--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:36:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplM/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -605.14          -610.19
2       -605.11          -607.99
--------------------------------------
TOTAL     -605.12          -609.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898308    0.090977    0.365075    1.510573    0.865391   1501.00   1501.00    1.000
r(A<->C){all}   0.175530    0.022589    0.000007    0.478553    0.134240    169.20    220.16    1.000
r(A<->G){all}   0.153115    0.018024    0.000035    0.411630    0.117519    258.27    294.88    1.000
r(A<->T){all}   0.163054    0.018777    0.000176    0.436573    0.125057    182.43    186.53    1.000
r(C<->G){all}   0.159555    0.018120    0.000104    0.418225    0.127729    169.88    263.96    1.020
r(C<->T){all}   0.172276    0.019422    0.000148    0.449490    0.140200    207.82    295.01    1.002
r(G<->T){all}   0.176469    0.021434    0.000089    0.466227    0.140129    156.48    183.23    1.003
pi(A){all}      0.224695    0.000381    0.187534    0.264837    0.224461   1210.12   1231.41    1.000
pi(C){all}      0.312469    0.000502    0.267378    0.355640    0.311544   1068.93   1134.43    1.000
pi(G){all}      0.274353    0.000457    0.232881    0.316174    0.274477   1371.31   1395.57    1.000
pi(T){all}      0.188483    0.000358    0.150893    0.224365    0.188059   1357.27   1410.00    1.000
alpha{1,2}      0.407076    0.217556    0.000182    1.346624    0.241369   1259.58   1279.58    1.000
alpha{3}        0.446580    0.234095    0.000145    1.375782    0.285265   1006.90   1161.05    1.001
pinvar{all}     0.996395    0.000020    0.988595    0.999993    0.997842   1175.27   1254.47    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-577.120878
Model 2: PositiveSelection	-577.120899
Model 0: one-ratio	-577.120914
Model 7: beta	-577.120878
Model 8: beta&w>1	-577.120878


Model 0 vs 1	7.200000004559115E-5

Model 2 vs 1	4.200000012133387E-5

Model 8 vs 7	0.0
>C1
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C2
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C3
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C4
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C5
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C6
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147 

C1              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C2              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C3              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C4              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C5              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C6              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
                **************************************************

C1              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C2              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C3              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C4              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C5              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C6              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
                **************************************************

C1              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C2              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C3              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C4              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C5              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C6              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4410]--->[4410]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.456 Mb, Max= 30.670 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C2              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C3              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C4              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C5              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C6              VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
                **************************************************

C1              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C2              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C3              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C4              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C5              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C6              GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
                **************************************************

C1              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C2              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C3              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C4              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C5              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C6              VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C2              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C3              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C4              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C5              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C6              GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
                **************************************************

C1              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C2              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C3              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C4              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C5              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C6              CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
                **************************************************

C1              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C2              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C3              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C4              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C5              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C6              CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
                **************************************************

C1              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C2              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C3              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C4              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C5              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C6              GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
                **************************************************

C1              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C2              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C3              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C4              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C5              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C6              TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
                **************************************************

C1              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C2              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C3              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C4              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C5              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C6              TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
                **************************************************

C1              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C2              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C3              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C4              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C5              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C6              GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
                **************************************************

C1              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C2              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C3              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C4              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C5              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C6              GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
                **************************************************

C1              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C2              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C3              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C4              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C5              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C6              CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
                *****************************************



>C1
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C2
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C3
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C4
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C5
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C6
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C1
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C2
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C3
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C4
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C5
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C6
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 441 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790115
      Setting output file names to "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 13450136
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0486216105
      Seed = 288243108
      Swapseed = 1579790115
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -986.979145 -- -24.965149
         Chain 2 -- -986.979145 -- -24.965149
         Chain 3 -- -986.979088 -- -24.965149
         Chain 4 -- -986.979088 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -986.978994 -- -24.965149
         Chain 2 -- -986.979145 -- -24.965149
         Chain 3 -- -986.979145 -- -24.965149
         Chain 4 -- -986.978994 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-986.979] (-986.979) (-986.979) (-986.979) * [-986.979] (-986.979) (-986.979) (-986.979) 
        500 -- (-613.909) (-616.262) (-615.808) [-614.533] * (-630.356) [-613.625] (-613.820) (-613.081) -- 0:00:00
       1000 -- (-617.192) (-613.657) (-614.968) [-614.563] * (-615.351) [-611.900] (-617.297) (-619.264) -- 0:16:39
       1500 -- (-609.001) (-612.812) [-612.477] (-622.938) * [-613.510] (-617.663) (-619.379) (-615.470) -- 0:11:05
       2000 -- (-619.489) [-611.894] (-620.112) (-611.177) * [-611.727] (-611.272) (-615.145) (-616.968) -- 0:08:19
       2500 -- (-614.129) (-622.785) (-611.746) [-617.903] * (-608.536) (-617.893) (-610.891) [-610.472] -- 0:06:39
       3000 -- (-617.530) [-614.231] (-614.799) (-611.982) * (-613.636) (-617.452) (-613.604) [-608.388] -- 0:05:32
       3500 -- (-619.313) (-616.529) (-622.465) [-620.002] * (-613.020) [-618.249] (-616.822) (-619.229) -- 0:04:44
       4000 -- (-621.721) (-613.995) (-616.412) [-613.651] * (-615.884) (-612.183) [-613.965] (-611.066) -- 0:04:09
       4500 -- (-611.277) (-614.813) (-616.625) [-608.541] * (-613.556) (-620.334) [-610.691] (-611.164) -- 0:03:41
       5000 -- [-615.804] (-616.093) (-617.976) (-620.622) * (-618.463) (-618.100) (-613.174) [-627.507] -- 0:03:19

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-622.390) [-619.466] (-614.649) (-623.827) * [-614.795] (-616.211) (-615.363) (-627.217) -- 0:03:00
       6000 -- [-611.211] (-613.301) (-621.329) (-622.637) * (-619.349) (-620.027) [-614.234] (-616.850) -- 0:02:45
       6500 -- (-617.643) [-621.492] (-619.496) (-617.371) * [-613.067] (-613.502) (-619.767) (-612.806) -- 0:02:32
       7000 -- (-614.063) (-611.831) (-614.080) [-612.864] * (-615.215) (-626.809) [-611.819] (-612.303) -- 0:02:21
       7500 -- [-613.373] (-611.595) (-616.979) (-620.913) * (-615.047) [-611.600] (-614.058) (-624.471) -- 0:02:12
       8000 -- (-611.966) (-617.189) (-614.600) [-615.892] * [-616.408] (-630.153) (-617.968) (-620.947) -- 0:02:04
       8500 -- (-613.470) (-620.605) [-615.264] (-615.581) * (-621.761) (-620.298) (-612.643) [-615.705] -- 0:01:56
       9000 -- (-617.723) (-612.764) (-617.138) [-609.563] * (-616.274) (-613.113) (-617.266) [-608.804] -- 0:01:50
       9500 -- (-621.428) (-619.223) [-622.379] (-620.875) * (-615.398) [-615.465] (-614.495) (-617.180) -- 0:01:44
      10000 -- (-618.465) (-619.206) (-619.573) [-609.327] * (-618.463) (-614.943) (-614.626) [-611.245] -- 0:01:39

      Average standard deviation of split frequencies: 0.082864

      10500 -- (-620.818) (-618.308) [-610.652] (-618.190) * (-610.693) (-619.194) [-612.894] (-613.701) -- 0:01:34
      11000 -- [-611.065] (-615.871) (-611.831) (-623.696) * (-606.071) (-619.228) [-612.064] (-621.843) -- 0:01:29
      11500 -- (-619.605) [-621.369] (-609.951) (-617.218) * (-606.473) (-613.406) [-618.929] (-619.688) -- 0:01:25
      12000 -- [-613.744] (-613.096) (-617.139) (-613.405) * [-606.626] (-612.634) (-607.964) (-617.890) -- 0:01:22
      12500 -- (-620.623) (-623.024) [-620.084] (-611.463) * [-603.932] (-614.517) (-622.143) (-616.230) -- 0:01:19
      13000 -- (-617.966) (-616.313) [-616.849] (-615.773) * (-605.603) (-614.749) (-617.331) [-618.315] -- 0:01:15
      13500 -- (-618.320) (-614.243) (-614.857) [-611.375] * (-605.412) (-612.152) (-617.137) [-615.662] -- 0:01:13
      14000 -- (-622.467) (-627.504) (-612.732) [-618.913] * (-609.316) (-619.814) [-618.660] (-614.691) -- 0:01:10
      14500 -- (-608.987) (-609.370) [-610.597] (-611.129) * (-607.891) (-613.310) (-616.519) [-613.330] -- 0:01:07
      15000 -- [-616.087] (-608.806) (-617.861) (-612.218) * [-607.752] (-612.484) (-611.124) (-614.213) -- 0:01:05

      Average standard deviation of split frequencies: 0.038670

      15500 -- (-624.851) (-604.452) [-611.505] (-609.967) * (-607.424) (-616.241) (-614.233) [-612.343] -- 0:01:03
      16000 -- [-609.874] (-606.550) (-615.606) (-612.609) * (-607.192) [-609.417] (-611.985) (-615.121) -- 0:01:01
      16500 -- (-617.778) (-607.644) [-615.283] (-621.333) * (-608.666) [-605.472] (-617.294) (-622.245) -- 0:00:59
      17000 -- [-614.468] (-606.840) (-614.368) (-617.259) * [-606.733] (-608.183) (-619.593) (-617.437) -- 0:01:55
      17500 -- [-609.114] (-604.881) (-612.305) (-608.873) * (-605.008) [-604.488] (-616.720) (-616.397) -- 0:01:52
      18000 -- (-617.443) (-606.415) [-611.657] (-619.391) * [-603.673] (-603.927) (-617.447) (-614.211) -- 0:01:49
      18500 -- (-617.939) (-608.615) (-615.745) [-609.421] * (-608.731) (-605.738) (-611.445) [-612.238] -- 0:01:46
      19000 -- (-631.613) [-606.427] (-610.901) (-612.534) * (-609.736) [-606.331] (-615.740) (-617.423) -- 0:01:43
      19500 -- (-634.841) (-606.525) [-616.303] (-617.971) * (-605.137) (-607.111) [-610.209] (-611.618) -- 0:01:40
      20000 -- (-622.919) (-610.870) [-614.566] (-614.946) * (-604.846) (-608.904) (-618.588) [-616.013] -- 0:01:38

      Average standard deviation of split frequencies: 0.072992

      20500 -- (-605.477) [-608.254] (-624.045) (-614.598) * (-604.560) (-607.574) (-618.644) [-610.271] -- 0:01:35
      21000 -- (-605.776) [-605.206] (-615.250) (-611.907) * (-607.143) (-609.051) [-614.273] (-612.200) -- 0:01:33
      21500 -- (-604.155) (-606.382) (-613.463) [-613.601] * (-606.098) (-608.839) [-612.004] (-616.210) -- 0:01:31
      22000 -- [-605.195] (-606.480) (-616.443) (-616.262) * [-608.134] (-607.821) (-620.579) (-619.159) -- 0:01:28
      22500 -- (-606.996) (-606.527) [-612.175] (-616.511) * (-605.772) [-606.792] (-618.559) (-624.592) -- 0:01:26
      23000 -- (-604.826) (-603.971) (-615.569) [-611.857] * (-608.821) [-604.916] (-614.394) (-619.602) -- 0:01:24
      23500 -- (-604.734) [-604.222] (-618.392) (-612.021) * (-607.962) [-604.542] (-614.911) (-625.093) -- 0:01:23
      24000 -- (-604.909) [-605.146] (-623.999) (-618.405) * (-605.475) (-604.148) [-616.474] (-614.710) -- 0:01:21
      24500 -- [-607.133] (-605.573) (-607.966) (-609.326) * [-604.573] (-603.981) (-611.475) (-621.844) -- 0:01:19
      25000 -- (-604.755) [-604.494] (-605.470) (-615.002) * (-607.796) [-606.267] (-614.176) (-617.545) -- 0:01:18

      Average standard deviation of split frequencies: 0.046622

      25500 -- (-607.653) (-606.251) (-605.745) [-615.771] * (-607.880) (-608.996) (-612.589) [-619.603] -- 0:01:16
      26000 -- [-605.265] (-607.360) (-607.637) (-612.681) * (-607.764) (-606.903) (-613.639) [-611.295] -- 0:01:14
      26500 -- (-605.475) (-604.634) (-608.220) [-613.071] * (-605.930) [-605.666] (-615.078) (-615.718) -- 0:01:13
      27000 -- (-611.236) (-604.477) [-607.613] (-616.005) * (-606.288) (-605.140) (-620.873) [-620.094] -- 0:01:12
      27500 -- (-603.585) (-606.373) (-607.606) [-612.328] * (-609.996) [-609.182] (-619.369) (-610.807) -- 0:01:10
      28000 -- (-604.268) (-604.683) [-608.820] (-630.283) * (-607.410) (-605.596) [-615.652] (-614.184) -- 0:01:09
      28500 -- [-605.758] (-606.174) (-607.621) (-614.178) * (-606.554) (-605.853) [-619.300] (-614.068) -- 0:01:08
      29000 -- [-603.946] (-604.959) (-608.675) (-615.641) * (-609.936) [-606.016] (-622.384) (-617.732) -- 0:01:06
      29500 -- [-604.241] (-606.088) (-606.703) (-613.731) * [-606.796] (-607.764) (-627.886) (-613.887) -- 0:01:05
      30000 -- [-604.091] (-606.234) (-606.793) (-619.266) * [-605.572] (-608.128) (-617.166) (-617.025) -- 0:01:04

      Average standard deviation of split frequencies: 0.049776

      30500 -- (-604.129) (-606.162) [-605.874] (-621.785) * (-605.185) (-606.893) [-611.578] (-614.386) -- 0:01:03
      31000 -- [-606.221] (-606.466) (-606.342) (-618.526) * [-605.592] (-606.145) (-617.794) (-615.170) -- 0:01:02
      31500 -- (-610.294) (-607.483) (-605.087) [-616.774] * (-604.422) (-608.610) [-614.990] (-614.743) -- 0:01:01
      32000 -- (-609.310) [-604.444] (-606.845) (-616.108) * (-605.425) (-611.730) [-613.769] (-613.412) -- 0:01:00
      32500 -- (-607.027) (-607.926) [-609.364] (-613.502) * [-606.018] (-606.494) (-613.954) (-615.218) -- 0:00:59
      33000 -- (-606.900) (-604.904) (-605.309) [-612.630] * (-607.602) (-606.849) (-618.270) [-607.642] -- 0:00:58
      33500 -- (-606.245) [-608.048] (-604.854) (-618.606) * (-605.147) (-606.107) (-609.404) [-616.028] -- 0:00:57
      34000 -- (-607.631) (-604.405) (-605.138) [-611.729] * [-606.880] (-607.099) (-609.369) (-616.220) -- 0:01:25
      34500 -- (-607.078) [-604.623] (-605.634) (-613.414) * [-604.133] (-604.842) (-624.020) (-611.532) -- 0:01:23
      35000 -- (-607.725) (-606.097) (-605.101) [-615.565] * [-603.762] (-603.701) (-610.623) (-616.105) -- 0:01:22

      Average standard deviation of split frequencies: 0.043867

      35500 -- (-610.939) (-606.202) (-605.397) [-618.064] * (-603.671) [-605.541] (-620.510) (-612.266) -- 0:01:21
      36000 -- (-607.430) (-606.028) [-605.655] (-614.958) * (-609.662) (-607.389) [-613.185] (-618.257) -- 0:01:20
      36500 -- (-604.869) (-604.682) (-604.584) [-614.439] * (-606.611) (-605.451) (-618.278) [-613.080] -- 0:01:19
      37000 -- (-604.463) [-606.165] (-608.463) (-617.107) * [-606.020] (-604.427) (-614.863) (-612.793) -- 0:01:18
      37500 -- [-606.738] (-607.950) (-606.282) (-612.217) * [-607.048] (-604.274) (-616.884) (-609.717) -- 0:01:17
      38000 -- [-604.726] (-605.825) (-603.839) (-621.146) * [-604.222] (-604.260) (-617.429) (-624.267) -- 0:01:15
      38500 -- (-604.629) (-605.485) [-605.908] (-613.226) * (-604.476) [-604.812] (-613.838) (-628.739) -- 0:01:14
      39000 -- (-604.804) [-607.125] (-612.779) (-613.969) * [-604.640] (-606.715) (-610.366) (-622.205) -- 0:01:13
      39500 -- (-610.934) (-605.154) (-605.013) [-610.844] * (-605.520) [-604.779] (-614.729) (-621.217) -- 0:01:12
      40000 -- (-605.005) (-603.994) (-604.023) [-617.170] * (-606.263) (-606.049) [-610.229] (-604.192) -- 0:01:12

      Average standard deviation of split frequencies: 0.029895

      40500 -- (-605.101) [-608.991] (-607.268) (-617.788) * (-607.260) (-606.243) [-612.598] (-606.008) -- 0:01:11
      41000 -- (-608.631) (-607.126) (-608.032) [-613.185] * (-606.484) [-605.251] (-617.581) (-607.255) -- 0:01:10
      41500 -- [-606.927] (-606.145) (-606.610) (-611.816) * (-605.584) [-604.099] (-620.191) (-604.246) -- 0:01:09
      42000 -- (-606.789) [-604.466] (-608.215) (-615.827) * (-607.385) [-605.465] (-620.910) (-606.543) -- 0:01:08
      42500 -- (-605.098) (-605.564) (-607.074) [-619.433] * [-605.707] (-606.556) (-625.254) (-606.519) -- 0:01:07
      43000 -- (-607.882) (-604.579) (-607.440) [-613.254] * (-608.797) (-609.725) (-619.438) [-612.996] -- 0:01:06
      43500 -- (-607.654) (-604.905) [-607.246] (-619.150) * (-607.490) [-609.288] (-619.471) (-606.828) -- 0:01:05
      44000 -- [-604.346] (-604.195) (-605.986) (-619.849) * (-606.386) (-610.049) (-609.862) [-606.301] -- 0:01:05
      44500 -- (-604.497) (-609.998) (-607.950) [-615.072] * [-606.303] (-610.045) (-613.729) (-604.098) -- 0:01:04
      45000 -- (-604.350) (-609.143) [-609.157] (-610.950) * (-608.891) (-606.439) [-621.162] (-605.392) -- 0:01:03

      Average standard deviation of split frequencies: 0.025864

      45500 -- (-604.878) [-612.520] (-607.061) (-622.817) * (-605.026) (-606.117) [-618.056] (-604.614) -- 0:01:02
      46000 -- [-605.700] (-605.706) (-607.830) (-620.940) * (-604.783) [-604.898] (-615.117) (-604.753) -- 0:01:02
      46500 -- (-604.058) [-603.870] (-605.978) (-617.422) * (-606.023) (-605.886) [-613.307] (-604.568) -- 0:01:01
      47000 -- [-606.462] (-607.297) (-607.481) (-622.960) * (-606.535) (-606.213) [-613.073] (-606.448) -- 0:01:00
      47500 -- (-604.880) [-606.152] (-605.490) (-614.680) * [-604.556] (-606.941) (-616.377) (-607.888) -- 0:01:00
      48000 -- [-604.166] (-606.636) (-606.221) (-617.970) * (-608.887) [-609.795] (-613.406) (-605.781) -- 0:00:59
      48500 -- (-604.663) (-605.557) (-604.549) [-614.591] * [-604.595] (-612.609) (-617.086) (-608.756) -- 0:00:58
      49000 -- (-604.906) (-606.072) [-606.472] (-612.938) * [-605.996] (-609.345) (-615.582) (-607.446) -- 0:00:58
      49500 -- (-605.690) (-605.392) (-603.822) [-610.910] * (-607.437) (-606.161) (-615.469) [-605.515] -- 0:00:57
      50000 -- (-606.467) [-607.260] (-605.594) (-608.595) * (-605.959) (-605.587) (-617.626) [-603.589] -- 0:00:57

