740.327) (-738.842) * (-739.274) [-737.592] (-737.776) (-738.236) -- 0:00:21
      648000 -- (-737.373) (-736.536) [-740.068] (-736.753) * (-739.712) [-737.143] (-737.147) (-739.241) -- 0:00:21
      648500 -- (-742.994) (-736.772) (-741.085) [-744.990] * [-736.503] (-738.815) (-737.423) (-738.266) -- 0:00:21
      649000 -- (-737.274) (-739.745) (-738.021) [-737.381] * (-736.624) (-736.195) [-739.271] (-736.771) -- 0:00:21
      649500 -- (-737.630) (-738.233) [-737.197] (-738.325) * (-736.493) (-738.232) [-737.604] (-737.536) -- 0:00:21
      650000 -- (-736.445) (-739.789) (-736.279) [-736.265] * (-739.556) (-736.961) [-736.922] (-736.640) -- 0:00:21

      Average standard deviation of split frequencies: 0.012558

      650500 -- (-736.125) (-740.227) (-738.750) [-736.639] * (-739.394) (-738.292) (-737.594) [-736.730] -- 0:00:20
      651000 -- (-736.558) (-740.266) (-736.278) [-736.345] * (-738.073) (-738.212) [-738.496] (-741.301) -- 0:00:20
      651500 -- (-736.640) (-741.738) (-741.205) [-736.937] * [-738.402] (-736.260) (-737.812) (-741.031) -- 0:00:20
      652000 -- [-737.583] (-738.934) (-737.106) (-740.290) * (-737.210) (-735.792) [-736.031] (-737.423) -- 0:00:20
      652500 -- (-737.896) (-737.990) (-738.270) [-738.686] * (-738.309) (-737.602) (-736.292) [-737.336] -- 0:00:20
      653000 -- (-736.557) (-737.794) [-736.615] (-740.836) * (-738.594) (-738.063) [-739.098] (-736.275) -- 0:00:20
      653500 -- (-738.342) [-737.742] (-737.016) (-740.499) * (-739.312) (-739.246) (-739.492) [-740.051] -- 0:00:20
      654000 -- (-737.005) (-737.817) [-738.682] (-738.183) * [-737.111] (-740.965) (-740.020) (-738.081) -- 0:00:20
      654500 -- (-738.047) [-738.320] (-740.671) (-737.561) * (-738.986) (-738.339) [-736.771] (-740.730) -- 0:00:20
      655000 -- (-740.510) (-736.570) (-738.857) [-738.024] * (-740.536) [-737.338] (-737.476) (-737.776) -- 0:00:20

      Average standard deviation of split frequencies: 0.012552

      655500 -- (-740.288) (-737.112) (-740.560) [-737.831] * (-746.541) (-736.849) (-737.551) [-736.935] -- 0:00:20
      656000 -- (-736.754) [-736.841] (-738.880) (-736.488) * (-743.144) (-740.277) (-739.361) [-739.436] -- 0:00:20
      656500 -- (-738.494) (-738.458) (-739.769) [-736.310] * (-737.800) [-738.024] (-740.426) (-738.678) -- 0:00:20
      657000 -- (-738.381) [-737.905] (-736.340) (-739.711) * [-740.083] (-740.827) (-740.669) (-737.381) -- 0:00:20
      657500 -- (-739.846) (-737.504) [-736.234] (-739.787) * (-740.290) (-738.656) (-740.234) [-738.863] -- 0:00:20
      658000 -- (-740.008) (-737.634) [-737.313] (-740.849) * (-738.006) [-739.838] (-737.905) (-736.303) -- 0:00:20
      658500 -- (-738.588) (-738.856) [-738.789] (-740.245) * (-738.946) [-739.017] (-736.450) (-735.993) -- 0:00:20
      659000 -- (-737.409) [-736.996] (-737.537) (-738.931) * (-739.521) (-737.494) [-739.137] (-738.917) -- 0:00:20
      659500 -- (-738.285) (-736.135) (-738.102) [-738.133] * (-737.528) (-737.891) [-738.511] (-739.184) -- 0:00:20
      660000 -- (-739.300) [-736.148] (-739.318) (-739.368) * (-737.577) (-736.713) (-738.678) [-738.876] -- 0:00:20

      Average standard deviation of split frequencies: 0.012130

      660500 -- [-740.207] (-739.574) (-737.088) (-736.568) * [-738.728] (-737.787) (-736.644) (-736.564) -- 0:00:20
      661000 -- (-737.910) (-736.955) [-737.518] (-736.514) * (-736.852) (-736.157) [-740.587] (-737.345) -- 0:00:20
      661500 -- (-741.858) (-738.948) [-736.357] (-739.292) * [-737.083] (-739.355) (-740.727) (-738.968) -- 0:00:19
      662000 -- (-740.042) (-739.196) (-736.463) [-738.271] * [-739.463] (-738.835) (-737.267) (-737.058) -- 0:00:20
      662500 -- (-740.475) [-737.799] (-738.033) (-738.653) * (-741.421) (-739.091) [-736.313] (-738.413) -- 0:00:20
      663000 -- (-736.324) (-739.065) (-737.500) [-739.012] * (-739.916) (-739.542) [-736.567] (-738.229) -- 0:00:20
      663500 -- (-736.408) (-736.778) [-737.608] (-742.215) * (-739.563) [-737.938] (-737.856) (-739.962) -- 0:00:20
      664000 -- (-736.422) (-736.681) (-740.016) [-737.661] * [-735.947] (-737.647) (-737.182) (-736.780) -- 0:00:20
      664500 -- (-736.521) [-739.212] (-738.428) (-736.402) * (-740.972) [-737.252] (-738.041) (-736.329) -- 0:00:20
      665000 -- (-740.890) [-739.579] (-738.393) (-735.967) * (-741.174) [-738.369] (-742.064) (-736.873) -- 0:00:20