      Average standard deviation of split frequencies: 0.023260

      50500 -- (-605.444) (-607.014) [-605.619] (-611.839) * (-604.885) (-608.550) (-615.728) [-604.783] -- 0:00:56
      51000 -- (-604.609) (-609.643) (-605.619) [-616.247] * (-604.401) (-605.124) (-619.661) [-604.036] -- 0:01:14
      51500 -- (-605.500) [-604.393] (-608.660) (-613.877) * (-606.594) [-606.995] (-616.603) (-605.781) -- 0:01:13
      52000 -- (-604.727) (-604.532) (-606.051) [-617.617] * (-606.892) (-604.061) (-615.689) [-604.907] -- 0:01:12
      52500 -- (-611.110) (-604.276) (-605.363) [-611.944] * (-608.601) (-604.446) [-619.867] (-606.164) -- 0:01:12
      53000 -- (-604.416) [-604.302] (-606.669) (-615.690) * (-608.682) (-605.276) (-612.931) [-609.719] -- 0:01:11
      53500 -- (-604.500) [-604.330] (-608.393) (-617.959) * (-605.804) (-606.739) (-615.474) [-605.055] -- 0:01:10
      54000 -- (-604.966) (-605.917) [-606.714] (-619.333) * (-606.200) (-605.678) (-617.125) [-604.453] -- 0:01:10
      54500 -- [-605.186] (-609.671) (-607.848) (-633.282) * (-606.306) [-608.453] (-609.116) (-604.427) -- 0:01:09
      55000 -- (-606.841) (-609.591) [-604.544] (-613.714) * (-607.605) [-605.617] (-611.216) (-604.727) -- 0:01:08

      Average standard deviation of split frequencies: 0.027258

      55500 -- (-606.788) (-611.862) [-605.356] (-606.427) * (-606.907) (-606.097) (-612.629) [-606.550] -- 0:01:08
      56000 -- (-607.778) [-605.801] (-605.001) (-603.410) * (-605.455) (-606.127) [-612.654] (-606.482) -- 0:01:07
      56500 -- (-606.402) (-604.846) [-604.421] (-607.615) * (-606.251) [-605.762] (-615.881) (-605.975) -- 0:01:06
      57000 -- (-604.997) (-604.823) (-604.452) [-607.071] * (-605.054) (-605.806) (-616.071) [-605.853] -- 0:01:06
      57500 -- (-604.314) (-605.202) (-608.526) [-606.491] * [-604.487] (-606.324) (-620.918) (-605.097) -- 0:01:05
      58000 -- (-603.859) (-607.049) [-608.428] (-610.904) * (-606.667) [-604.502] (-613.647) (-607.763) -- 0:01:04
      58500 -- (-604.837) [-604.351] (-607.038) (-608.801) * (-606.719) (-605.032) (-620.108) [-608.374] -- 0:01:04
      59000 -- (-605.194) [-605.613] (-606.948) (-604.208) * [-605.498] (-606.473) (-613.650) (-605.385) -- 0:01:03
      59500 -- (-605.703) (-605.241) (-605.386) [-605.709] * [-605.482] (-605.882) (-618.545) (-606.768) -- 0:01:03
      60000 -- [-604.345] (-609.865) (-608.846) (-606.133) * (-605.865) (-607.391) (-615.191) [-604.844] -- 0:01:02

      Average standard deviation of split frequencies: 0.031788

      60500 -- (-605.241) (-607.064) (-606.041) [-609.761] * (-605.559) (-604.620) [-617.033] (-605.245) -- 0:01:02
      61000 -- (-605.445) [-604.601] (-606.828) (-611.342) * (-607.931) (-607.830) (-619.565) [-604.651] -- 0:01:01
      61500 -- (-608.092) [-605.289] (-604.738) (-607.806) * [-605.518] (-606.451) (-620.163) (-605.117) -- 0:01:01
      62000 -- (-613.889) (-606.213) [-606.644] (-604.517) * (-606.526) [-606.089] (-614.738) (-605.183) -- 0:01:00
      62500 -- (-607.842) [-608.330] (-604.008) (-604.539) * (-609.778) (-605.762) (-617.450) [-604.209] -- 0:01:00
      63000 -- (-604.499) [-605.392] (-606.409) (-604.607) * (-608.667) [-604.692] (-621.309) (-605.076) -- 0:00:59
      63500 -- (-604.732) (-607.884) [-604.710] (-605.717) * (-607.643) (-604.390) [-610.499] (-606.356) -- 0:00:58
      64000 -- (-605.310) (-605.959) [-606.741] (-609.052) * (-604.550) [-603.783] (-620.291) (-606.095) -- 0:00:58
      64500 -- [-605.458] (-605.575) (-605.211) (-605.904) * [-605.482] (-605.083) (-621.469) (-606.580) -- 0:00:58
      65000 -- (-606.711) (-607.185) [-611.572] (-606.375) * (-604.167) [-605.462] (-614.280) (-606.770) -- 0:00:57

      Average standard deviation of split frequencies: 0.031167

      65500 -- [-603.528] (-606.659) (-606.191) (-609.566) * [-608.432] (-607.598) (-616.896) (-606.850) -- 0:00:57
      66000 -- (-605.130) [-605.445] (-609.068) (-604.961) * [-606.158] (-604.179) (-616.067) (-605.742) -- 0:00:56
      66500 -- (-606.406) (-604.795) [-606.086] (-605.028) * (-604.820) (-606.813) (-617.372) [-606.496] -- 0:00:56
      67000 -- (-607.082) [-604.714] (-604.464) (-608.232) * [-603.496] (-604.123) (-615.079) (-605.058) -- 0:00:55
      67500 -- (-609.730) (-605.464) [-605.829] (-606.676) * (-604.389) (-604.074) (-616.429) [-604.643] -- 0:00:55
      68000 -- (-607.345) [-604.277] (-610.160) (-604.621) * [-604.023] (-604.439) (-619.853) (-605.992) -- 0:01:08
      68500 -- (-608.730) (-604.703) (-608.189) [-605.659] * (-604.882) (-609.029) (-611.680) [-606.155] -- 0:01:07
      69000 -- (-608.859) (-604.828) [-605.740] (-605.458) * [-603.816] (-604.941) (-622.949) (-604.954) -- 0:01:07
      69500 -- (-607.118) (-605.544) [-606.451] (-607.157) * [-604.523] (-608.665) (-615.673) (-608.721) -- 0:01:06
      70000 -- (-605.873) (-609.960) (-604.278) [-606.575] * [-605.614] (-606.294) (-613.889) (-607.387) -- 0:01:06

      Average standard deviation of split frequencies: 0.027017

      70500 -- [-607.006] (-605.392) (-606.405) (-606.923) * (-605.960) (-605.721) [-617.508] (-608.199) -- 0:01:05
      71000 -- (-605.265) (-604.738) (-606.505) [-604.289] * (-605.047) (-605.234) [-612.233] (-607.648) -- 0:01:05
      71500 -- (-605.352) [-604.853] (-608.479) (-605.830) * (-603.736) (-603.583) (-617.514) [-606.390] -- 0:01:04
      72000 -- (-607.024) (-604.234) [-605.204] (-604.197) * (-604.937) (-606.535) (-616.177) [-604.422] -- 0:01:04
      72500 -- (-603.888) [-605.490] (-604.529) (-605.670) * (-606.680) (-606.709) (-616.095) [-604.657] -- 0:01:03
      73000 -- (-605.234) [-609.710] (-604.422) (-604.739) * [-605.227] (-605.112) (-629.311) (-605.755) -- 0:01:03
      73500 -- (-608.868) (-606.203) [-605.182] (-607.928) * [-605.310] (-604.316) (-615.954) (-604.223) -- 0:01:03
      74000 -- [-605.169] (-605.070) (-605.494) (-609.102) * [-605.256] (-605.876) (-612.645) (-606.829) -- 0:01:02
      74500 -- (-606.485) (-604.054) (-609.074) [-605.193] * (-606.843) (-606.223) [-614.018] (-610.606) -- 0:01:02
      75000 -- (-606.518) (-605.489) (-610.276) [-607.072] * (-609.056) (-606.883) (-631.020) [-604.805] -- 0:01:01

      Average standard deviation of split frequencies: 0.022950

      75500 -- [-605.096] (-605.110) (-611.326) (-605.690) * (-607.494) (-605.363) (-625.933) [-604.381] -- 0:01:01
      76000 -- [-604.906] (-604.833) (-606.326) (-610.977) * [-605.918] (-607.895) (-612.905) (-604.543) -- 0:01:00
      76500 -- [-604.469] (-604.083) (-606.326) (-608.062) * [-605.457] (-605.067) (-604.338) (-606.776) -- 0:01:00
      77000 -- (-605.002) (-604.563) [-607.497] (-606.161) * (-605.932) (-607.881) [-604.635] (-605.019) -- 0:00:59
      77500 -- (-607.049) (-605.369) (-604.915) [-607.493] * (-604.415) (-605.003) [-604.163] (-604.155) -- 0:00:59
      78000 -- [-607.302] (-605.046) (-606.583) (-605.063) * (-606.041) (-605.916) (-608.321) [-605.081] -- 0:00:59
      78500 -- [-603.946] (-608.254) (-605.451) (-606.558) * (-607.041) (-604.809) [-607.133] (-606.689) -- 0:00:58
      79000 -- [-607.153] (-604.435) (-608.794) (-608.687) * (-608.954) (-604.006) [-604.580] (-604.199) -- 0:00:58
      79500 -- (-606.099) [-604.178] (-607.419) (-604.792) * [-606.862] (-608.006) (-609.203) (-604.802) -- 0:00:57
      80000 -- (-607.805) (-604.994) (-605.512) [-605.013] * [-606.062] (-606.455) (-605.170) (-607.232) -- 0:00:57

      Average standard deviation of split frequencies: 0.024913

      80500 -- (-607.016) [-604.426] (-605.585) (-605.934) * (-605.027) [-608.280] (-607.170) (-605.828) -- 0:00:57
      81000 -- [-608.409] (-604.316) (-606.207) (-606.716) * (-608.139) (-605.206) [-605.619] (-606.083) -- 0:00:56
      81500 -- (-605.871) (-606.716) (-607.275) [-607.182] * (-606.210) [-604.511] (-605.233) (-605.146) -- 0:00:56
      82000 -- (-605.221) (-610.414) [-604.800] (-609.607) * [-603.642] (-606.337) (-605.264) (-604.578) -- 0:00:55
      82500 -- [-605.588] (-608.316) (-604.712) (-608.880) * [-603.936] (-604.583) (-608.494) (-603.654) -- 0:00:55
      83000 -- [-606.451] (-604.471) (-605.064) (-606.605) * [-606.512] (-604.043) (-605.993) (-604.985) -- 0:00:55
      83500 -- [-604.230] (-606.947) (-605.842) (-610.270) * [-605.680] (-608.825) (-606.210) (-608.116) -- 0:00:54
      84000 -- (-604.228) [-604.043] (-612.142) (-605.319) * [-604.787] (-605.095) (-606.210) (-606.033) -- 0:00:54
      84500 -- [-604.564] (-605.242) (-605.909) (-607.510) * (-605.423) (-606.347) (-604.745) [-605.562] -- 0:00:54
      85000 -- [-606.679] (-603.784) (-610.066) (-613.039) * [-606.465] (-604.983) (-604.143) (-608.723) -- 0:01:04

      Average standard deviation of split frequencies: 0.024797

      85500 -- (-606.488) [-604.679] (-608.347) (-605.404) * (-613.089) [-605.564] (-607.083) (-611.223) -- 0:01:04
      86000 -- (-603.951) [-604.064] (-607.136) (-605.121) * (-604.003) [-608.807] (-604.231) (-606.507) -- 0:01:03
      86500 -- (-604.941) (-604.628) [-605.371] (-605.062) * (-606.542) (-606.806) (-606.584) [-604.773] -- 0:01:03
      87000 -- (-603.885) (-604.629) [-605.702] (-607.099) * (-606.196) [-605.948] (-606.630) (-606.428) -- 0:01:02
      87500 -- (-609.085) (-606.404) [-604.640] (-606.509) * (-606.448) (-603.683) (-608.535) [-604.920] -- 0:01:02
      88000 -- (-608.337) (-607.052) [-603.974] (-605.366) * (-611.267) (-606.110) (-608.228) [-604.112] -- 0:01:02
      88500 -- (-607.788) (-609.576) (-606.572) [-604.839] * (-604.878) (-606.874) [-606.387] (-613.631) -- 0:01:01
      89000 -- (-607.883) (-608.231) [-606.777] (-606.574) * (-603.564) [-607.157] (-606.400) (-611.536) -- 0:01:01
      89500 -- (-606.407) (-603.992) (-605.968) [-605.813] * (-604.394) (-607.014) (-604.947) [-603.580] -- 0:01:01
      90000 -- [-606.818] (-604.941) (-607.879) (-606.290) * (-608.538) [-607.179] (-605.466) (-607.739) -- 0:01:00

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-605.798) (-609.048) [-606.849] (-606.897) * (-606.903) (-604.253) [-606.814] (-607.445) -- 0:01:00
      91000 -- (-605.512) (-607.083) [-607.015] (-605.082) * [-605.569] (-608.348) (-605.110) (-608.219) -- 0:00:59
      91500 -- (-608.610) (-605.363) [-606.173] (-604.155) * (-605.352) (-606.598) [-607.069] (-606.182) -- 0:00:59
      92000 -- (-612.025) (-606.119) (-608.464) [-604.558] * [-606.344] (-606.170) (-605.151) (-606.581) -- 0:00:59
      92500 -- (-608.465) (-606.889) [-604.350] (-604.248) * (-606.880) (-606.744) (-607.120) [-604.171] -- 0:00:58
      93000 -- (-606.794) (-604.712) [-607.142] (-607.834) * (-614.477) [-605.660] (-605.489) (-604.909) -- 0:00:58
      93500 -- (-604.050) (-606.958) [-606.966] (-606.252) * (-604.897) (-606.897) [-607.293] (-607.567) -- 0:00:58
      94000 -- [-603.731] (-608.436) (-605.384) (-608.430) * [-604.459] (-608.091) (-606.565) (-606.164) -- 0:00:57
      94500 -- [-606.227] (-604.867) (-608.766) (-612.323) * (-605.077) (-604.193) (-607.076) [-604.944] -- 0:00:57
      95000 -- (-607.634) (-607.292) [-606.806] (-604.505) * (-607.224) [-605.330] (-606.755) (-605.260) -- 0:00:57

      Average standard deviation of split frequencies: 0.025069

      95500 -- (-604.834) (-608.419) [-606.476] (-605.066) * (-604.740) [-605.445] (-607.049) (-605.377) -- 0:00:56
      96000 -- (-603.894) (-607.155) (-606.725) [-604.157] * (-608.187) (-606.373) (-604.952) [-606.435] -- 0:00:56
      96500 -- (-607.688) (-605.450) (-608.167) [-609.263] * (-607.309) (-605.744) (-604.945) [-603.830] -- 0:00:56
      97000 -- (-606.104) (-608.321) [-605.198] (-610.578) * [-605.454] (-608.701) (-607.664) (-603.766) -- 0:00:55
      97500 -- [-605.215] (-606.286) (-605.733) (-604.774) * (-605.028) [-606.496] (-607.336) (-605.298) -- 0:00:55
      98000 -- (-604.954) [-605.072] (-606.268) (-605.726) * (-607.594) (-604.558) [-605.448] (-605.239) -- 0:00:55
      98500 -- [-607.015] (-605.461) (-609.649) (-607.003) * (-604.947) [-604.629] (-607.193) (-605.360) -- 0:00:54
      99000 -- (-606.679) (-605.162) (-605.884) [-605.061] * (-603.861) (-604.937) (-607.042) [-603.500] -- 0:00:54
      99500 -- (-606.272) (-603.861) (-605.633) [-604.992] * [-604.472] (-607.817) (-609.114) (-603.581) -- 0:00:54
      100000 -- (-605.993) (-605.299) (-604.476) [-607.984] * (-604.054) (-609.784) (-608.940) [-604.724] -- 0:00:54

      Average standard deviation of split frequencies: 0.024715

      100500 -- (-605.388) (-606.435) [-606.388] (-603.909) * (-606.241) (-606.697) (-609.609) [-605.669] -- 0:00:53
      101000 -- (-604.479) (-606.696) (-604.413) [-604.583] * (-607.164) (-605.986) (-608.737) [-607.907] -- 0:00:53
      101500 -- (-606.088) (-606.268) [-609.564] (-609.454) * (-604.708) [-604.891] (-604.876) (-606.563) -- 0:01:01
      102000 -- (-606.114) (-606.080) (-609.492) [-604.981] * (-604.582) (-607.908) [-606.282] (-608.015) -- 0:01:01
      102500 -- (-604.616) (-605.005) [-606.212] (-606.789) * (-605.679) (-608.499) (-604.935) [-606.732] -- 0:01:01
      103000 -- (-607.200) (-606.015) (-606.601) [-605.015] * [-604.877] (-607.319) (-606.749) (-607.585) -- 0:01:00
      103500 -- (-604.907) (-605.814) [-605.755] (-608.677) * [-604.495] (-604.310) (-605.738) (-605.186) -- 0:01:00
      104000 -- [-606.060] (-607.150) (-605.787) (-606.723) * (-604.914) [-605.354] (-608.468) (-604.846) -- 0:01:00
      104500 -- (-604.996) (-610.519) [-607.758] (-604.280) * [-603.630] (-608.203) (-604.989) (-605.835) -- 0:00:59
      105000 -- (-603.724) (-608.084) [-605.850] (-606.064) * (-604.431) [-606.530] (-606.346) (-605.504) -- 0:00:59

      Average standard deviation of split frequencies: 0.022236

      105500 -- (-608.536) (-607.848) (-604.349) [-604.891] * [-603.623] (-607.505) (-605.883) (-604.776) -- 0:00:59
      106000 -- (-610.968) (-607.964) [-607.121] (-603.539) * (-604.780) (-605.188) [-606.579] (-604.893) -- 0:00:59
      106500 -- (-608.918) [-607.004] (-607.062) (-606.067) * [-604.344] (-606.790) (-605.436) (-604.378) -- 0:00:58
      107000 -- (-605.164) (-607.105) (-607.107) [-607.222] * (-607.005) (-605.485) (-604.666) [-605.624] -- 0:00:58
      107500 -- (-606.143) (-604.815) [-605.033] (-606.988) * [-605.337] (-604.884) (-610.559) (-606.487) -- 0:00:58
      108000 -- (-605.959) [-605.833] (-606.471) (-607.285) * (-605.921) [-606.871] (-609.760) (-607.103) -- 0:00:57
      108500 -- (-605.873) (-605.897) [-605.442] (-605.798) * (-604.987) (-607.140) (-606.813) [-606.528] -- 0:00:57
      109000 -- (-606.510) (-605.110) [-603.694] (-607.883) * (-606.475) (-606.028) [-605.441] (-605.198) -- 0:00:57
      109500 -- (-608.102) (-604.363) (-604.356) [-607.542] * [-607.140] (-605.652) (-607.878) (-605.436) -- 0:00:56
      110000 -- (-607.358) (-605.787) [-604.277] (-604.904) * [-604.828] (-605.976) (-608.234) (-605.424) -- 0:00:56

      Average standard deviation of split frequencies: 0.023540

      110500 -- (-606.080) [-604.966] (-605.105) (-606.377) * [-604.784] (-604.798) (-606.924) (-604.381) -- 0:00:56
      111000 -- (-607.942) (-604.482) [-604.848] (-611.371) * (-608.361) (-604.188) (-607.576) [-604.949] -- 0:00:56
      111500 -- (-604.973) [-604.322] (-604.416) (-607.717) * (-609.332) [-606.666] (-610.711) (-604.731) -- 0:00:55
      112000 -- (-604.242) (-612.183) [-603.709] (-608.507) * (-607.102) [-606.133] (-604.982) (-611.559) -- 0:00:55
      112500 -- (-603.924) (-607.522) (-604.803) [-609.248] * (-606.349) [-606.937] (-604.038) (-605.684) -- 0:00:55
      113000 -- (-605.762) (-608.018) (-605.896) [-607.721] * [-606.055] (-606.292) (-608.314) (-608.561) -- 0:00:54
      113500 -- (-605.421) (-615.120) [-606.176] (-605.918) * [-605.556] (-604.537) (-605.539) (-606.518) -- 0:00:54
      114000 -- (-607.134) (-612.882) (-608.675) [-605.559] * (-606.499) (-607.301) [-604.622] (-605.201) -- 0:00:54
      114500 -- (-605.831) (-609.067) (-608.218) [-604.453] * (-605.073) (-604.945) [-608.919] (-604.475) -- 0:00:54
      115000 -- (-605.728) (-605.084) [-606.380] (-604.092) * (-606.310) [-605.391] (-605.860) (-604.073) -- 0:00:53

      Average standard deviation of split frequencies: 0.021900

      115500 -- (-605.642) (-608.093) (-604.039) [-605.718] * [-603.624] (-605.155) (-604.232) (-605.867) -- 0:00:53
      116000 -- (-604.670) (-605.444) (-608.588) [-608.641] * (-604.166) (-606.767) [-604.737] (-604.446) -- 0:00:53
      116500 -- [-605.623] (-604.104) (-611.246) (-603.843) * [-605.825] (-604.180) (-606.052) (-605.159) -- 0:00:53
      117000 -- (-605.802) (-604.226) (-605.472) [-603.820] * (-604.864) (-604.731) (-604.787) [-604.079] -- 0:00:52
      117500 -- (-607.743) (-604.751) (-605.399) [-606.881] * [-606.570] (-607.917) (-604.248) (-605.600) -- 0:00:52
      118000 -- (-610.167) [-603.616] (-604.839) (-604.383) * (-607.246) [-607.184] (-606.602) (-604.785) -- 0:00:52
      118500 -- (-613.335) (-607.224) (-610.240) [-603.868] * (-609.267) (-605.975) [-605.593] (-605.566) -- 0:00:59
      119000 -- (-609.244) (-606.522) (-607.900) [-604.485] * (-604.046) [-603.581] (-605.872) (-605.375) -- 0:00:59
      119500 -- [-605.542] (-604.546) (-605.480) (-605.084) * [-603.966] (-607.209) (-607.120) (-605.691) -- 0:00:58
      120000 -- [-606.250] (-604.675) (-606.231) (-612.649) * (-604.128) (-606.719) (-605.977) [-605.240] -- 0:00:58

      Average standard deviation of split frequencies: 0.022412

      120500 -- (-606.703) [-605.306] (-606.150) (-606.267) * (-605.774) (-608.061) (-609.028) [-605.138] -- 0:00:58
      121000 -- [-606.940] (-604.996) (-605.521) (-606.661) * (-609.340) (-607.775) [-607.604] (-609.422) -- 0:00:58
      121500 -- (-606.126) [-605.992] (-604.910) (-606.674) * (-609.062) (-607.620) (-604.865) [-604.615] -- 0:00:57
      122000 -- (-605.256) (-605.137) [-607.559] (-605.652) * (-604.161) (-605.205) [-604.927] (-610.080) -- 0:00:57
      122500 -- (-604.479) (-606.184) [-605.862] (-605.053) * (-607.452) [-606.550] (-603.784) (-608.450) -- 0:00:57
      123000 -- (-604.054) (-606.756) [-604.552] (-605.745) * [-604.865] (-608.483) (-605.803) (-608.456) -- 0:00:57
      123500 -- [-603.887] (-604.019) (-604.794) (-605.831) * (-606.798) [-604.317] (-605.532) (-609.625) -- 0:00:56
      124000 -- [-607.208] (-603.949) (-605.573) (-606.009) * [-605.634] (-605.273) (-604.887) (-608.506) -- 0:00:56
      124500 -- (-607.839) (-604.777) (-610.510) [-606.142] * (-605.087) [-604.142] (-604.340) (-608.236) -- 0:00:56
      125000 -- [-604.996] (-606.821) (-611.495) (-606.430) * (-607.314) (-605.246) [-605.135] (-606.576) -- 0:00:56

      Average standard deviation of split frequencies: 0.019888

      125500 -- (-607.636) (-607.548) [-605.606] (-608.376) * (-605.456) [-604.333] (-604.897) (-606.064) -- 0:00:55
      126000 -- (-603.969) (-604.860) [-606.762] (-605.901) * (-606.318) (-604.323) (-606.184) [-605.706] -- 0:00:55
      126500 -- (-606.041) (-604.481) (-610.116) [-605.034] * [-605.593] (-606.130) (-609.595) (-605.178) -- 0:00:55
      127000 -- (-609.607) (-604.731) (-607.263) [-606.893] * [-604.203] (-607.067) (-604.840) (-605.918) -- 0:00:54
      127500 -- (-610.221) (-607.290) (-607.229) [-607.936] * (-603.801) (-605.768) [-605.318] (-606.670) -- 0:00:54
      128000 -- (-605.864) (-605.726) [-607.887] (-613.735) * (-604.238) [-605.397] (-606.017) (-603.975) -- 0:00:54
      128500 -- (-606.341) [-605.964] (-606.717) (-606.579) * (-606.075) (-608.534) [-606.568] (-605.048) -- 0:00:54
      129000 -- [-603.988] (-608.284) (-605.814) (-606.663) * (-610.754) (-604.692) [-606.198] (-609.039) -- 0:00:54
      129500 -- (-604.632) (-607.248) [-605.114] (-607.995) * (-609.497) [-606.395] (-603.628) (-607.442) -- 0:00:53
      130000 -- (-604.902) [-607.370] (-606.263) (-603.909) * (-605.141) (-606.618) (-608.360) [-606.417] -- 0:00:53

      Average standard deviation of split frequencies: 0.018439

      130500 -- (-608.221) (-606.277) [-603.540] (-604.114) * (-607.109) (-605.967) (-604.954) [-605.929] -- 0:00:53
      131000 -- (-604.933) [-605.100] (-608.778) (-606.707) * [-604.516] (-608.453) (-606.141) (-604.355) -- 0:00:53
      131500 -- (-606.282) (-604.669) (-607.487) [-605.457] * [-604.413] (-609.964) (-606.513) (-605.238) -- 0:00:52
      132000 -- (-608.586) (-604.861) [-604.272] (-604.051) * (-611.144) (-612.052) [-607.781] (-607.632) -- 0:00:52
      132500 -- (-605.244) (-605.369) (-608.846) [-603.995] * (-607.847) (-605.786) [-606.297] (-606.373) -- 0:00:52
      133000 -- (-609.892) (-604.603) (-603.846) [-604.956] * [-604.961] (-605.957) (-604.122) (-604.868) -- 0:00:52
      133500 -- (-604.681) (-604.267) (-612.239) [-605.289] * [-606.436] (-603.865) (-603.945) (-604.298) -- 0:00:51
      134000 -- [-604.223] (-605.025) (-606.151) (-604.797) * [-606.983] (-604.573) (-606.618) (-606.254) -- 0:00:51
      134500 -- [-604.146] (-610.317) (-610.996) (-606.359) * (-613.063) [-605.199] (-605.995) (-608.329) -- 0:00:51
      135000 -- (-603.916) (-606.054) [-605.208] (-606.924) * [-604.875] (-605.821) (-604.416) (-606.826) -- 0:00:51

      Average standard deviation of split frequencies: 0.017716

      135500 -- (-607.075) (-605.983) (-604.392) [-604.273] * [-606.066] (-607.072) (-604.853) (-608.841) -- 0:00:57
      136000 -- (-606.571) [-605.074] (-603.924) (-604.793) * [-605.385] (-606.709) (-604.122) (-617.350) -- 0:00:57
      136500 -- (-605.653) (-605.991) (-606.657) [-606.487] * (-605.483) (-608.558) (-604.666) [-606.495] -- 0:00:56
      137000 -- (-607.139) (-604.164) (-604.987) [-607.893] * (-606.997) (-605.507) [-604.996] (-606.380) -- 0:00:56
      137500 -- (-604.231) [-604.310] (-604.929) (-608.456) * (-606.446) [-607.812] (-606.840) (-608.102) -- 0:00:56
      138000 -- [-604.256] (-604.799) (-604.225) (-607.794) * (-603.988) [-604.589] (-604.149) (-606.988) -- 0:00:56
      138500 -- (-605.679) (-604.053) (-605.575) [-606.283] * (-604.032) (-606.613) [-604.645] (-605.737) -- 0:00:55
      139000 -- (-609.109) (-604.682) [-605.215] (-604.760) * (-604.747) (-603.916) (-604.537) [-604.779] -- 0:00:55
      139500 -- [-604.181] (-604.855) (-604.917) (-605.877) * (-604.144) [-607.640] (-606.105) (-608.334) -- 0:00:55
      140000 -- (-604.947) (-604.592) [-606.807] (-604.529) * [-603.977] (-607.699) (-604.521) (-605.204) -- 0:00:55

      Average standard deviation of split frequencies: 0.017501

      140500 -- [-605.542] (-605.924) (-607.526) (-613.089) * (-607.629) [-607.310] (-606.881) (-604.954) -- 0:00:55
      141000 -- (-606.141) (-605.605) (-605.057) [-607.752] * (-605.303) (-609.453) (-603.684) [-604.581] -- 0:00:54
      141500 -- (-605.006) (-604.787) (-605.128) [-606.955] * (-606.383) (-611.186) (-603.702) [-607.410] -- 0:00:54
      142000 -- (-604.918) (-607.886) [-605.367] (-605.262) * (-604.694) (-605.576) (-604.988) [-607.307] -- 0:00:54
      142500 -- (-605.859) (-607.110) (-606.386) [-605.710] * (-606.380) (-606.781) (-605.156) [-604.186] -- 0:00:54
      143000 -- (-605.492) (-607.084) (-606.899) [-604.366] * (-608.022) (-605.283) (-604.092) [-605.377] -- 0:00:53
      143500 -- [-606.690] (-608.571) (-605.088) (-603.939) * [-606.497] (-605.798) (-604.772) (-605.757) -- 0:00:53
      144000 -- (-606.763) (-606.254) [-604.958] (-604.509) * (-605.866) [-605.136] (-604.502) (-610.081) -- 0:00:53
      144500 -- [-604.233] (-610.541) (-604.141) (-604.498) * [-606.408] (-604.994) (-606.286) (-609.260) -- 0:00:53
      145000 -- (-603.722) (-607.292) [-605.691] (-607.632) * [-605.055] (-607.248) (-608.312) (-606.881) -- 0:00:53

      Average standard deviation of split frequencies: 0.016503

      145500 -- [-605.085] (-606.934) (-606.224) (-606.872) * (-604.756) [-604.985] (-604.410) (-605.892) -- 0:00:52
      146000 -- (-604.187) (-606.260) (-605.474) [-603.936] * (-605.096) (-605.973) [-603.947] (-606.817) -- 0:00:52
      146500 -- (-607.061) (-607.472) [-606.321] (-604.698) * [-605.386] (-605.988) (-604.540) (-604.262) -- 0:00:52
      147000 -- (-604.410) (-604.099) (-604.185) [-604.134] * [-605.081] (-607.357) (-604.098) (-604.978) -- 0:00:52
      147500 -- (-604.589) (-605.773) (-606.168) [-606.175] * [-608.881] (-605.364) (-604.457) (-606.983) -- 0:00:52
      148000 -- (-607.810) (-605.550) (-605.999) [-605.499] * (-605.243) (-605.450) [-605.132] (-605.131) -- 0:00:51
      148500 -- (-604.368) [-609.181] (-605.776) (-603.674) * [-605.450] (-606.018) (-605.588) (-607.866) -- 0:00:51
      149000 -- (-604.747) (-609.417) (-606.485) [-605.717] * (-608.668) (-608.220) (-605.305) [-606.394] -- 0:00:51
      149500 -- [-604.365] (-607.830) (-605.841) (-604.407) * (-609.179) (-609.294) [-605.700] (-606.592) -- 0:00:51
      150000 -- (-608.408) [-603.576] (-603.837) (-607.996) * (-608.270) (-606.659) (-604.718) [-605.872] -- 0:00:51

      Average standard deviation of split frequencies: 0.017556

      150500 -- [-605.417] (-605.406) (-610.113) (-608.640) * [-605.003] (-606.729) (-607.651) (-604.583) -- 0:00:50
      151000 -- (-606.781) [-604.753] (-612.402) (-606.668) * (-605.448) (-605.493) (-607.668) [-607.401] -- 0:00:50
      151500 -- (-604.963) (-606.914) [-604.358] (-607.220) * (-607.324) (-605.874) (-607.523) [-607.604] -- 0:00:50
      152000 -- (-605.743) (-607.174) [-606.006] (-604.992) * (-610.914) (-604.733) (-607.541) [-607.104] -- 0:00:55
      152500 -- (-604.147) (-606.174) [-606.530] (-605.408) * (-614.199) (-607.107) [-603.879] (-611.944) -- 0:00:55
      153000 -- (-604.684) (-605.690) (-605.507) [-605.455] * [-606.882] (-609.360) (-605.207) (-609.628) -- 0:00:55
      153500 -- (-603.875) [-605.087] (-604.780) (-604.854) * [-604.177] (-605.576) (-609.381) (-605.136) -- 0:00:55
      154000 -- [-606.071] (-604.317) (-604.415) (-606.035) * (-604.739) (-604.490) [-607.110] (-605.242) -- 0:00:54
      154500 -- (-606.789) (-607.339) [-604.716] (-609.561) * (-607.957) (-605.870) [-606.068] (-606.011) -- 0:00:54
      155000 -- (-607.080) (-606.567) (-604.018) [-607.140] * (-612.330) (-605.760) (-605.267) [-607.489] -- 0:00:54

      Average standard deviation of split frequencies: 0.017627

      155500 -- (-605.464) (-606.380) (-608.324) [-605.634] * [-604.650] (-604.122) (-606.012) (-604.741) -- 0:00:54
      156000 -- [-603.580] (-608.534) (-607.097) (-606.756) * [-603.722] (-604.942) (-609.628) (-606.373) -- 0:00:54
      156500 -- (-603.854) (-605.815) [-606.242] (-612.347) * (-604.496) (-605.539) (-606.929) [-604.691] -- 0:00:53
      157000 -- (-604.405) (-608.001) (-604.704) [-606.138] * (-603.840) (-607.191) (-606.204) [-605.989] -- 0:00:53
      157500 -- (-605.199) (-607.192) (-605.592) [-604.653] * (-603.954) (-605.178) [-603.951] (-607.914) -- 0:00:53
      158000 -- [-603.555] (-605.715) (-606.133) (-605.385) * [-605.647] (-603.590) (-603.763) (-607.430) -- 0:00:53
      158500 -- (-606.087) (-604.321) (-604.145) [-606.769] * (-608.247) (-604.874) (-605.850) [-603.389] -- 0:00:53
      159000 -- [-604.992] (-607.504) (-605.060) (-606.050) * [-608.147] (-607.226) (-609.229) (-605.049) -- 0:00:52
      159500 -- (-609.933) (-607.277) (-607.944) [-604.790] * (-606.344) (-604.741) (-609.450) [-604.609] -- 0:00:52
      160000 -- (-607.073) (-609.837) [-603.680] (-605.996) * (-605.736) (-606.243) [-607.317] (-604.314) -- 0:00:52

      Average standard deviation of split frequencies: 0.019071

      160500 -- (-608.593) (-606.074) [-606.220] (-607.767) * [-605.247] (-604.122) (-607.851) (-607.207) -- 0:00:52
      161000 -- (-604.490) (-605.008) (-605.339) [-605.267] * [-605.138] (-604.239) (-605.055) (-606.830) -- 0:00:52
      161500 -- (-606.555) [-603.679] (-606.948) (-604.686) * (-604.393) (-607.565) [-605.018] (-604.815) -- 0:00:51
      162000 -- (-604.932) [-604.361] (-605.231) (-605.762) * [-610.814] (-605.791) (-605.362) (-606.927) -- 0:00:51
      162500 -- (-605.258) [-604.752] (-605.927) (-605.253) * (-605.441) [-605.299] (-605.023) (-607.951) -- 0:00:51
      163000 -- (-604.370) [-605.522] (-604.357) (-605.495) * (-603.673) [-605.447] (-605.092) (-604.341) -- 0:00:51
      163500 -- (-605.076) [-606.483] (-605.395) (-610.537) * (-607.898) (-605.692) [-605.325] (-605.908) -- 0:00:51
      164000 -- (-604.482) (-604.382) [-608.995] (-609.750) * (-609.653) (-605.005) [-604.389] (-606.488) -- 0:00:50
      164500 -- (-604.523) (-605.210) [-605.308] (-610.207) * (-607.835) [-607.817] (-606.468) (-607.102) -- 0:00:50
      165000 -- (-606.283) (-605.510) (-609.348) [-607.314] * (-607.761) [-604.193] (-605.916) (-609.039) -- 0:00:50

      Average standard deviation of split frequencies: 0.017828

      165500 -- (-607.016) (-605.431) (-608.274) [-609.598] * (-604.568) (-604.197) [-605.076] (-604.618) -- 0:00:50
      166000 -- (-606.384) (-606.149) (-609.235) [-609.052] * (-605.812) (-605.474) (-605.549) [-604.389] -- 0:00:50
      166500 -- (-606.667) [-604.175] (-606.192) (-607.350) * (-603.723) (-607.699) (-607.298) [-606.082] -- 0:00:50
      167000 -- (-604.567) (-603.616) [-605.897] (-608.976) * [-608.056] (-604.775) (-604.508) (-606.364) -- 0:00:49
      167500 -- (-611.292) [-606.285] (-607.205) (-605.115) * (-609.909) (-610.853) [-604.436] (-605.697) -- 0:00:49
      168000 -- (-604.831) (-605.727) (-607.628) [-605.686] * (-608.243) (-610.121) (-606.155) [-607.280] -- 0:00:49
      168500 -- (-608.120) (-608.374) (-607.344) [-605.929] * [-604.789] (-606.704) (-604.845) (-607.031) -- 0:00:49
      169000 -- (-603.691) [-608.285] (-605.299) (-605.959) * (-604.099) (-606.087) (-607.822) [-605.303] -- 0:00:54
      169500 -- [-603.650] (-611.189) (-604.868) (-616.952) * (-603.871) [-604.910] (-606.191) (-607.437) -- 0:00:53
      170000 -- (-604.125) [-606.914] (-604.638) (-612.287) * (-604.198) [-604.319] (-604.812) (-609.494) -- 0:00:53

      Average standard deviation of split frequencies: 0.016137

      170500 -- (-604.214) [-605.622] (-604.351) (-610.100) * (-604.156) (-604.618) (-608.862) [-605.151] -- 0:00:53
      171000 -- [-607.794] (-605.281) (-603.956) (-604.671) * (-606.368) (-604.064) (-606.652) [-607.675] -- 0:00:53
      171500 -- (-606.054) [-607.197] (-606.364) (-604.518) * (-606.369) [-604.064] (-609.361) (-605.064) -- 0:00:53
      172000 -- (-604.847) [-604.198] (-605.308) (-606.169) * (-606.406) [-604.763] (-609.234) (-616.429) -- 0:00:52
      172500 -- (-606.525) [-603.897] (-604.942) (-608.613) * (-605.879) [-604.945] (-613.157) (-604.512) -- 0:00:52
      173000 -- (-604.722) (-604.286) (-605.318) [-607.066] * [-604.388] (-604.502) (-607.970) (-603.748) -- 0:00:52
      173500 -- (-604.849) (-604.434) (-605.300) [-606.183] * [-606.303] (-606.645) (-610.631) (-603.977) -- 0:00:52
      174000 -- (-604.716) (-605.363) [-605.550] (-606.346) * (-606.565) (-608.440) (-607.444) [-604.080] -- 0:00:52
      174500 -- (-606.143) (-605.769) [-604.535] (-604.492) * (-604.898) (-605.472) (-603.866) [-605.375] -- 0:00:52
      175000 -- (-611.194) (-604.273) [-604.717] (-606.434) * (-604.923) (-610.820) (-605.391) [-605.454] -- 0:00:51