      Average standard deviation of split frequencies: 0.012343

      665500 -- (-740.563) (-737.592) (-740.503) [-738.753] * (-741.253) (-738.769) [-741.860] (-737.571) -- 0:00:20
      666000 -- (-738.400) (-738.184) (-737.399) [-738.010] * (-739.387) [-736.065] (-736.062) (-739.539) -- 0:00:20
      666500 -- (-739.079) (-739.681) (-738.712) [-736.730] * (-736.697) (-737.770) (-740.367) [-738.163] -- 0:00:20
      667000 -- (-738.636) (-742.314) (-738.785) [-738.581] * (-738.715) (-738.857) (-739.934) [-741.412] -- 0:00:19
      667500 -- (-739.114) (-738.591) (-743.643) [-736.179] * (-742.929) (-738.275) [-736.269] (-739.012) -- 0:00:19
      668000 -- (-737.539) (-737.680) (-742.276) [-737.841] * [-736.709] (-736.853) (-737.459) (-738.800) -- 0:00:19
      668500 -- [-736.976] (-738.311) (-739.552) (-739.176) * (-739.442) (-739.137) (-738.065) [-737.396] -- 0:00:19
      669000 -- (-736.504) (-737.814) (-737.356) [-739.903] * (-737.527) (-737.108) [-735.817] (-736.996) -- 0:00:19
      669500 -- (-739.763) (-741.664) (-736.642) [-741.024] * [-737.085] (-736.406) (-736.145) (-740.831) -- 0:00:19
      670000 -- (-737.429) [-735.966] (-736.727) (-738.905) * [-741.059] (-736.624) (-738.508) (-736.544) -- 0:00:19

      Average standard deviation of split frequencies: 0.011510

      670500 -- (-738.081) (-741.202) (-736.912) [-739.649] * (-742.338) [-739.270] (-736.119) (-742.879) -- 0:00:19
      671000 -- [-736.716] (-736.349) (-737.421) (-736.636) * (-736.413) (-741.349) [-736.651] (-738.301) -- 0:00:19
      671500 -- (-737.043) (-735.652) [-736.276] (-736.370) * (-738.657) (-740.656) [-736.601] (-739.329) -- 0:00:19
      672000 -- [-737.855] (-736.814) (-738.232) (-736.526) * (-737.875) (-742.271) (-736.339) [-740.445] -- 0:00:19
      672500 -- (-739.597) (-739.715) [-739.555] (-736.369) * (-737.797) (-740.458) (-736.900) [-737.504] -- 0:00:19
      673000 -- (-736.808) (-740.206) [-736.797] (-738.279) * (-736.438) (-739.328) (-736.622) [-736.648] -- 0:00:19
      673500 -- (-737.254) (-739.034) (-738.680) [-736.802] * (-736.776) (-740.593) (-737.231) [-737.162] -- 0:00:19
      674000 -- (-740.216) [-736.495] (-736.184) (-737.389) * (-737.460) (-736.726) (-737.055) [-739.142] -- 0:00:19
      674500 -- (-736.497) (-740.613) [-736.737] (-740.588) * (-738.449) (-736.614) [-736.551] (-736.480) -- 0:00:19
      675000 -- (-737.165) (-738.259) (-739.055) [-736.533] * [-739.014] (-736.597) (-736.393) (-737.441) -- 0:00:19

      Average standard deviation of split frequencies: 0.011114

      675500 -- [-737.793] (-738.092) (-737.821) (-735.650) * (-736.246) (-737.376) [-739.050] (-740.019) -- 0:00:19
      676000 -- [-742.864] (-738.804) (-737.166) (-735.889) * [-735.740] (-735.734) (-736.466) (-738.402) -- 0:00:19
      676500 -- (-740.273) (-736.856) [-737.747] (-736.432) * [-741.861] (-735.745) (-740.233) (-740.501) -- 0:00:19
      677000 -- [-738.618] (-737.380) (-737.306) (-736.676) * (-736.914) (-737.441) (-737.496) [-738.546] -- 0:00:19
      677500 -- [-742.240] (-737.332) (-739.556) (-736.412) * [-739.744] (-745.681) (-739.081) (-743.057) -- 0:00:19
      678000 -- [-737.075] (-740.586) (-737.967) (-738.658) * (-737.463) [-737.090] (-738.488) (-737.547) -- 0:00:18
      678500 -- [-739.759] (-736.525) (-738.213) (-737.651) * (-737.076) (-735.821) (-737.383) [-736.695] -- 0:00:19
      679000 -- (-737.309) (-737.061) (-737.360) [-737.572] * (-738.102) (-738.595) [-736.874] (-736.905) -- 0:00:19
      679500 -- (-739.307) [-736.181] (-738.639) (-736.177) * (-737.100) (-736.826) (-736.000) [-739.589] -- 0:00:19
      680000 -- (-736.507) (-736.141) (-738.792) [-736.656] * (-737.217) (-738.838) [-738.543] (-739.114) -- 0:00:19