      Average standard deviation of split frequencies: 0.014802

      175500 -- (-607.960) [-604.231] (-606.745) (-604.523) * [-604.665] (-606.197) (-605.331) (-608.498) -- 0:00:51
      176000 -- [-605.352] (-604.897) (-605.313) (-608.782) * (-607.084) [-606.257] (-605.574) (-608.699) -- 0:00:51
      176500 -- (-605.126) [-606.004] (-607.508) (-604.598) * (-609.028) (-606.826) (-607.803) [-607.292] -- 0:00:51
      177000 -- (-605.319) [-607.256] (-605.982) (-606.869) * (-607.906) (-607.197) (-610.110) [-606.176] -- 0:00:51
      177500 -- (-605.770) (-605.788) (-605.090) [-604.247] * (-607.000) (-603.916) [-604.255] (-605.057) -- 0:00:50
      178000 -- (-604.381) [-607.265] (-609.502) (-607.098) * (-603.996) (-607.954) (-606.913) [-604.264] -- 0:00:50
      178500 -- [-609.916] (-607.200) (-607.128) (-606.123) * (-609.735) (-605.121) [-609.002] (-603.985) -- 0:00:50
      179000 -- (-604.289) [-605.791] (-607.295) (-606.621) * (-607.215) (-605.760) [-603.909] (-604.600) -- 0:00:50
      179500 -- (-604.578) (-610.370) (-606.106) [-607.234] * [-605.269] (-607.299) (-603.914) (-606.154) -- 0:00:50
      180000 -- (-607.256) [-605.964] (-607.414) (-604.620) * (-610.355) [-606.092] (-605.716) (-607.323) -- 0:00:50

      Average standard deviation of split frequencies: 0.014351

      180500 -- [-606.282] (-606.772) (-609.513) (-604.916) * [-605.408] (-604.753) (-604.885) (-604.065) -- 0:00:49
      181000 -- (-604.784) [-607.168] (-606.423) (-606.059) * (-605.909) (-604.770) [-604.312] (-604.083) -- 0:00:49
      181500 -- (-603.889) [-605.580] (-608.966) (-606.129) * (-604.600) (-607.362) [-608.409] (-604.536) -- 0:00:49
      182000 -- (-605.516) (-603.733) [-604.186] (-604.985) * [-604.411] (-605.559) (-606.443) (-608.938) -- 0:00:49
      182500 -- (-604.688) (-606.384) [-604.538] (-605.500) * (-603.948) [-603.762] (-606.801) (-605.295) -- 0:00:49
      183000 -- (-604.364) (-605.169) (-606.071) [-604.633] * (-605.432) [-606.401] (-607.236) (-606.246) -- 0:00:49
      183500 -- (-605.466) (-605.396) [-605.460] (-604.581) * (-609.669) [-606.734] (-610.273) (-605.588) -- 0:00:48
      184000 -- (-603.895) (-604.552) (-603.675) [-605.688] * [-605.194] (-605.423) (-607.929) (-608.549) -- 0:00:48
      184500 -- [-606.079] (-604.543) (-605.952) (-607.919) * [-605.694] (-605.357) (-608.746) (-608.930) -- 0:00:48
      185000 -- (-604.443) (-604.046) [-605.823] (-610.235) * (-604.714) (-605.364) [-606.332] (-604.745) -- 0:00:48

      Average standard deviation of split frequencies: 0.015740

      185500 -- (-604.987) (-605.725) (-607.184) [-607.110] * (-606.532) [-605.335] (-604.990) (-605.647) -- 0:00:52
      186000 -- (-611.822) (-604.858) (-607.507) [-605.412] * (-605.423) (-605.485) (-606.981) [-606.300] -- 0:00:52
      186500 -- [-605.380] (-604.562) (-606.124) (-606.097) * [-606.297] (-608.122) (-604.123) (-606.629) -- 0:00:52
      187000 -- [-605.899] (-607.480) (-608.293) (-607.050) * (-608.390) (-608.202) (-605.669) [-605.830] -- 0:00:52
      187500 -- (-610.302) (-605.646) [-604.789] (-612.912) * [-604.550] (-605.782) (-609.421) (-609.052) -- 0:00:52
      188000 -- (-607.017) [-607.847] (-607.803) (-609.471) * (-606.360) (-608.174) [-604.439] (-607.728) -- 0:00:51
      188500 -- (-606.743) (-610.782) (-604.574) [-606.651] * [-605.570] (-608.391) (-606.294) (-604.988) -- 0:00:51
      189000 -- (-606.986) (-608.080) (-606.645) [-605.770] * (-606.871) (-603.741) (-609.644) [-606.616] -- 0:00:51
      189500 -- [-605.815] (-605.410) (-606.607) (-605.903) * (-604.574) (-605.479) (-607.185) [-605.191] -- 0:00:51
      190000 -- (-604.022) (-606.394) [-604.170] (-604.632) * [-605.915] (-607.759) (-604.573) (-605.268) -- 0:00:51

      Average standard deviation of split frequencies: 0.015225

      190500 -- (-604.635) [-605.287] (-604.070) (-605.212) * (-606.793) (-605.858) (-607.783) [-604.447] -- 0:00:50
      191000 -- (-607.036) (-605.597) [-605.970] (-606.672) * (-605.661) (-603.854) (-612.417) [-604.374] -- 0:00:50
      191500 -- (-607.847) [-605.299] (-604.257) (-605.774) * (-606.781) [-604.929] (-609.782) (-605.894) -- 0:00:50
      192000 -- (-608.750) [-605.314] (-604.776) (-608.859) * [-605.318] (-604.499) (-609.299) (-604.551) -- 0:00:50
      192500 -- (-607.936) (-605.756) (-603.709) [-606.630] * [-603.600] (-603.780) (-604.782) (-607.966) -- 0:00:50
      193000 -- (-605.103) (-607.036) [-606.234] (-605.229) * (-604.992) (-605.760) (-605.155) [-606.561] -- 0:00:50
      193500 -- (-604.726) (-607.577) [-605.295] (-604.912) * [-604.499] (-605.754) (-604.464) (-605.888) -- 0:00:50
      194000 -- [-605.571] (-606.496) (-607.039) (-605.768) * (-604.369) (-605.716) (-606.186) [-605.345] -- 0:00:49
      194500 -- [-605.164] (-608.594) (-603.978) (-604.204) * (-604.485) (-606.420) [-604.590] (-606.270) -- 0:00:49
      195000 -- (-607.018) [-605.502] (-607.523) (-606.234) * (-606.459) (-610.212) (-604.148) [-605.800] -- 0:00:49

      Average standard deviation of split frequencies: 0.015366

      195500 -- (-607.822) [-608.580] (-603.865) (-605.825) * (-605.715) (-607.089) (-604.856) [-606.667] -- 0:00:49
      196000 -- (-604.430) (-606.473) [-603.637] (-609.435) * [-606.052] (-605.238) (-605.115) (-606.793) -- 0:00:49
      196500 -- (-605.480) (-610.063) (-605.087) [-604.411] * (-607.199) [-604.405] (-606.731) (-608.440) -- 0:00:49
      197000 -- [-609.127] (-606.486) (-605.607) (-605.609) * (-606.417) [-605.988] (-605.695) (-607.797) -- 0:00:48
      197500 -- (-604.374) (-605.634) (-606.240) [-605.443] * (-604.409) (-607.216) (-605.325) [-606.923] -- 0:00:48
      198000 -- (-610.641) (-605.138) (-605.748) [-604.268] * (-605.493) (-609.422) [-605.891] (-608.556) -- 0:00:48
      198500 -- (-607.914) [-607.955] (-604.405) (-607.005) * (-610.409) (-607.609) (-605.562) [-607.350] -- 0:00:48
      199000 -- [-609.387] (-606.816) (-604.660) (-605.948) * (-610.509) (-611.488) (-606.296) [-604.469] -- 0:00:48
      199500 -- (-605.147) (-606.578) (-608.347) [-606.391] * [-608.028] (-604.119) (-604.273) (-605.313) -- 0:00:48
      200000 -- (-605.626) [-611.328] (-604.944) (-607.448) * [-610.866] (-607.264) (-606.732) (-608.524) -- 0:00:48

      Average standard deviation of split frequencies: 0.016815

      200500 -- (-608.607) [-606.588] (-606.244) (-608.803) * (-609.052) (-607.417) [-604.956] (-609.136) -- 0:00:47
      201000 -- [-605.355] (-604.733) (-605.056) (-605.990) * (-605.249) [-604.540] (-604.307) (-611.332) -- 0:00:47
      201500 -- [-605.019] (-606.069) (-606.623) (-604.149) * [-607.145] (-603.901) (-604.229) (-609.788) -- 0:00:47
      202000 -- [-604.009] (-605.025) (-604.949) (-604.987) * (-612.020) (-605.766) [-603.832] (-609.076) -- 0:00:47
      202500 -- [-607.444] (-604.855) (-603.399) (-607.600) * (-606.050) (-603.953) [-603.711] (-607.592) -- 0:00:51
      203000 -- (-605.170) [-603.743] (-605.490) (-607.203) * (-606.120) (-604.931) (-608.037) [-605.379] -- 0:00:51
      203500 -- (-605.977) (-607.445) (-606.802) [-605.415] * (-607.726) [-606.928] (-604.489) (-605.346) -- 0:00:50
      204000 -- (-610.502) (-605.892) [-605.577] (-605.152) * (-608.178) (-603.884) (-605.103) [-604.100] -- 0:00:50
      204500 -- (-606.237) (-605.839) (-606.635) [-604.497] * (-603.907) (-604.269) [-606.389] (-607.174) -- 0:00:50
      205000 -- (-606.007) [-606.965] (-608.936) (-605.448) * (-610.489) [-606.753] (-607.562) (-609.248) -- 0:00:50

      Average standard deviation of split frequencies: 0.016862

      205500 -- (-606.036) [-609.444] (-605.169) (-604.734) * [-608.226] (-605.274) (-604.809) (-605.951) -- 0:00:50
      206000 -- [-604.850] (-605.136) (-606.621) (-605.914) * [-605.968] (-605.767) (-607.351) (-605.004) -- 0:00:50
      206500 -- (-603.758) (-608.138) (-608.308) [-608.136] * [-606.256] (-607.485) (-607.053) (-606.330) -- 0:00:49
      207000 -- (-608.018) (-605.414) (-605.839) [-604.774] * (-605.324) (-605.148) [-604.169] (-607.525) -- 0:00:49
      207500 -- (-605.622) (-606.436) [-606.338] (-605.722) * [-606.273] (-604.209) (-604.217) (-604.639) -- 0:00:49
      208000 -- (-606.068) (-607.181) [-606.474] (-605.293) * (-605.155) (-604.012) (-605.732) [-608.568] -- 0:00:49
      208500 -- (-609.363) [-607.026] (-604.108) (-610.203) * [-604.837] (-611.411) (-605.009) (-608.900) -- 0:00:49
      209000 -- (-606.056) (-606.149) (-607.710) [-605.060] * (-607.506) [-603.903] (-606.358) (-606.884) -- 0:00:49
      209500 -- (-609.331) (-606.209) [-605.751] (-607.419) * (-605.935) (-607.905) [-605.919] (-604.921) -- 0:00:49
      210000 -- (-607.829) (-604.734) [-605.317] (-606.953) * [-604.843] (-608.018) (-605.070) (-604.304) -- 0:00:48

      Average standard deviation of split frequencies: 0.016135

      210500 -- (-608.420) (-604.450) (-605.705) [-604.830] * [-605.734] (-605.045) (-604.297) (-604.526) -- 0:00:48
      211000 -- [-608.834] (-605.835) (-605.814) (-606.579) * (-605.184) (-605.245) (-613.683) [-605.635] -- 0:00:48
      211500 -- [-606.197] (-605.295) (-604.269) (-609.434) * [-605.816] (-607.599) (-606.068) (-605.875) -- 0:00:48
      212000 -- [-606.515] (-606.842) (-604.105) (-607.286) * (-605.043) (-607.523) (-605.428) [-607.365] -- 0:00:48
      212500 -- [-605.689] (-606.091) (-603.665) (-607.381) * (-604.970) (-607.304) [-608.146] (-604.964) -- 0:00:48
      213000 -- [-607.564] (-605.400) (-614.126) (-604.239) * (-604.894) (-605.883) (-606.255) [-604.892] -- 0:00:48
      213500 -- (-607.239) (-604.168) (-610.209) [-605.587] * [-607.692] (-608.982) (-607.191) (-605.200) -- 0:00:47
      214000 -- (-605.811) (-604.218) [-605.608] (-604.487) * (-608.154) (-609.334) [-608.828] (-605.704) -- 0:00:47
      214500 -- (-606.928) (-603.924) [-606.251] (-605.753) * [-605.639] (-606.720) (-604.245) (-605.226) -- 0:00:47
      215000 -- (-604.149) (-604.705) [-604.187] (-609.731) * (-605.024) (-607.803) [-604.181] (-604.317) -- 0:00:47

      Average standard deviation of split frequencies: 0.016247

      215500 -- (-605.863) (-604.689) [-610.457] (-608.417) * (-606.880) (-605.966) [-606.451] (-604.036) -- 0:00:47
      216000 -- [-605.368] (-605.154) (-604.751) (-606.743) * (-604.889) (-608.266) (-606.462) [-606.843] -- 0:00:47
      216500 -- (-606.682) (-607.743) [-604.881] (-605.058) * (-607.070) (-606.323) [-605.483] (-608.756) -- 0:00:47
      217000 -- [-606.471] (-607.267) (-614.171) (-606.180) * (-604.451) [-604.767] (-607.899) (-605.837) -- 0:00:46
      217500 -- [-604.779] (-607.225) (-613.680) (-606.195) * (-605.581) (-607.144) (-603.854) [-603.664] -- 0:00:46
      218000 -- [-604.910] (-607.810) (-610.330) (-608.692) * (-605.089) [-604.876] (-603.977) (-606.280) -- 0:00:46
      218500 -- [-607.642] (-609.468) (-607.588) (-605.932) * (-606.403) [-604.869] (-609.646) (-604.992) -- 0:00:46
      219000 -- (-604.742) (-606.019) [-607.437] (-607.904) * (-606.537) (-605.711) (-609.096) [-605.790] -- 0:00:49
      219500 -- [-606.424] (-606.362) (-606.868) (-605.894) * (-609.953) [-605.319] (-606.498) (-605.413) -- 0:00:49
      220000 -- (-607.812) (-604.305) [-606.812] (-609.104) * (-603.903) (-613.598) (-606.337) [-605.923] -- 0:00:49

      Average standard deviation of split frequencies: 0.016615

      220500 -- (-607.833) (-603.779) (-604.728) [-606.247] * [-607.524] (-604.866) (-603.847) (-605.234) -- 0:00:49
      221000 -- (-604.695) [-606.184] (-609.462) (-606.313) * (-606.432) (-609.292) (-605.075) [-606.584] -- 0:00:49
      221500 -- [-609.054] (-605.030) (-604.999) (-604.595) * (-605.404) (-611.421) (-606.383) [-605.158] -- 0:00:49
      222000 -- [-603.759] (-604.178) (-606.515) (-606.333) * (-604.094) (-605.420) (-606.265) [-604.986] -- 0:00:49
      222500 -- (-604.987) (-604.985) [-606.409] (-607.098) * (-605.165) (-606.005) [-604.332] (-609.696) -- 0:00:48
      223000 -- [-606.151] (-609.836) (-605.979) (-605.972) * (-606.785) [-605.148] (-606.587) (-606.900) -- 0:00:48
      223500 -- (-605.376) (-606.606) (-604.507) [-605.469] * [-606.460] (-608.077) (-606.644) (-608.532) -- 0:00:48
      224000 -- [-609.357] (-605.805) (-604.588) (-603.897) * (-606.613) (-606.547) (-605.753) [-605.692] -- 0:00:48
      224500 -- (-610.644) (-606.893) (-603.892) [-604.172] * (-604.746) (-605.398) [-605.402] (-605.318) -- 0:00:48
      225000 -- (-606.298) (-605.296) (-605.481) [-604.862] * (-607.826) (-607.333) (-604.890) [-603.801] -- 0:00:48

      Average standard deviation of split frequencies: 0.016358

      225500 -- [-607.468] (-606.282) (-603.534) (-605.654) * (-608.023) (-609.911) (-607.345) [-603.999] -- 0:00:48
      226000 -- (-606.318) (-604.555) [-604.112] (-604.515) * (-609.087) (-608.551) (-604.331) [-604.797] -- 0:00:47
      226500 -- (-605.616) (-605.918) (-604.599) [-603.849] * (-603.695) (-608.173) [-606.321] (-605.474) -- 0:00:47
      227000 -- (-610.983) [-604.319] (-605.648) (-605.208) * (-607.877) (-608.260) [-605.136] (-605.969) -- 0:00:47
      227500 -- [-607.341] (-606.346) (-604.340) (-607.068) * (-605.190) (-605.277) (-608.931) [-606.314] -- 0:00:47
      228000 -- (-607.947) (-607.421) [-603.749] (-607.714) * (-604.334) [-607.156] (-608.062) (-606.606) -- 0:00:47
      228500 -- [-605.070] (-607.133) (-604.613) (-607.924) * (-604.256) (-604.220) (-607.468) [-606.449] -- 0:00:47
      229000 -- (-607.876) (-606.104) [-604.618] (-608.495) * (-605.786) (-609.912) (-606.293) [-604.715] -- 0:00:47
      229500 -- [-605.891] (-607.650) (-605.447) (-606.548) * (-607.195) (-605.932) [-607.122] (-606.658) -- 0:00:47
      230000 -- (-607.340) (-606.929) [-605.749] (-612.009) * (-604.162) (-605.934) (-604.790) [-606.323] -- 0:00:46

      Average standard deviation of split frequencies: 0.016803

      230500 -- [-608.204] (-605.040) (-604.726) (-605.430) * (-608.504) (-605.902) (-605.185) [-606.257] -- 0:00:46
      231000 -- (-611.903) [-604.659] (-607.375) (-606.894) * (-605.276) [-605.501] (-604.072) (-608.083) -- 0:00:46
      231500 -- (-604.509) (-606.506) [-605.754] (-609.049) * (-606.901) (-607.223) (-603.882) [-606.137] -- 0:00:46
      232000 -- [-605.043] (-607.676) (-604.689) (-605.261) * (-607.221) (-607.287) [-608.347] (-606.472) -- 0:00:46
      232500 -- [-606.547] (-605.071) (-604.254) (-603.552) * (-605.326) (-608.570) (-604.919) [-605.970] -- 0:00:46
      233000 -- (-609.187) [-606.002] (-604.607) (-604.103) * (-606.993) (-606.706) [-604.952] (-604.172) -- 0:00:46
      233500 -- (-604.939) (-607.127) (-604.512) [-604.533] * (-607.207) (-607.571) [-604.852] (-605.310) -- 0:00:45
      234000 -- (-604.854) (-604.442) [-604.645] (-605.243) * (-608.863) (-608.737) [-604.762] (-607.916) -- 0:00:45
      234500 -- (-605.410) (-604.805) (-606.447) [-603.510] * (-607.808) (-606.733) [-604.206] (-606.290) -- 0:00:45
      235000 -- (-604.530) (-604.552) [-607.132] (-603.787) * (-608.475) (-606.733) [-604.115] (-608.182) -- 0:00:48

      Average standard deviation of split frequencies: 0.016868

      235500 -- (-607.855) (-604.883) (-604.601) [-604.486] * (-604.503) (-605.522) [-603.776] (-605.501) -- 0:00:48
      236000 -- [-604.506] (-605.057) (-604.614) (-610.156) * (-604.999) (-604.201) [-604.119] (-609.914) -- 0:00:48
      236500 -- [-606.901] (-607.256) (-605.835) (-605.182) * (-604.201) [-605.459] (-608.979) (-606.390) -- 0:00:48
      237000 -- (-606.003) (-605.639) [-604.225] (-604.483) * (-608.024) (-606.022) (-608.637) [-605.167] -- 0:00:48
      237500 -- (-605.062) (-605.808) (-610.264) [-606.007] * (-605.856) (-605.991) [-605.071] (-606.219) -- 0:00:48
      238000 -- (-607.032) (-604.860) (-609.833) [-605.799] * (-604.432) (-607.118) (-607.822) [-607.477] -- 0:00:48
      238500 -- [-603.875] (-607.354) (-608.284) (-604.784) * [-605.311] (-606.698) (-608.833) (-605.130) -- 0:00:47
      239000 -- (-607.192) (-605.283) [-604.671] (-603.988) * (-605.849) (-603.883) (-605.379) [-603.758] -- 0:00:47
      239500 -- [-606.000] (-604.572) (-605.130) (-604.777) * [-605.006] (-604.230) (-605.911) (-606.309) -- 0:00:47
      240000 -- (-603.809) [-604.212] (-605.828) (-604.177) * (-604.404) (-604.367) (-605.411) [-605.384] -- 0:00:47

      Average standard deviation of split frequencies: 0.016649

      240500 -- [-607.752] (-606.634) (-605.542) (-607.195) * (-604.056) (-608.370) [-604.451] (-604.856) -- 0:00:47
      241000 -- (-604.375) (-607.032) (-607.502) [-604.792] * (-604.145) [-605.504] (-609.321) (-604.095) -- 0:00:47
      241500 -- [-604.612] (-605.143) (-604.588) (-607.162) * (-606.633) [-605.124] (-606.700) (-605.438) -- 0:00:47
      242000 -- (-606.298) (-605.146) (-607.117) [-605.577] * (-612.025) (-606.493) (-610.430) [-605.455] -- 0:00:46
      242500 -- (-606.762) (-612.776) (-604.760) [-605.593] * [-605.086] (-609.826) (-604.393) (-606.414) -- 0:00:46
      243000 -- [-606.239] (-603.632) (-604.262) (-604.388) * (-606.658) [-607.474] (-605.751) (-604.509) -- 0:00:46
      243500 -- (-604.342) [-605.152] (-604.276) (-605.504) * (-605.736) [-607.008] (-605.934) (-607.371) -- 0:00:46
      244000 -- [-606.055] (-604.596) (-604.895) (-607.138) * (-604.183) (-604.877) (-604.766) [-604.956] -- 0:00:46
      244500 -- (-605.328) (-607.599) [-605.744] (-605.443) * (-610.545) [-606.437] (-605.281) (-606.767) -- 0:00:46
      245000 -- (-604.136) [-604.565] (-608.285) (-605.337) * (-606.993) [-605.742] (-609.574) (-604.916) -- 0:00:46

      Average standard deviation of split frequencies: 0.016641

      245500 -- (-607.754) [-604.428] (-608.533) (-607.070) * (-607.438) (-604.081) (-608.159) [-604.815] -- 0:00:46
      246000 -- (-607.951) (-605.064) [-606.536] (-607.174) * (-606.236) (-606.524) (-606.082) [-604.574] -- 0:00:45
      246500 -- [-608.197] (-607.459) (-607.651) (-608.103) * (-605.306) [-606.201] (-605.834) (-606.389) -- 0:00:45
      247000 -- (-608.299) (-604.452) (-605.022) [-605.052] * (-606.636) (-604.911) [-609.156] (-604.511) -- 0:00:45
      247500 -- (-603.664) [-606.219] (-605.730) (-605.434) * (-608.029) [-604.685] (-606.715) (-605.132) -- 0:00:45
      248000 -- (-604.611) (-605.860) [-607.141] (-605.464) * (-605.210) (-605.365) [-609.628] (-604.703) -- 0:00:45
      248500 -- (-605.588) (-605.998) (-605.395) [-605.872] * (-605.690) [-604.665] (-610.039) (-606.493) -- 0:00:45
      249000 -- (-606.718) (-604.836) [-605.288] (-604.144) * (-604.978) (-605.156) (-607.116) [-606.353] -- 0:00:45
      249500 -- [-606.605] (-604.782) (-605.909) (-608.476) * (-606.230) (-606.529) [-606.261] (-608.864) -- 0:00:45
      250000 -- (-605.247) [-605.821] (-605.929) (-606.200) * (-605.889) (-609.608) [-605.812] (-608.167) -- 0:00:45

      Average standard deviation of split frequencies: 0.016431

      250500 -- (-605.101) (-608.115) (-604.809) [-607.019] * [-606.799] (-605.375) (-608.153) (-607.269) -- 0:00:44
      251000 -- [-607.107] (-606.629) (-604.531) (-608.099) * (-607.355) (-606.028) (-604.380) [-604.468] -- 0:00:47
      251500 -- (-606.025) [-605.915] (-607.802) (-610.565) * (-604.989) (-604.235) [-604.693] (-604.541) -- 0:00:47
      252000 -- (-608.276) (-604.430) (-608.502) [-604.736] * (-606.994) (-604.572) (-606.990) [-605.165] -- 0:00:47
      252500 -- (-604.482) [-604.564] (-604.497) (-604.886) * [-608.245] (-603.944) (-603.895) (-605.494) -- 0:00:47
      253000 -- [-606.606] (-606.789) (-604.463) (-604.117) * (-604.824) (-605.031) [-604.449] (-606.983) -- 0:00:47
      253500 -- [-604.298] (-607.366) (-603.900) (-606.311) * (-604.611) (-605.868) [-603.724] (-608.054) -- 0:00:47
      254000 -- (-607.013) (-607.800) (-605.025) [-605.372] * (-606.218) [-604.623] (-607.680) (-611.500) -- 0:00:46
      254500 -- (-606.050) (-607.075) (-606.398) [-607.293] * [-606.511] (-606.235) (-607.184) (-608.870) -- 0:00:46
      255000 -- [-606.385] (-604.881) (-605.377) (-605.910) * (-605.990) (-608.828) [-605.741] (-607.150) -- 0:00:46

      Average standard deviation of split frequencies: 0.017251

      255500 -- [-606.624] (-604.741) (-607.143) (-605.791) * (-605.141) [-603.831] (-605.909) (-605.917) -- 0:00:46
      256000 -- (-606.463) (-603.750) [-604.779] (-608.265) * (-604.183) [-608.636] (-603.891) (-605.686) -- 0:00:46
      256500 -- (-606.524) (-605.180) [-606.599] (-609.043) * [-604.344] (-608.409) (-609.238) (-604.058) -- 0:00:46
      257000 -- [-605.358] (-609.330) (-607.294) (-604.645) * (-603.985) [-605.897] (-608.003) (-605.152) -- 0:00:46
      257500 -- (-605.937) [-606.979] (-606.335) (-608.188) * (-603.922) (-605.574) [-604.655] (-606.108) -- 0:00:46
      258000 -- [-606.132] (-605.146) (-607.238) (-605.232) * (-604.997) (-606.001) [-605.035] (-606.080) -- 0:00:46
      258500 -- (-605.642) (-604.781) (-603.957) [-605.921] * (-605.937) [-606.565] (-604.302) (-605.982) -- 0:00:45
      259000 -- (-604.230) (-607.528) (-605.953) [-603.753] * (-605.286) (-610.575) [-603.929] (-604.982) -- 0:00:45
      259500 -- (-605.401) (-604.686) [-605.647] (-605.364) * (-604.748) (-609.746) (-607.309) [-605.553] -- 0:00:45
      260000 -- (-607.622) (-608.933) (-603.973) [-605.448] * (-607.299) (-605.449) (-608.560) [-606.870] -- 0:00:45

      Average standard deviation of split frequencies: 0.016181

      260500 -- (-606.937) (-610.509) [-603.819] (-607.523) * (-604.857) (-606.248) (-605.855) [-604.234] -- 0:00:45
      261000 -- (-607.724) (-606.018) (-605.985) [-603.797] * (-604.964) (-606.924) (-603.671) [-603.621] -- 0:00:45
      261500 -- [-605.091] (-606.764) (-605.432) (-603.942) * [-603.807] (-608.560) (-604.092) (-604.229) -- 0:00:45
      262000 -- (-609.013) (-604.665) (-609.057) [-604.424] * [-606.049] (-605.399) (-605.663) (-605.486) -- 0:00:45
      262500 -- (-607.504) [-603.765] (-613.292) (-605.694) * [-606.959] (-605.097) (-603.995) (-604.642) -- 0:00:44
      263000 -- [-605.074] (-604.939) (-609.764) (-609.049) * [-605.039] (-607.654) (-604.000) (-606.376) -- 0:00:44
      263500 -- (-604.778) (-605.159) [-604.529] (-609.592) * (-606.076) (-608.492) [-605.174] (-610.056) -- 0:00:44
      264000 -- (-603.840) (-604.476) [-605.989] (-614.324) * [-605.855] (-609.353) (-605.124) (-610.455) -- 0:00:44
      264500 -- [-603.945] (-604.919) (-606.064) (-608.881) * (-604.371) (-606.635) [-603.691] (-605.138) -- 0:00:44
      265000 -- (-606.354) [-605.808] (-604.396) (-610.594) * (-604.327) (-606.017) (-605.529) [-606.593] -- 0:00:44

      Average standard deviation of split frequencies: 0.016147

      265500 -- (-605.081) (-605.701) (-604.614) [-606.518] * [-604.679] (-607.031) (-611.822) (-603.994) -- 0:00:44
      266000 -- (-605.817) (-604.742) [-604.226] (-605.375) * (-604.627) (-606.694) (-608.418) [-604.814] -- 0:00:44
      266500 -- (-604.628) (-604.365) (-604.226) [-604.214] * [-603.562] (-604.963) (-603.933) (-607.747) -- 0:00:44
      267000 -- [-604.409] (-607.530) (-605.492) (-605.363) * [-605.313] (-604.655) (-605.415) (-607.525) -- 0:00:43
      267500 -- (-604.144) (-605.933) [-606.377] (-605.849) * (-604.696) (-606.799) [-605.105] (-606.512) -- 0:00:43
      268000 -- [-605.227] (-605.839) (-607.081) (-605.218) * (-604.577) (-605.294) (-604.969) [-607.597] -- 0:00:46
      268500 -- (-607.141) [-605.665] (-610.644) (-607.236) * (-604.242) (-603.718) [-604.867] (-608.770) -- 0:00:46
      269000 -- (-605.610) (-605.109) (-607.997) [-604.933] * (-605.356) (-604.190) (-608.088) [-604.870] -- 0:00:46
      269500 -- [-609.097] (-604.898) (-604.618) (-605.200) * [-607.392] (-604.984) (-607.637) (-605.123) -- 0:00:46
      270000 -- (-604.024) (-607.907) (-604.656) [-604.968] * (-608.483) (-605.822) (-605.478) [-604.703] -- 0:00:45

      Average standard deviation of split frequencies: 0.015880

      270500 -- (-605.835) (-607.032) (-604.687) [-604.464] * (-606.424) [-605.185] (-606.249) (-607.595) -- 0:00:45
      271000 -- (-606.830) (-604.570) [-604.356] (-605.395) * (-618.658) (-605.762) [-606.987] (-607.679) -- 0:00:45
      271500 -- (-606.885) (-605.219) (-607.444) [-605.120] * [-607.613] (-606.154) (-608.951) (-607.769) -- 0:00:45
      272000 -- (-609.138) (-606.769) (-608.339) [-604.286] * (-605.953) (-605.677) [-606.325] (-607.595) -- 0:00:45
      272500 -- (-605.848) [-608.289] (-607.210) (-606.516) * [-606.333] (-604.561) (-606.541) (-607.729) -- 0:00:45
      273000 -- (-606.581) [-607.743] (-606.726) (-606.666) * [-606.190] (-607.912) (-605.652) (-606.357) -- 0:00:45
      273500 -- (-607.087) (-606.014) [-606.702] (-610.517) * (-605.137) [-606.462] (-606.601) (-604.908) -- 0:00:45
      274000 -- (-604.698) (-605.234) (-606.455) [-608.336] * (-609.340) (-604.742) (-606.580) [-605.477] -- 0:00:45
      274500 -- (-606.422) [-607.650] (-604.593) (-606.711) * [-605.499] (-605.290) (-614.295) (-610.903) -- 0:00:44
      275000 -- (-605.992) [-605.875] (-607.275) (-604.269) * [-604.960] (-605.613) (-612.472) (-605.081) -- 0:00:44

      Average standard deviation of split frequencies: 0.015573

      275500 -- (-604.027) [-604.490] (-604.545) (-603.917) * [-606.813] (-605.167) (-604.910) (-604.721) -- 0:00:44
      276000 -- (-605.096) [-604.552] (-604.731) (-603.643) * [-603.654] (-606.377) (-605.776) (-607.203) -- 0:00:44
      276500 -- (-604.631) (-606.787) (-604.295) [-606.612] * [-605.954] (-608.354) (-604.293) (-604.832) -- 0:00:44
      277000 -- (-604.382) (-608.589) (-607.050) [-603.854] * (-604.724) (-609.792) (-604.439) [-606.578] -- 0:00:44
      277500 -- (-603.930) (-608.797) (-605.333) [-603.877] * (-609.751) (-606.329) [-605.572] (-606.656) -- 0:00:44
      278000 -- (-605.064) [-605.245] (-606.938) (-604.331) * [-604.343] (-606.273) (-604.296) (-604.983) -- 0:00:44
      278500 -- (-608.544) [-608.333] (-606.036) (-607.795) * [-605.120] (-611.158) (-610.070) (-604.782) -- 0:00:44
      279000 -- (-607.181) [-606.881] (-605.024) (-605.761) * (-608.305) (-607.657) [-608.051] (-604.844) -- 0:00:43
      279500 -- (-604.424) (-606.108) (-604.848) [-607.754] * [-605.164] (-606.523) (-604.616) (-610.780) -- 0:00:43
      280000 -- (-604.878) [-606.369] (-604.777) (-608.666) * [-604.492] (-608.311) (-606.231) (-609.623) -- 0:00:43

      Average standard deviation of split frequencies: 0.015907

      280500 -- (-605.219) (-609.499) [-606.307] (-603.431) * [-604.099] (-606.306) (-606.352) (-609.500) -- 0:00:43
      281000 -- (-607.637) [-607.339] (-606.365) (-603.649) * (-605.292) (-608.331) (-603.719) [-605.632] -- 0:00:43
      281500 -- (-605.163) [-604.741] (-605.744) (-606.828) * (-604.512) (-609.009) (-607.407) [-605.569] -- 0:00:43
      282000 -- [-604.340] (-604.835) (-605.976) (-607.180) * (-603.871) [-605.710] (-605.141) (-605.891) -- 0:00:43
      282500 -- (-619.359) [-604.581] (-606.026) (-607.116) * (-607.153) [-604.577] (-604.858) (-607.081) -- 0:00:43
      283000 -- (-606.797) [-603.999] (-603.663) (-610.410) * (-609.811) (-605.552) (-605.656) [-605.488] -- 0:00:43
      283500 -- (-604.588) [-607.125] (-604.246) (-607.687) * (-605.585) (-607.725) (-606.089) [-604.765] -- 0:00:42
      284000 -- (-606.606) (-606.567) (-606.484) [-605.233] * (-604.095) (-603.953) (-604.226) [-606.558] -- 0:00:45
      284500 -- (-608.301) [-606.963] (-607.957) (-605.644) * [-604.263] (-604.971) (-604.563) (-605.670) -- 0:00:45
      285000 -- (-605.884) [-605.452] (-606.194) (-606.055) * (-604.171) [-604.546] (-605.771) (-603.461) -- 0:00:45

      Average standard deviation of split frequencies: 0.015933

      285500 -- (-606.851) [-608.481] (-604.924) (-604.969) * (-606.898) [-605.104] (-604.890) (-604.558) -- 0:00:45
      286000 -- (-606.439) (-609.454) (-606.409) [-607.069] * (-607.417) [-608.545] (-603.971) (-604.180) -- 0:00:44
      286500 -- (-607.754) (-603.367) (-604.237) [-605.116] * (-606.680) (-604.881) [-606.605] (-607.145) -- 0:00:44
      287000 -- (-608.771) (-607.463) (-604.476) [-605.602] * (-604.331) (-607.314) (-606.018) [-605.700] -- 0:00:44
      287500 -- [-604.902] (-608.159) (-604.129) (-606.334) * (-603.684) [-609.728] (-606.731) (-607.915) -- 0:00:44
      288000 -- [-604.914] (-604.934) (-604.122) (-604.094) * (-607.373) (-607.939) [-606.850] (-605.624) -- 0:00:44
      288500 -- (-605.394) [-606.628] (-606.521) (-603.942) * [-606.074] (-609.969) (-606.184) (-606.465) -- 0:00:44
      289000 -- (-608.270) (-607.979) [-604.721] (-606.590) * [-606.295] (-607.351) (-609.505) (-607.802) -- 0:00:44
      289500 -- [-604.391] (-606.788) (-604.445) (-609.141) * [-605.613] (-604.267) (-607.551) (-614.359) -- 0:00:44
      290000 -- (-609.413) [-608.462] (-607.766) (-606.183) * (-604.414) [-604.343] (-607.391) (-609.632) -- 0:00:44

      Average standard deviation of split frequencies: 0.016504

      290500 -- (-605.430) (-609.397) [-604.244] (-604.039) * (-606.543) (-604.190) (-606.165) [-606.918] -- 0:00:43
      291000 -- (-604.310) (-611.807) (-605.212) [-605.121] * [-605.846] (-605.429) (-613.887) (-604.949) -- 0:00:43
      291500 -- (-606.441) (-607.824) [-605.596] (-612.356) * (-604.899) (-604.913) (-604.884) [-605.192] -- 0:00:43
      292000 -- [-604.589] (-607.578) (-605.563) (-608.203) * (-605.106) (-607.795) (-605.688) [-606.184] -- 0:00:43
      292500 -- [-603.661] (-607.136) (-607.123) (-611.939) * (-606.223) (-605.302) [-604.366] (-605.645) -- 0:00:43
      293000 -- (-606.192) (-607.083) [-604.143] (-605.704) * [-604.597] (-608.724) (-604.975) (-605.752) -- 0:00:43
      293500 -- [-606.376] (-604.099) (-606.234) (-604.332) * (-604.916) (-608.299) (-605.399) [-604.617] -- 0:00:43
      294000 -- [-606.180] (-605.111) (-603.703) (-606.150) * (-604.013) (-606.703) (-606.284) [-606.729] -- 0:00:43
      294500 -- (-607.926) (-604.913) (-604.359) [-605.821] * (-606.481) (-604.463) (-603.873) [-605.374] -- 0:00:43
      295000 -- [-605.135] (-603.935) (-605.100) (-607.371) * (-606.156) [-605.059] (-607.284) (-608.020) -- 0:00:43