      Average standard deviation of split frequencies: 0.011471

      680500 -- (-736.560) (-741.736) [-737.352] (-736.400) * [-736.108] (-736.330) (-739.044) (-739.893) -- 0:00:19
      681000 -- (-736.538) (-736.865) [-738.073] (-742.168) * [-740.324] (-736.675) (-740.153) (-738.316) -- 0:00:19
      681500 -- (-738.806) (-737.043) (-738.258) [-740.249] * (-738.041) (-736.675) (-736.463) [-738.275] -- 0:00:19
      682000 -- (-737.945) [-740.392] (-738.696) (-736.445) * (-737.130) (-735.801) [-737.232] (-737.788) -- 0:00:19
      682500 -- (-737.770) [-738.655] (-739.127) (-739.369) * (-737.687) (-737.610) [-740.934] (-737.629) -- 0:00:19
      683000 -- (-737.772) [-736.459] (-737.667) (-739.750) * (-738.346) (-740.212) (-737.712) [-736.246] -- 0:00:19
      683500 -- [-737.051] (-742.074) (-742.216) (-738.208) * (-735.951) [-739.476] (-737.070) (-736.399) -- 0:00:18
      684000 -- [-736.477] (-738.149) (-736.760) (-737.136) * (-736.733) (-739.151) [-738.630] (-739.480) -- 0:00:18
      684500 -- [-738.109] (-736.031) (-741.178) (-736.060) * (-739.372) (-737.752) (-736.522) [-738.387] -- 0:00:18
      685000 -- (-742.590) [-738.274] (-740.660) (-737.179) * [-742.172] (-737.044) (-739.083) (-739.116) -- 0:00:18

      Average standard deviation of split frequencies: 0.011682

      685500 -- (-737.915) (-737.532) (-738.284) [-738.526] * (-739.251) (-742.053) (-737.406) [-736.744] -- 0:00:18
      686000 -- (-738.037) (-737.629) [-740.632] (-739.539) * (-738.959) (-736.151) [-737.149] (-736.073) -- 0:00:18
      686500 -- (-738.898) (-739.805) [-737.957] (-740.717) * [-737.617] (-737.166) (-739.651) (-736.647) -- 0:00:18
      687000 -- (-737.073) (-739.027) [-736.540] (-738.104) * (-737.536) [-736.096] (-738.488) (-737.602) -- 0:00:18
      687500 -- [-738.073] (-740.312) (-740.131) (-739.044) * (-738.755) (-739.231) [-739.625] (-736.927) -- 0:00:18
      688000 -- (-736.481) (-736.931) [-738.897] (-736.706) * [-736.864] (-737.372) (-741.967) (-738.503) -- 0:00:18
      688500 -- (-741.455) [-736.568] (-737.608) (-738.544) * [-736.487] (-739.396) (-743.224) (-736.165) -- 0:00:18
      689000 -- [-739.448] (-741.426) (-736.813) (-736.530) * [-738.145] (-742.296) (-738.674) (-738.998) -- 0:00:18
      689500 -- (-736.927) [-736.526] (-736.813) (-738.455) * [-738.388] (-736.825) (-736.293) (-740.161) -- 0:00:18
      690000 -- (-742.097) (-738.159) [-739.922] (-736.996) * (-736.855) (-736.473) [-735.889] (-740.805) -- 0:00:18

      Average standard deviation of split frequencies: 0.011987

      690500 -- (-738.367) (-736.756) (-736.502) [-735.749] * [-737.211] (-737.938) (-738.158) (-738.410) -- 0:00:18
      691000 -- (-735.529) (-736.990) (-740.454) [-736.325] * (-736.393) (-737.188) (-737.217) [-738.603] -- 0:00:18
      691500 -- (-737.378) (-738.037) [-739.506] (-737.103) * (-736.150) (-737.748) [-737.218] (-741.510) -- 0:00:18
      692000 -- (-737.250) (-739.393) (-738.963) [-736.308] * (-736.198) (-737.842) (-737.221) [-737.247] -- 0:00:18
      692500 -- [-737.589] (-738.547) (-738.185) (-736.056) * (-737.485) (-741.149) [-736.375] (-737.368) -- 0:00:18
      693000 -- (-739.182) (-738.072) [-737.187] (-737.852) * (-737.074) (-739.880) [-736.386] (-737.102) -- 0:00:18
      693500 -- [-736.758] (-737.494) (-736.335) (-738.727) * [-736.551] (-738.690) (-737.275) (-736.301) -- 0:00:18
      694000 -- (-735.