      Average standard deviation of split frequencies: 0.014802

      295500 -- [-604.973] (-604.753) (-606.852) (-605.603) * [-605.035] (-605.648) (-607.418) (-610.303) -- 0:00:42
      296000 -- (-605.959) (-604.993) (-606.298) [-605.831] * (-606.346) (-607.451) (-606.030) [-608.036] -- 0:00:42
      296500 -- (-606.006) [-606.821] (-605.873) (-603.906) * (-607.312) (-604.582) (-603.638) [-604.809] -- 0:00:42
      297000 -- (-611.338) (-605.330) [-604.374] (-603.935) * (-605.182) (-607.363) (-605.796) [-605.544] -- 0:00:42
      297500 -- (-608.172) [-604.981] (-604.600) (-604.962) * [-604.891] (-608.362) (-605.028) (-606.189) -- 0:00:42
      298000 -- [-606.576] (-605.392) (-607.510) (-605.387) * [-605.373] (-604.149) (-610.809) (-607.871) -- 0:00:42
      298500 -- (-610.560) (-609.518) (-607.669) [-605.085] * (-608.260) [-604.251] (-606.236) (-610.693) -- 0:00:42
      299000 -- [-604.542] (-605.195) (-605.404) (-603.865) * [-606.144] (-605.721) (-604.244) (-606.735) -- 0:00:42
      299500 -- (-606.522) [-603.956] (-611.326) (-605.137) * (-605.975) [-607.581] (-604.446) (-604.362) -- 0:00:42
      300000 -- (-607.519) (-604.750) [-606.567] (-611.173) * (-604.359) (-610.881) [-606.397] (-604.158) -- 0:00:42

      Average standard deviation of split frequencies: 0.014572

      300500 -- (-607.182) (-605.922) [-604.520] (-604.405) * [-605.408] (-604.926) (-609.827) (-604.151) -- 0:00:41
      301000 -- [-607.708] (-606.169) (-605.089) (-604.596) * (-604.745) (-612.062) [-604.764] (-607.464) -- 0:00:44
      301500 -- (-610.019) (-604.850) [-606.940] (-605.170) * (-605.503) (-607.461) [-606.718] (-603.692) -- 0:00:44
      302000 -- (-605.474) (-606.467) (-606.351) [-604.489] * (-606.076) (-608.152) [-604.579] (-604.358) -- 0:00:43
      302500 -- (-603.663) (-606.632) [-606.942] (-606.083) * (-605.990) (-603.616) [-606.090] (-604.736) -- 0:00:43
      303000 -- (-604.940) (-606.483) [-605.492] (-605.737) * (-606.753) (-603.630) [-607.927] (-604.548) -- 0:00:43
      303500 -- (-605.391) (-612.649) [-609.255] (-606.946) * (-604.561) [-605.258] (-606.877) (-610.679) -- 0:00:43
      304000 -- (-605.736) (-609.098) [-604.315] (-610.917) * (-605.097) (-608.728) [-606.472] (-606.695) -- 0:00:43
      304500 -- (-610.146) (-605.349) (-604.364) [-609.170] * (-612.929) (-607.512) (-607.241) [-606.977] -- 0:00:43
      305000 -- (-608.805) (-605.738) [-604.717] (-607.215) * (-607.168) (-610.014) (-603.982) [-605.348] -- 0:00:43

      Average standard deviation of split frequencies: 0.013321

      305500 -- (-610.091) [-604.705] (-606.172) (-604.699) * (-605.837) (-605.944) (-604.224) [-605.064] -- 0:00:43
      306000 -- [-607.327] (-605.480) (-608.893) (-604.120) * (-605.432) (-610.195) (-605.734) [-608.964] -- 0:00:43
      306500 -- (-606.854) (-604.601) [-605.200] (-606.505) * [-606.146] (-606.632) (-605.850) (-607.119) -- 0:00:42
      307000 -- (-605.860) (-608.615) (-605.304) [-604.568] * (-604.571) (-605.901) (-603.943) [-607.569] -- 0:00:42
      307500 -- (-606.672) (-608.059) (-605.848) [-605.114] * (-606.405) (-605.779) (-605.136) [-607.818] -- 0:00:42
      308000 -- [-608.624] (-603.828) (-608.262) (-606.241) * (-605.735) (-607.108) (-605.907) [-604.961] -- 0:00:42
      308500 -- (-604.538) [-603.726] (-606.422) (-605.917) * (-608.341) (-604.370) (-605.217) [-605.055] -- 0:00:42
      309000 -- (-605.410) (-605.787) [-607.095] (-606.437) * (-604.720) (-603.798) (-606.705) [-605.281] -- 0:00:42
      309500 -- (-604.742) (-604.412) (-606.514) [-606.488] * (-604.649) [-604.771] (-605.464) (-605.249) -- 0:00:42
      310000 -- (-605.484) (-604.279) [-603.643] (-605.428) * (-605.577) (-604.340) [-606.103] (-607.327) -- 0:00:42

      Average standard deviation of split frequencies: 0.013825

      310500 -- (-604.066) [-607.697] (-605.543) (-605.154) * (-603.671) (-607.452) [-605.893] (-603.882) -- 0:00:42
      311000 -- [-605.017] (-604.317) (-606.061) (-603.973) * (-605.285) (-605.857) (-605.605) [-610.110] -- 0:00:42
      311500 -- (-606.949) (-604.911) [-605.171] (-606.619) * (-610.223) (-606.166) [-604.336] (-605.717) -- 0:00:41
      312000 -- (-606.766) [-605.126] (-604.542) (-608.662) * (-609.098) (-606.410) (-604.277) [-604.895] -- 0:00:41
      312500 -- [-606.276] (-605.151) (-603.867) (-604.688) * (-603.962) (-607.492) (-605.340) [-606.683] -- 0:00:41
      313000 -- (-607.723) (-604.720) (-607.588) [-604.668] * (-605.980) (-612.993) (-603.886) [-612.399] -- 0:00:41
      313500 -- (-605.922) (-606.143) (-604.684) [-605.642] * (-605.907) [-604.827] (-604.467) (-605.662) -- 0:00:41
      314000 -- (-605.889) (-606.474) (-605.888) [-606.068] * (-608.099) (-604.387) (-607.652) [-607.124] -- 0:00:41
      314500 -- (-607.379) (-605.581) (-605.765) [-606.252] * (-605.470) [-607.102] (-607.128) (-605.232) -- 0:00:41
      315000 -- [-604.274] (-605.322) (-603.516) (-608.788) * (-609.141) [-603.672] (-605.616) (-605.996) -- 0:00:41

      Average standard deviation of split frequencies: 0.013758

      315500 -- (-604.874) [-604.229] (-605.492) (-604.006) * [-605.786] (-607.987) (-604.884) (-605.411) -- 0:00:41
      316000 -- (-604.906) [-604.494] (-605.303) (-607.894) * (-605.918) [-603.741] (-607.215) (-606.540) -- 0:00:41
      316500 -- [-605.433] (-605.818) (-604.948) (-606.537) * (-606.543) [-606.335] (-604.235) (-607.088) -- 0:00:41
      317000 -- [-606.225] (-604.085) (-604.481) (-608.023) * [-604.821] (-603.836) (-603.948) (-604.974) -- 0:00:40
      317500 -- (-606.433) [-605.923] (-604.786) (-604.235) * (-605.815) (-603.845) [-604.854] (-606.277) -- 0:00:42
      318000 -- (-605.439) (-606.051) (-605.301) [-604.721] * (-611.611) (-607.229) (-607.752) [-608.739] -- 0:00:42
      318500 -- (-605.765) (-604.621) (-604.647) [-605.239] * [-604.420] (-605.463) (-608.304) (-609.941) -- 0:00:42
      319000 -- (-605.184) (-609.743) [-605.322] (-608.352) * (-603.664) (-604.252) [-608.535] (-607.437) -- 0:00:42
      319500 -- (-604.448) [-605.415] (-604.260) (-607.130) * (-604.717) (-607.903) (-607.307) [-609.865] -- 0:00:42
      320000 -- [-604.940] (-608.209) (-605.806) (-605.745) * (-603.603) (-608.856) (-604.836) [-605.123] -- 0:00:42

      Average standard deviation of split frequencies: 0.013557

      320500 -- (-603.995) (-605.358) (-604.889) [-604.624] * (-606.269) (-608.154) [-607.118] (-609.018) -- 0:00:42
      321000 -- (-606.348) (-605.763) (-608.813) [-604.872] * (-606.229) (-606.534) [-606.108] (-609.259) -- 0:00:42
      321500 -- [-604.294] (-604.909) (-604.817) (-605.234) * [-603.917] (-608.866) (-607.844) (-606.581) -- 0:00:42
      322000 -- (-606.835) (-605.908) (-612.040) [-603.918] * (-604.372) [-604.525] (-605.583) (-605.475) -- 0:00:42
      322500 -- (-610.576) [-604.059] (-607.290) (-608.311) * (-607.557) (-604.970) [-605.948] (-607.908) -- 0:00:42
      323000 -- (-608.249) [-606.206] (-604.510) (-605.039) * [-604.365] (-605.250) (-605.208) (-604.879) -- 0:00:41
      323500 -- (-604.470) (-607.210) (-605.249) [-604.906] * (-603.947) (-604.935) [-604.585] (-609.016) -- 0:00:41
      324000 -- (-611.538) (-605.472) [-604.569] (-604.932) * (-604.607) [-605.137] (-604.613) (-606.395) -- 0:00:41
      324500 -- (-604.158) (-605.700) [-604.978] (-604.779) * (-604.634) (-605.568) [-604.456] (-604.255) -- 0:00:41
      325000 -- (-605.416) (-604.789) [-604.523] (-608.028) * (-606.043) [-608.860] (-607.080) (-604.413) -- 0:00:41

      Average standard deviation of split frequencies: 0.013851

      325500 -- [-604.451] (-604.230) (-605.838) (-605.840) * (-609.528) (-605.137) [-604.869] (-606.358) -- 0:00:41
      326000 -- (-606.000) [-606.113] (-604.220) (-608.909) * [-604.449] (-605.144) (-605.173) (-608.287) -- 0:00:41
      326500 -- (-604.820) (-605.644) [-604.887] (-607.191) * (-606.449) (-604.816) [-605.252] (-606.314) -- 0:00:41
      327000 -- (-606.708) [-605.384] (-606.309) (-608.341) * [-606.639] (-604.491) (-608.787) (-606.433) -- 0:00:41
      327500 -- (-603.763) (-604.664) (-603.671) [-610.808] * (-605.542) (-607.715) [-605.716] (-606.415) -- 0:00:41
      328000 -- (-605.734) [-607.783] (-604.076) (-607.528) * (-605.207) [-605.469] (-606.621) (-607.380) -- 0:00:40
      328500 -- (-604.690) [-607.059] (-609.411) (-604.801) * (-606.658) [-606.142] (-607.914) (-603.701) -- 0:00:40
      329000 -- (-604.999) [-606.435] (-605.546) (-604.335) * (-611.264) (-604.622) (-609.332) [-605.476] -- 0:00:40
      329500 -- [-605.578] (-606.079) (-614.305) (-604.246) * (-607.399) [-603.721] (-610.362) (-604.284) -- 0:00:40
      330000 -- [-605.085] (-604.892) (-604.825) (-605.047) * (-605.750) (-604.832) [-608.911] (-604.549) -- 0:00:40

      Average standard deviation of split frequencies: 0.012530

      330500 -- (-605.865) (-605.197) (-604.529) [-608.784] * [-606.977] (-605.037) (-607.613) (-608.279) -- 0:00:40
      331000 -- (-607.863) [-606.619] (-604.060) (-614.439) * [-606.639] (-608.005) (-604.616) (-607.197) -- 0:00:40
      331500 -- [-607.208] (-607.714) (-605.051) (-605.639) * (-610.692) [-608.177] (-605.492) (-607.482) -- 0:00:40
      332000 -- (-605.187) [-606.555] (-604.768) (-605.235) * (-610.012) [-610.131] (-606.505) (-607.370) -- 0:00:40
      332500 -- (-605.379) [-608.271] (-604.361) (-604.647) * (-608.646) (-603.909) (-606.775) [-603.930] -- 0:00:40
      333000 -- (-606.195) (-609.120) [-606.723] (-606.590) * (-606.263) (-604.024) [-605.369] (-608.983) -- 0:00:40
      333500 -- (-606.258) (-606.014) [-606.659] (-606.091) * (-607.393) [-603.567] (-607.099) (-609.321) -- 0:00:39
      334000 -- (-607.750) [-605.767] (-603.713) (-604.252) * (-605.723) (-608.881) [-608.504] (-606.796) -- 0:00:39
      334500 -- (-608.166) (-605.495) [-604.185] (-603.564) * [-606.553] (-605.968) (-605.014) (-609.038) -- 0:00:39
      335000 -- (-605.885) [-604.753] (-605.883) (-605.403) * (-607.236) [-604.201] (-605.259) (-605.281) -- 0:00:41

      Average standard deviation of split frequencies: 0.012705

      335500 -- (-604.337) [-605.378] (-604.397) (-606.420) * (-607.274) [-605.487] (-607.648) (-608.149) -- 0:00:41
      336000 -- (-603.854) (-609.260) [-607.490] (-606.249) * (-605.529) (-605.361) [-612.734] (-606.341) -- 0:00:41
      336500 -- [-603.940] (-604.641) (-604.352) (-604.870) * (-606.309) [-605.669] (-607.323) (-604.368) -- 0:00:41
      337000 -- (-603.816) (-603.842) [-604.815] (-605.232) * [-606.552] (-605.210) (-610.668) (-604.895) -- 0:00:41
      337500 -- (-605.503) (-605.813) (-604.086) [-605.497] * [-604.943] (-604.449) (-607.588) (-606.682) -- 0:00:41
      338000 -- (-604.531) (-604.235) (-605.938) [-607.348] * [-605.643] (-608.946) (-606.183) (-607.623) -- 0:00:41
      338500 -- (-606.487) (-605.870) [-608.093] (-608.874) * (-605.026) (-608.043) [-604.612] (-607.077) -- 0:00:41
      339000 -- (-604.532) (-605.100) (-605.763) [-608.817] * (-607.027) (-610.356) (-606.159) [-607.659] -- 0:00:40
      339500 -- (-607.383) [-605.269] (-606.288) (-603.874) * (-604.824) [-604.158] (-604.017) (-611.177) -- 0:00:40
      340000 -- (-604.481) [-605.893] (-605.741) (-605.867) * (-605.086) (-605.032) [-605.371] (-606.480) -- 0:00:40

      Average standard deviation of split frequencies: 0.012838

      340500 -- [-606.268] (-606.247) (-604.461) (-607.622) * [-606.721] (-604.715) (-607.690) (-603.827) -- 0:00:40
      341000 -- (-607.349) (-607.580) (-607.206) [-609.803] * (-605.447) [-604.377] (-603.700) (-605.863) -- 0:00:40
      341500 -- (-606.456) [-605.984] (-606.793) (-605.318) * [-603.888] (-606.219) (-605.385) (-604.063) -- 0:00:40
      342000 -- (-605.582) [-603.998] (-604.490) (-606.757) * (-607.794) (-607.108) (-605.694) [-604.504] -- 0:00:40
      342500 -- (-606.693) [-603.481] (-608.254) (-607.363) * (-603.551) (-607.636) [-603.501] (-604.178) -- 0:00:40
      343000 -- (-609.070) (-604.515) (-604.925) [-605.238] * [-608.932] (-604.351) (-604.184) (-608.519) -- 0:00:40
      343500 -- (-606.334) (-609.232) (-608.534) [-607.178] * [-605.253] (-605.849) (-604.567) (-606.170) -- 0:00:40
      344000 -- (-605.902) (-605.649) [-608.147] (-608.583) * (-605.575) (-606.167) (-610.612) [-605.707] -- 0:00:40
      344500 -- [-604.782] (-605.630) (-604.904) (-604.981) * [-604.443] (-605.500) (-606.330) (-606.556) -- 0:00:39
      345000 -- [-606.488] (-605.271) (-608.466) (-605.111) * (-604.046) (-605.662) (-604.846) [-606.090] -- 0:00:39

      Average standard deviation of split frequencies: 0.012186

      345500 -- (-608.114) (-605.956) (-608.754) [-604.193] * (-609.896) [-605.398] (-605.692) (-606.874) -- 0:00:39
      346000 -- (-604.508) (-604.546) (-608.339) [-607.057] * (-610.520) (-605.477) [-608.299] (-607.078) -- 0:00:39
      346500 -- (-604.427) (-606.704) (-607.411) [-604.078] * (-607.344) (-604.188) [-604.898] (-605.986) -- 0:00:39
      347000 -- (-606.717) (-605.415) (-612.340) [-603.974] * (-606.483) (-604.702) [-606.486] (-610.882) -- 0:00:39
      347500 -- (-605.927) (-605.435) (-610.384) [-603.613] * (-604.001) (-606.514) [-605.096] (-605.865) -- 0:00:39
      348000 -- [-604.771] (-605.620) (-612.021) (-606.911) * (-606.035) (-604.467) [-604.568] (-605.318) -- 0:00:39
      348500 -- [-605.733] (-609.312) (-608.137) (-608.929) * (-604.877) (-605.269) [-609.099] (-606.937) -- 0:00:39
      349000 -- (-605.280) [-604.874] (-610.498) (-607.987) * (-608.016) (-606.143) [-606.027] (-605.885) -- 0:00:39
      349500 -- (-606.746) (-604.066) [-609.703] (-608.526) * (-608.407) [-605.108] (-606.426) (-605.154) -- 0:00:39
      350000 -- (-603.854) (-606.595) [-606.823] (-606.157) * (-607.638) (-604.794) (-608.554) [-608.501] -- 0:00:39

      Average standard deviation of split frequencies: 0.011427

      350500 -- (-604.694) [-604.444] (-607.088) (-606.230) * (-606.789) (-604.177) (-607.780) [-605.204] -- 0:00:38
      351000 -- (-605.368) (-605.586) (-610.559) [-605.634] * (-605.225) [-603.879] (-607.468) (-604.252) -- 0:00:38
      351500 -- (-605.283) (-605.097) [-606.019] (-609.592) * (-606.706) (-605.225) (-606.594) [-603.619] -- 0:00:38
      352000 -- (-605.655) [-606.176] (-605.246) (-604.140) * (-607.265) (-604.429) (-608.467) [-605.573] -- 0:00:40
      352500 -- [-606.110] (-607.051) (-605.648) (-606.292) * (-604.151) (-605.124) (-608.625) [-604.960] -- 0:00:40
      353000 -- (-603.904) (-605.269) [-604.729] (-612.455) * (-606.388) [-606.170] (-611.137) (-604.110) -- 0:00:40
      353500 -- [-604.349] (-606.421) (-606.713) (-607.344) * [-604.360] (-610.900) (-605.998) (-604.110) -- 0:00:40
      354000 -- (-604.767) (-604.002) (-610.345) [-603.638] * (-604.622) (-608.849) [-604.606] (-604.939) -- 0:00:40
      354500 -- (-604.989) (-604.318) (-603.558) [-604.960] * (-608.819) (-612.520) (-608.955) [-604.682] -- 0:00:40
      355000 -- (-604.046) (-608.594) [-604.806] (-606.437) * (-606.394) (-609.961) (-607.626) [-606.797] -- 0:00:39

      Average standard deviation of split frequencies: 0.010814

      355500 -- (-604.168) (-604.602) [-605.632] (-605.334) * (-604.289) [-604.314] (-605.518) (-604.890) -- 0:00:39
      356000 -- [-604.240] (-606.125) (-604.855) (-607.206) * [-604.586] (-608.694) (-609.071) (-605.192) -- 0:00:39
      356500 -- (-607.548) (-607.937) [-605.619] (-606.872) * (-604.923) (-604.005) (-607.845) [-606.992] -- 0:00:39
      357000 -- (-607.959) (-605.154) (-607.929) [-604.968] * (-606.874) [-610.038] (-608.654) (-607.502) -- 0:00:39
      357500 -- [-607.852] (-605.129) (-607.989) (-604.697) * [-607.456] (-608.006) (-604.020) (-603.974) -- 0:00:39
      358000 -- (-604.903) [-608.275] (-604.867) (-610.136) * (-605.608) [-605.537] (-606.143) (-607.019) -- 0:00:39
      358500 -- (-611.016) (-604.489) (-604.563) [-605.185] * (-608.867) [-604.800] (-603.956) (-604.022) -- 0:00:39
      359000 -- [-605.608] (-605.559) (-604.427) (-606.232) * (-604.638) (-604.625) [-605.099] (-606.509) -- 0:00:39
      359500 -- (-603.691) [-605.017] (-605.551) (-605.083) * [-605.123] (-604.606) (-604.154) (-605.960) -- 0:00:39
      360000 -- (-604.438) (-606.180) (-606.206) [-605.601] * (-605.967) [-605.222] (-604.475) (-605.512) -- 0:00:39

      Average standard deviation of split frequencies: 0.011400

      360500 -- (-607.910) (-610.514) (-607.987) [-608.375] * [-610.359] (-607.588) (-606.492) (-610.998) -- 0:00:39
      361000 -- (-607.486) (-605.999) (-610.259) [-606.919] * (-607.274) [-605.955] (-605.461) (-611.845) -- 0:00:38
      361500 -- (-608.533) (-604.754) [-608.318] (-604.046) * (-606.031) [-606.307] (-603.542) (-603.599) -- 0:00:38
      362000 -- (-606.641) (-604.922) (-609.556) [-604.897] * [-607.767] (-609.981) (-606.886) (-605.199) -- 0:00:38
      362500 -- (-606.555) (-604.926) (-612.190) [-603.713] * [-605.569] (-608.890) (-604.841) (-605.536) -- 0:00:38
      363000 -- [-608.053] (-608.216) (-610.237) (-605.682) * (-604.721) (-607.960) (-607.898) [-605.133] -- 0:00:38
      363500 -- (-612.062) (-606.716) (-604.992) [-604.344] * (-606.796) (-607.063) (-603.761) [-605.281] -- 0:00:38
      364000 -- (-605.157) (-604.997) (-603.896) [-607.820] * [-605.156] (-605.950) (-605.661) (-607.021) -- 0:00:38
      364500 -- [-605.471] (-605.084) (-603.959) (-605.222) * (-604.508) [-606.024] (-607.274) (-606.199) -- 0:00:38
      365000 -- (-605.055) (-604.085) [-607.049] (-605.198) * (-606.306) [-605.758] (-610.431) (-605.095) -- 0:00:38

      Average standard deviation of split frequencies: 0.011163

      365500 -- (-604.219) (-605.904) [-604.560] (-611.235) * (-605.612) (-605.112) (-605.665) [-605.373] -- 0:00:38
      366000 -- (-604.305) [-606.343] (-610.257) (-604.583) * (-605.476) (-603.901) [-605.855] (-606.375) -- 0:00:38
      366500 -- (-603.958) (-607.741) (-605.382) [-607.228] * (-604.147) (-604.494) [-605.699] (-603.615) -- 0:00:38
      367000 -- [-606.415] (-608.995) (-611.269) (-605.790) * (-604.170) [-604.538] (-606.230) (-604.047) -- 0:00:37
      367500 -- (-605.445) (-605.971) [-606.815] (-604.694) * (-605.009) (-604.948) [-605.248] (-605.778) -- 0:00:37
      368000 -- [-605.746] (-605.643) (-605.478) (-605.219) * (-605.808) (-604.810) (-605.263) [-606.595] -- 0:00:37
      368500 -- [-604.281] (-605.013) (-607.155) (-606.480) * [-609.072] (-608.364) (-604.282) (-605.998) -- 0:00:39
      369000 -- (-609.940) [-606.133] (-610.176) (-608.126) * (-609.084) [-604.821] (-604.932) (-606.317) -- 0:00:39
      369500 -- (-605.326) [-605.592] (-607.597) (-605.332) * (-604.560) [-603.817] (-604.893) (-610.071) -- 0:00:39
      370000 -- (-605.471) (-605.006) [-605.819] (-606.092) * (-606.131) [-604.118] (-604.767) (-607.628) -- 0:00:39

      Average standard deviation of split frequencies: 0.012011

      370500 -- (-605.819) [-610.037] (-605.382) (-607.262) * (-607.996) (-607.329) (-611.387) [-605.298] -- 0:00:39
      371000 -- (-604.496) [-606.465] (-604.544) (-609.120) * [-604.558] (-609.473) (-607.733) (-607.913) -- 0:00:38
      371500 -- [-605.999] (-606.094) (-605.409) (-606.693) * (-606.348) (-606.921) (-610.050) [-606.578] -- 0:00:38
      372000 -- (-603.849) (-607.340) (-607.452) [-604.631] * (-605.174) [-604.345] (-611.056) (-606.554) -- 0:00:38
      372500 -- (-605.542) (-607.064) (-607.434) [-604.511] * [-605.357] (-604.433) (-606.929) (-604.931) -- 0:00:38
      373000 -- (-605.402) (-608.834) [-608.281] (-605.162) * (-603.908) [-606.896] (-606.068) (-603.995) -- 0:00:38
      373500 -- (-605.972) (-605.887) (-605.905) [-606.508] * (-608.507) (-605.360) (-606.971) [-613.187] -- 0:00:38
      374000 -- (-606.419) [-608.010] (-610.505) (-604.347) * (-610.328) (-608.268) [-607.238] (-606.200) -- 0:00:38
      374500 -- (-605.535) (-605.135) [-606.283] (-606.643) * [-604.978] (-606.646) (-605.069) (-605.674) -- 0:00:38
      375000 -- (-604.274) (-606.389) (-606.518) [-604.272] * (-605.727) (-609.674) (-608.655) [-604.158] -- 0:00:38

      Average standard deviation of split frequencies: 0.012390

      375500 -- (-605.082) (-604.426) (-607.216) [-604.290] * (-604.979) (-606.195) [-609.374] (-604.000) -- 0:00:38
      376000 -- (-605.015) (-605.664) [-605.224] (-606.045) * (-603.793) [-605.201] (-607.456) (-605.582) -- 0:00:38
      376500 -- [-605.462] (-605.823) (-605.969) (-604.876) * (-606.394) (-607.416) (-605.268) [-605.022] -- 0:00:38
      377000 -- (-604.856) (-605.685) [-604.941] (-607.172) * (-609.250) (-605.564) (-605.984) [-605.365] -- 0:00:38
      377500 -- [-606.353] (-605.134) (-604.465) (-604.978) * (-606.810) (-609.515) (-606.093) [-604.631] -- 0:00:37
      378000 -- (-605.662) (-607.334) [-605.352] (-604.700) * (-604.522) [-603.505] (-605.365) (-605.878) -- 0:00:37
      378500 -- [-605.699] (-606.365) (-604.675) (-604.406) * (-605.138) [-604.371] (-605.932) (-607.832) -- 0:00:37
      379000 -- (-607.527) [-604.582] (-606.494) (-608.701) * (-604.808) (-604.851) (-606.701) [-605.892] -- 0:00:37
      379500 -- [-605.069] (-604.308) (-610.317) (-606.261) * (-603.876) [-605.178] (-607.490) (-609.754) -- 0:00:37
      380000 -- [-603.852] (-604.637) (-608.812) (-605.574) * (-608.546) (-605.008) (-606.239) [-610.176] -- 0:00:37

      Average standard deviation of split frequencies: 0.012602

      380500 -- (-604.475) (-606.581) (-607.415) [-604.869] * (-603.756) (-608.321) [-608.028] (-606.460) -- 0:00:37
      381000 -- (-606.435) (-605.577) (-606.876) [-607.447] * (-604.524) [-606.314] (-606.122) (-604.120) -- 0:00:37
      381500 -- (-605.753) [-605.839] (-606.424) (-606.408) * [-604.639] (-605.646) (-608.549) (-606.777) -- 0:00:37
      382000 -- (-605.005) [-605.802] (-604.949) (-607.204) * (-606.141) (-608.140) (-606.386) [-604.595] -- 0:00:37
      382500 -- (-607.276) [-604.518] (-604.281) (-606.353) * (-604.504) (-608.661) (-606.214) [-604.454] -- 0:00:37
      383000 -- [-607.417] (-605.886) (-604.212) (-605.111) * (-604.804) (-604.319) (-612.213) [-604.377] -- 0:00:37
      383500 -- (-607.147) (-607.601) (-606.284) [-604.265] * (-604.334) [-608.757] (-607.250) (-606.146) -- 0:00:36
      384000 -- [-605.325] (-608.997) (-607.479) (-606.886) * [-605.022] (-606.701) (-607.988) (-608.365) -- 0:00:36
      384500 -- (-604.727) [-606.521] (-606.798) (-609.873) * (-606.229) (-607.841) [-606.420] (-607.502) -- 0:00:38
      385000 -- [-607.983] (-604.612) (-603.688) (-609.329) * (-606.061) [-607.721] (-607.138) (-604.907) -- 0:00:38

      Average standard deviation of split frequencies: 0.013721

      385500 -- (-604.101) [-605.224] (-606.819) (-609.165) * (-605.898) (-605.446) (-606.602) [-607.665] -- 0:00:38
      386000 -- (-606.844) (-604.586) [-607.213] (-608.856) * (-604.870) (-604.876) [-605.968] (-607.442) -- 0:00:38
      386500 -- (-609.474) [-604.510] (-603.799) (-607.605) * (-605.235) (-607.415) (-604.673) [-605.666] -- 0:00:38
      387000 -- (-605.624) (-608.534) (-603.720) [-606.200] * (-604.991) (-603.809) (-605.338) [-604.348] -- 0:00:38
      387500 -- (-608.083) (-610.319) (-605.996) [-605.063] * (-605.664) (-604.789) (-608.839) [-608.057] -- 0:00:37
      388000 -- (-604.861) (-604.047) (-610.867) [-605.934] * (-604.909) [-611.508] (-609.287) (-608.760) -- 0:00:37
      388500 -- [-605.888] (-604.209) (-610.338) (-605.049) * (-604.680) [-608.118] (-607.389) (-605.343) -- 0:00:37
      389000 -- (-606.422) (-610.000) [-606.591] (-606.826) * (-605.147) (-606.505) (-605.335) [-605.654] -- 0:00:37
      389500 -- [-604.609] (-605.545) (-604.560) (-605.693) * (-604.456) [-605.274] (-606.760) (-605.201) -- 0:00:37
      390000 -- (-604.523) (-605.748) (-606.990) [-605.628] * [-603.926] (-606.974) (-605.703) (-607.281) -- 0:00:37

      Average standard deviation of split frequencies: 0.013202

      390500 -- [-605.436] (-605.401) (-605.967) (-605.951) * (-604.959) (-604.155) [-604.519] (-603.497) -- 0:00:37
      391000 -- (-607.640) [-603.588] (-606.592) (-605.578) * (-606.502) (-604.991) [-605.971] (-605.528) -- 0:00:37
      391500 -- [-607.021] (-604.974) (-603.838) (-607.164) * [-604.472] (-604.727) (-608.580) (-606.806) -- 0:00:37
      392000 -- (-605.292) (-605.037) [-605.332] (-608.204) * (-609.202) (-607.002) [-605.938] (-608.446) -- 0:00:37
      392500 -- (-611.596) [-605.692] (-607.742) (-605.748) * (-608.110) [-606.406] (-609.659) (-606.271) -- 0:00:37
      393000 -- (-608.017) (-606.859) (-606.907) [-606.145] * (-604.741) (-606.967) [-605.754] (-610.363) -- 0:00:37
      393500 -- (-610.981) (-609.693) (-605.800) [-605.264] * (-604.177) [-609.289] (-606.244) (-609.134) -- 0:00:36
      394000 -- [-605.905] (-606.699) (-610.273) (-605.459) * (-606.551) [-609.196] (-605.835) (-603.847) -- 0:00:36
      394500 -- (-604.326) [-605.372] (-606.144) (-604.593) * (-608.115) (-609.253) (-603.757) [-604.935] -- 0:00:36
      395000 -- [-604.901] (-606.769) (-606.447) (-604.511) * [-607.204] (-606.249) (-605.231) (-604.826) -- 0:00:36

      Average standard deviation of split frequencies: 0.012955

      395500 -- (-613.746) (-609.419) (-605.656) [-606.913] * (-606.449) [-604.585] (-605.160) (-605.044) -- 0:00:36
      396000 -- (-603.887) [-604.616] (-604.779) (-607.970) * (-606.194) [-605.488] (-605.267) (-605.300) -- 0:00:36
      396500 -- (-607.173) [-606.849] (-604.528) (-606.335) * (-604.664) (-604.701) (-609.574) [-606.317] -- 0:00:36
      397000 -- [-606.245] (-605.620) (-604.737) (-610.060) * [-604.499] (-608.024) (-606.679) (-606.236) -- 0:00:36
      397500 -- (-606.433) (-604.847) [-609.270] (-605.576) * (-605.486) [-605.106] (-605.331) (-608.794) -- 0:00:36
      398000 -- [-604.910] (-605.976) (-604.590) (-607.794) * (-605.007) [-606.392] (-604.982) (-607.428) -- 0:00:36
      398500 -- (-604.486) [-608.130] (-604.963) (-606.654) * (-604.462) [-605.406] (-606.784) (-608.343) -- 0:00:36
      399000 -- (-606.501) (-606.223) [-605.082] (-605.309) * (-604.319) [-605.862] (-606.513) (-606.635) -- 0:00:36
      399500 -- [-606.865] (-605.766) (-604.684) (-604.095) * (-603.875) (-608.913) (-604.658) [-604.497] -- 0:00:36
      400000 -- (-612.006) (-606.070) [-606.089] (-603.869) * (-605.982) [-605.901] (-605.556) (-604.930) -- 0:00:36

      Average standard deviation of split frequencies: 0.012873

      400500 -- [-608.450] (-605.075) (-605.996) (-604.894) * (-604.575) (-606.022) (-604.800) [-604.056] -- 0:00:35
      401000 -- [-606.480] (-605.469) (-610.538) (-605.297) * (-604.485) (-606.936) [-607.684] (-607.201) -- 0:00:37
      401500 -- (-605.638) (-608.121) (-609.713) [-607.082] * (-607.354) (-604.718) [-607.015] (-605.084) -- 0:00:37
      402000 -- (-612.361) (-609.084) (-606.243) [-604.216] * [-605.596] (-604.201) (-604.648) (-605.954) -- 0:00:37
      402500 -- (-608.388) (-607.620) [-603.933] (-605.714) * (-603.845) (-610.663) [-605.890] (-606.634) -- 0:00:37
      403000 -- (-608.313) (-607.304) (-605.226) [-603.791] * (-606.979) (-605.953) (-607.022) [-606.142] -- 0:00:37
      403500 -- (-605.296) [-607.215] (-608.699) (-605.101) * (-605.076) (-604.760) (-607.748) [-604.549] -- 0:00:36
      404000 -- (-603.779) [-606.088] (-606.300) (-604.169) * (-606.152) (-606.330) (-605.377) [-606.042] -- 0:00:36
      404500 -- (-607.783) (-605.769) [-605.496] (-607.978) * (-610.003) (-606.774) [-611.560] (-604.922) -- 0:00:36
      405000 -- [-605.122] (-609.124) (-608.858) (-605.125) * [-604.321] (-607.130) (-604.948) (-609.111) -- 0:00:36

      Average standard deviation of split frequencies: 0.013114

      405500 -- (-605.413) (-607.865) [-607.178] (-610.066) * (-604.878) [-604.366] (-605.110) (-609.228) -- 0:00:36
      406000 -- (-613.587) (-605.542) [-605.896] (-607.418) * (-605.764) [-604.881] (-606.196) (-607.357) -- 0:00:36
      406500 -- (-607.090) (-604.901) (-604.808) [-609.049] * [-608.977] (-605.349) (-605.373) (-605.497) -- 0:00:36
      407000 -- [-604.998] (-604.349) (-605.085) (-606.181) * (-606.290) [-606.236] (-606.442) (-606.134) -- 0:00:36
      407500 -- (-604.009) (-604.931) [-604.755] (-603.836) * (-604.660) [-604.252] (-604.874) (-604.334) -- 0:00:36
      408000 -- (-605.268) (-608.232) (-606.006) [-609.440] * [-604.937] (-604.911) (-604.533) (-604.446) -- 0:00:36
      408500 -- [-604.683] (-607.631) (-605.551) (-607.133) * (-605.617) [-606.099] (-607.145) (-605.527) -- 0:00:36
      409000 -- [-605.106] (-605.815) (-606.804) (-605.794) * [-604.567] (-608.371) (-606.158) (-605.325) -- 0:00:36
      409500 -- (-605.289) (-605.326) [-609.075] (-616.578) * (-605.537) (-610.028) [-607.772] (-607.031) -- 0:00:36
      410000 -- (-608.094) (-603.819) [-606.752] (-604.510) * (-606.621) [-605.565] (-603.666) (-607.420) -- 0:00:35

      Average standard deviation of split frequencies: 0.011884

      410500 -- (-607.086) [-606.020] (-607.555) (-611.400) * [-604.627] (-607.366) (-608.428) (-605.007) -- 0:00:35
      411000 -- (-604.563) (-606.028) (-609.074) [-604.657] * [-605.222] (-604.933) (-606.446) (-606.537) -- 0:00:35
      411500 -- (-606.072) [-606.809] (-606.667) (-608.017) * [-604.531] (-604.700) (-606.665) (-605.154) -- 0:00:35
      412000 -- (-607.308) (-606.328) [-606.004] (-608.675) * (-604.346) (-606.932) (-607.068) [-603.852] -- 0:00:35
      412500 -- [-606.416] (-608.575) (-605.212) (-605.520) * [-604.519] (-606.021) (-605.167) (-611.127) -- 0:00:35
      413000 -- (-606.249) (-606.025) (-605.481) [-604.325] * (-604.143) (-604.572) (-607.208) [-605.737] -- 0:00:35
      413500 -- (-605.944) (-604.339) (-606.619) [-606.807] * [-606.707] (-607.110) (-609.304) (-607.286) -- 0:00:35
      414000 -- [-605.033] (-605.004) (-607.802) (-603.986) * (-605.979) (-609.270) [-604.969] (-605.917) -- 0:00:35
      414500 -- (-604.907) (-605.317) (-604.986) [-604.717] * (-605.331) (-604.514) [-604.864] (-604.980) -- 0:00:35
      415000 -- (-606.077) (-605.131) [-605.689] (-605.780) * (-606.959) (-605.184) (-606.681) [-608.753] -- 0:00:35

      Average standard deviation of split frequencies: 0.012065

      415500 -- (-604.146) (-605.532) [-607.349] (-605.836) * (-607.240) (-606.048) [-605.208] (-606.792) -- 0:00:35
      416000 -- [-606.828] (-605.257) (-604.410) (-609.745) * (-608.723) (-606.207) (-605.967) [-608.326] -- 0:00:35
      416500 -- [-609.161] (-603.839) (-604.204) (-604.274) * [-608.364] (-604.624) (-608.590) (-608.593) -- 0:00:35
      417000 -- (-608.570) (-606.764) (-610.925) [-607.525] * (-605.915) (-608.690) [-606.210] (-604.116) -- 0:00:34
      417500 -- (-604.809) (-608.621) [-605.193] (-610.628) * [-606.813] (-607.655) (-606.661) (-607.617) -- 0:00:34
      418000 -- (-604.286) [-607.970] (-606.368) (-607.284) * (-604.794) [-607.653] (-607.050) (-605.574) -- 0:00:36
      418500 -- (-606.064) [-605.641] (-606.958) (-605.032) * [-605.201] (-607.995) (-608.160) (-606.688) -- 0:00:36
      419000 -- (-606.252) [-605.300] (-607.083) (-608.181) * (-611.749) (-605.824) [-604.820] (-605.995) -- 0:00:36
      419500 -- (-607.850) [-606.863] (-607.447) (-604.457) * (-605.076) (-604.416) (-607.401) [-606.727] -- 0:00:35
      420000 -- (-604.887) (-606.264) (-605.844) [-604.148] * [-605.985] (-605.081) (-605.261) (-606.292) -- 0:00:35

      Average standard deviation of split frequencies: 0.011668

      420500 -- (-604.739) [-606.509] (-606.159) (-607.696) * [-606.606] (-605.226) (-605.512) (-604.028) -- 0:00:35
      421000 -- (-606.477) [-604.359] (-604.543) (-609.292) * (-605.019) [-604.551] (-605.794) (-605.451) -- 0:00:35
      421500 -- (-604.962) (-607.366) (-604.772) [-604.554] * (-606.848) (-604.458) [-605.796] (-604.591) -- 0:00:35
      422000 -- (-605.875) (-607.214) [-604.576] (-605.526) * (-607.065) (-604.313) (-605.080) [-604.453] -- 0:00:35
      422500 -- (-607.199) (-605.964) [-604.727] (-606.883) * (-603.807) [-605.426] (-608.415) (-604.926) -- 0:00:35
      423000 -- (-606.240) [-604.012] (-604.212) (-605.638) * (-605.015) [-608.525] (-605.627) (-604.627) -- 0:00:35
      423500 -- (-608.747) (-605.774) [-604.896] (-604.377) * (-607.822) [-608.564] (-607.962) (-603.949) -- 0:00:35
      424000 -- (-604.401) [-603.802] (-605.494) (-605.715) * (-606.961) [-606.072] (-605.802) (-605.369) -- 0:00:35
      424500 -- (-605.458) [-603.635] (-606.403) (-606.228) * [-607.643] (-607.497) (-605.586) (-604.705) -- 0:00:35
      425000 -- [-605.146] (-605.344) (-608.511) (-605.531) * (-610.042) [-608.565] (-605.800) (-606.520) -- 0:00:35

      Average standard deviation of split frequencies: 0.011521

      425500 -- (-606.020) (-605.975) [-606.738] (-606.577) * (-606.531) [-607.368] (-606.076) (-607.268) -- 0:00:35
      426000 -- (-608.536) [-605.543] (-616.787) (-608.186) * (-607.776) (-607.516) (-606.035) [-604.067] -- 0:00:35
      426500 -- [-604.300] (-604.603) (-606.570) (-604.967) * (-609.413) [-603.918] (-607.443) (-604.832) -- 0:00:34
      427000 -- (-604.059) (-607.738) (-604.803) [-605.557] * (-607.244) (-608.321) [-609.854] (-605.825) -- 0:00:34
      427500 -- [-606.143] (-607.198) (-606.888) (-606.312) * (-605.292) (-607.263) (-606.148) [-605.660] -- 0:00:34
      428000 -- (-604.885) [-607.249] (-610.969) (-605.306) * [-604.968] (-608.061) (-606.137) (-609.526) -- 0:00:34
      428500 -- (-607.403) (-606.708) (-604.684) [-608.142] * (-605.315) (-609.280) [-605.397] (-607.415) -- 0:00:34
      429000 -- (-605.980) (-604.155) [-606.545] (-605.509) * [-606.136] (-607.015) (-607.956) (-605.657) -- 0:00:34
      429500 -- (-606.995) (-608.709) [-604.984] (-605.102) * (-606.739) (-605.175) (-606.119) [-605.513] -- 0:00:34
      430000 -- (-605.649) (-608.276) [-610.470] (-610.407) * (-608.451) [-605.946] (-603.707) (-605.497) -- 0:00:34

      Average standard deviation of split frequencies: 0.012556

      430500 -- (-609.998) (-605.055) (-605.314) [-607.006] * [-606.580] (-608.297) (-604.131) (-607.769) -- 0:00:34
      431000 -- (-610.186) (-604.945) (-605.655) [-605.256] * [-604.515] (-604.061) (-607.550) (-606.949) -- 0:00:34
      431500 -- (-607.337) [-605.920] (-605.393) (-605.759) * (-604.589) (-606.291) (-605.347) [-605.087] -- 0:00:34
      432000 -- (-607.867) [-604.229] (-605.735) (-607.418) * [-604.888] (-608.281) (-605.252) (-604.031) -- 0:00:34
      432500 -- (-604.610) (-606.518) [-606.204] (-604.186) * (-604.553) (-610.195) [-607.592] (-604.718) -- 0:00:34
      433000 -- [-605.075] (-604.337) (-606.826) (-603.993) * (-604.419) (-606.918) [-605.357] (-605.481) -- 0:00:34
      433500 -- [-604.293] (-604.503) (-605.726) (-605.601) * (-606.297) [-606.447] (-605.665) (-604.578) -- 0:00:33
      434000 -- (-604.105) (-606.708) [-609.088] (-608.244) * (-606.214) [-604.240] (-605.244) (-603.871) -- 0:00:33
      434500 -- (-603.461) [-607.255] (-607.725) (-606.085) * (-606.895) (-605.296) (-607.211) [-604.532] -- 0:00:35
      435000 -- (-603.582) (-608.376) [-605.993] (-606.091) * [-605.919] (-605.331) (-607.154) (-604.553) -- 0:00:35

      Average standard deviation of split frequencies: 0.012434

      435500 -- (-606.625) [-607.326] (-605.996) (-607.157) * (-605.507) (-606.680) [-604.645] (-604.182) -- 0:00:34
      436000 -- (-605.027) (-605.874) [-606.759] (-607.953) * [-606.202] (-607.485) (-605.735) (-609.521) -- 0:00:34
      436500 -- [-605.242] (-605.738) (-609.189) (-605.952) * (-608.202) [-604.722] (-606.442) (-605.351) -- 0:00:34
      437000 -- (-608.240) [-608.276] (-608.372) (-605.852) * [-604.497] (-606.514) (-610.874) (-606.325) -- 0:00:34
      437500 -- (-609.038) (-606.607) (-608.058) [-605.373] * [-607.945] (-609.820) (-604.887) (-607.648) -- 0:00:34
      438000 -- (-606.755) (-603.681) [-607.610] (-604.726) * (-607.149) (-606.922) (-607.472) [-607.735] -- 0:00:34
      438500 -- [-607.807] (-605.047) (-611.808) (-608.879) * [-604.094] (-607.245) (-607.510) (-604.577) -- 0:00:34
      439000 -- (-605.981) (-604.407) (-606.793) [-614.913] * [-603.954] (-604.537) (-607.526) (-606.056) -- 0:00:34
      439500 -- (-608.508) [-607.270] (-609.206) (-611.639) * (-607.758) [-605.067] (-605.850) (-607.746) -- 0:00:34
      440000 -- (-611.159) (-605.434) [-604.959] (-606.924) * (-607.613) [-605.077] (-607.303) (-605.218) -- 0:00:34

      Average standard deviation of split frequencies: 0.012770

      440500 -- [-609.212] (-607.931) (-607.081) (-607.467) * (-606.804) (-604.521) [-605.300] (-605.462) -- 0:00:34
      441000 -- (-606.574) [-607.287] (-606.075) (-606.388) * (-606.998) (-606.269) (-609.074) [-605.193] -- 0:00:34
      441500 -- [-605.779] (-607.776) (-604.719) (-610.269) * (-605.834) (-607.501) (-605.912) [-604.687] -- 0:00:34
      442000 -- [-605.203] (-605.284) (-604.182) (-608.033) * (-603.944) [-608.714] (-604.272) (-603.909) -- 0:00:34
      442500 -- [-605.523] (-606.101) (-604.056) (-605.587) * (-609.130) [-605.943] (-606.169) (-603.949) -- 0:00:34
      443000 -- [-606.136] (-605.701) (-605.552) (-606.840) * (-606.578) (-607.430) (-606.579) [-604.127] -- 0:00:33
      443500 -- (-603.952) (-604.916) [-605.445] (-606.139) * (-606.388) (-606.197) (-606.094) [-604.445] -- 0:00:33
      444000 -- (-606.618) (-609.058) [-605.750] (-604.969) * [-605.487] (-607.225) (-605.098) (-604.109) -- 0:00:33
      444500 -- (-606.069) (-612.372) [-608.699] (-607.793) * (-604.531) [-604.362] (-605.748) (-605.041) -- 0:00:33
      445000 -- (-606.019) (-608.798) [-607.993] (-606.408) * (-604.661) [-605.399] (-607.777) (-606.478) -- 0:00:33

      Average standard deviation of split frequencies: 0.013057

      445500 -- (-605.037) (-606.100) (-605.933) [-607.212] * (-606.912) (-605.444) [-606.258] (-611.109) -- 0:00:33
      446000 -- (-606.712) (-604.895) (-609.337) [-607.127] * (-605.430) (-605.194) [-608.843] (-606.611) -- 0:00:33
      446500 -- [-606.104] (-604.451) (-604.865) (-605.378) * [-603.922] (-604.450) (-609.728) (-608.592) -- 0:00:33
      447000 -- (-606.336) (-605.988) (-606.738) [-604.099] * [-605.094] (-605.982) (-605.588) (-605.900) -- 0:00:33
      447500 -- (-606.433) (-605.231) [-606.179] (-605.979) * (-604.063) (-604.725) [-605.423] (-605.103) -- 0:00:33
      448000 -- (-604.602) (-605.269) [-606.674] (-605.732) * [-605.234] (-604.241) (-608.793) (-607.775) -- 0:00:33
      448500 -- (-609.564) (-605.369) [-606.457] (-605.530) * (-605.684) (-605.867) (-607.363) [-605.077] -- 0:00:33
      449000 -- (-609.492) [-605.014] (-607.720) (-608.562) * (-609.771) (-605.364) [-605.541] (-605.272) -- 0:00:33
      449500 -- [-605.344] (-604.106) (-604.497) (-604.777) * (-611.457) (-606.548) (-604.725) [-605.503] -- 0:00:34
      450000 -- (-609.076) (-604.356) (-605.651) [-604.897] * (-607.940) (-609.060) (-607.510) [-605.947] -- 0:00:34

      Average standard deviation of split frequencies: 0.013291

      450500 -- (-604.982) [-604.623] (-606.553) (-606.965) * (-604.179) [-604.611] (-606.505) (-607.144) -- 0:00:34
      451000 -- (-603.465) (-605.353) [-611.338] (-612.190) * (-607.507) (-604.558) [-605.731] (-605.541) -- 0:00:34
      451500 -- (-607.858) [-606.636] (-606.816) (-607.651) * (-606.887) (-606.242) [-606.040] (-607.841) -- 0:00:34
      452000 -- (-605.203) [-603.647] (-608.211) (-606.910) * (-606.359) (-604.833) (-609.251) [-605.419] -- 0:00:33
      452500 -- (-605.213) (-606.870) [-608.237] (-607.136) * (-608.048) (-606.031) (-605.022) [-603.689] -- 0:00:33
      453000 -- [-604.812] (-604.251) (-606.581) (-610.200) * (-608.092) [-606.235] (-608.515) (-603.709) -- 0:00:33
      453500 -- (-605.636) [-604.507] (-606.518) (-609.295) * [-605.482] (-604.877) (-605.911) (-608.701) -- 0:00:33
      454000 -- [-604.645] (-604.100) (-606.051) (-603.933) * (-603.637) [-604.168] (-604.391) (-604.835) -- 0:00:33
      454500 -- (-606.426) (-605.279) (-609.479) [-606.774] * (-606.305) [-605.354] (-605.240) (-607.163) -- 0:00:33
      455000 -- [-605.452] (-607.233) (-606.873) (-604.483) * [-606.146] (-605.766) (-604.707) (-607.281) -- 0:00:33

      Average standard deviation of split frequencies: 0.013135

      455500 -- (-605.948) [-604.777] (-606.434) (-605.600) * [-604.310] (-608.531) (-604.658) (-606.395) -- 0:00:33
      456000 -- (-605.227) (-605.804) (-606.681) [-604.452] * (-603.945) [-606.287] (-606.545) (-604.284) -- 0:00:33
      456500 -- (-609.654) (-606.470) [-605.581] (-604.463) * (-605.031) (-605.820) [-606.600] (-610.798) -- 0:00:33
      457000 -- [-605.084] (-607.843) (-605.446) (-604.582) * (-604.816) [-604.803] (-607.978) (-606.740) -- 0:00:33
      457500 -- [-606.197] (-606.039) (-605.445) (-604.895) * (-605.909) (-605.862) (-605.232) [-606.135] -- 0:00:33
      458000 -- (-604.697) (-605.237) (-608.241) [-607.093] * (-607.759) [-609.701] (-606.486) (-608.598) -- 0:00:33
      458500 -- [-605.139] (-604.807) (-605.216) (-605.518) * (-605.043) (-608.521) (-606.382) [-605.371] -- 0:00:33
      459000 -- (-605.926) [-606.486] (-605.334) (-603.982) * [-604.594] (-604.431) (-606.402) (-605.387) -- 0:00:33
      459500 -- [-604.997] (-604.748) (-604.951) (-604.908) * [-604.794] (-607.613) (-605.888) (-605.702) -- 0:00:32
      460000 -- [-604.519] (-606.028) (-606.261) (-606.661) * (-603.963) (-608.054) (-604.976) [-606.774] -- 0:00:32

      Average standard deviation of split frequencies: 0.012663

      460500 -- (-604.876) (-605.355) [-606.319] (-605.059) * [-603.896] (-606.675) (-610.004) (-606.863) -- 0:00:32
      461000 -- (-608.249) (-605.776) (-605.479) [-604.879] * (-604.090) [-604.261] (-606.141) (-607.920) -- 0:00:32
      461500 -- (-606.180) [-607.755] (-607.170) (-605.809) * (-606.278) (-605.657) [-605.827] (-604.273) -- 0:00:32
      462000 -- (-612.231) [-604.782] (-606.210) (-615.143) * (-608.278) (-607.702) [-604.878] (-608.529) -- 0:00:32
      462500 -- [-604.488] (-605.043) (-605.820) (-605.229) * (-607.343) (-608.027) [-605.534] (-607.067) -- 0:00:32
      463000 -- (-608.042) [-604.644] (-606.762) (-607.652) * (-605.659) (-607.257) (-604.867) [-607.737] -- 0:00:32
      463500 -- (-607.745) (-607.245) [-605.398] (-604.566) * (-605.206) [-606.156] (-605.763) (-608.793) -- 0:00:32
      464000 -- (-603.566) (-604.620) [-606.826] (-605.410) * [-605.505] (-606.112) (-605.101) (-606.079) -- 0:00:32
      464500 -- (-606.646) (-607.153) [-603.631] (-604.206) * (-609.598) (-610.620) [-607.207] (-603.933) -- 0:00:32
      465000 -- (-604.565) (-607.254) [-605.407] (-604.606) * (-603.945) (-607.501) [-605.545] (-604.102) -- 0:00:32

      Average standard deviation of split frequencies: 0.012675

      465500 -- (-604.514) [-603.969] (-604.196) (-606.236) * [-604.185] (-605.609) (-608.130) (-606.037) -- 0:00:33
      466000 -- (-612.676) [-604.185] (-605.320) (-610.146) * (-607.332) (-606.842) [-607.831] (-604.423) -- 0:00:33
      466500 -- (-614.713) (-606.745) [-608.913] (-605.152) * (-607.491) (-606.027) [-605.256] (-607.721) -- 0:00:33
      467000 -- (-605.151) (-607.621) [-607.067] (-605.957) * (-610.925) (-605.575) (-604.522) [-605.610] -- 0:00:33
      467500 -- [-607.535] (-610.310) (-604.445) (-606.001) * [-606.334] (-606.491) (-604.229) (-604.324) -- 0:00:33
      468000 -- (-605.103) (-608.220) [-605.787] (-604.292) * [-603.945] (-608.665) (-606.343) (-604.378) -- 0:00:32
      468500 -- (-603.534) [-607.573] (-604.964) (-605.282) * [-605.450] (-610.256) (-606.627) (-605.440) -- 0:00:32
      469000 -- [-606.317] (-604.798) (-604.823) (-606.747) * (-608.448) (-605.263) [-607.176] (-605.016) -- 0:00:32
      469500 -- [-608.059] (-607.832) (-606.735) (-608.071) * (-606.962) [-605.084] (-608.160) (-608.258) -- 0:00:32
      470000 -- [-605.686] (-607.905) (-606.020) (-608.303) * (-604.840) (-607.894) (-608.670) [-604.750] -- 0:00:32

      Average standard deviation of split frequencies: 0.013020

      470500 -- (-607.601) [-603.796] (-606.150) (-606.500) * [-605.556] (-605.201) (-606.212) (-607.581) -- 0:00:32
      471000 -- (-607.566) [-605.803] (-604.578) (-606.610) * (-605.073) (-608.088) (-605.730) [-605.498] -- 0:00:32
      471500 -- (-605.054) (-607.332) (-607.088) [-607.546] * (-605.019) (-612.442) (-603.891) [-604.240] -- 0:00:32
      472000 -- (-605.003) (-606.633) (-605.583) [-603.888] * [-605.393] (-610.247) (-607.925) (-605.819) -- 0:00:32
      472500 -- (-605.515) (-604.214) [-605.452] (-614.573) * (-605.653) (-610.020) [-605.419] (-611.578) -- 0:00:32
      473000 -- (-606.463) [-604.461] (-606.280) (-606.424) * [-603.689] (-606.065) (-607.712) (-604.622) -- 0:00:32
      473500 -- (-608.515) (-604.383) [-607.915] (-607.983) * (-605.280) (-605.823) (-607.654) [-607.041] -- 0:00:32
      474000 -- [-605.086] (-604.922) (-605.708) (-607.125) * [-607.984] (-605.934) (-604.627) (-606.591) -- 0:00:32
      474500 -- (-606.446) (-604.863) (-611.436) [-607.208] * [-605.395] (-606.488) (-605.335) (-605.128) -- 0:00:32
      475000 -- (-605.662) [-604.208] (-604.273) (-607.224) * [-605.990] (-611.689) (-607.174) (-606.215) -- 0:00:32

      Average standard deviation of split frequencies: 0.013060

      475500 -- (-605.163) (-607.638) [-605.171] (-605.613) * (-605.286) [-605.215] (-608.887) (-605.943) -- 0:00:31
      476000 -- (-612.053) [-605.344] (-607.592) (-604.927) * (-605.722) [-604.910] (-606.714) (-605.841) -- 0:00:31
      476500 -- [-605.476] (-605.710) (-605.477) (-603.919) * (-610.534) (-604.077) [-606.486] (-608.027) -- 0:00:31
      477000 -- (-610.619) (-604.695) [-604.883] (-604.851) * (-606.600) (-609.962) (-605.299) [-606.309] -- 0:00:31
      477500 -- (-612.087) [-605.420] (-605.168) (-611.110) * (-606.282) [-603.550] (-606.221) (-605.249) -- 0:00:31
      478000 -- (-605.240) [-604.415] (-606.853) (-606.440) * (-605.749) (-604.658) (-607.534) [-605.123] -- 0:00:31
      478500 -- (-609.223) (-604.538) [-605.482] (-610.949) * (-605.308) (-606.355) [-606.075] (-603.887) -- 0:00:31
      479000 -- (-606.173) (-608.567) [-606.110] (-609.905) * (-607.763) (-611.618) (-604.854) [-603.682] -- 0:00:31
      479500 -- [-604.333] (-606.603) (-604.827) (-605.704) * (-610.666) [-609.362] (-604.608) (-605.819) -- 0:00:31
      480000 -- [-604.132] (-605.778) (-605.233) (-603.984) * (-610.825) (-606.365) [-606.905] (-605.373) -- 0:00:31

      Average standard deviation of split frequencies: 0.012688

      480500 -- (-604.285) (-607.725) (-605.265) [-604.347] * (-605.065) (-604.936) (-607.024) [-608.245] -- 0:00:31
      481000 -- (-606.059) [-604.313] (-609.149) (-606.292) * (-604.298) (-604.055) (-604.700) [-608.515] -- 0:00:31
      481500 -- (-606.853) [-604.101] (-604.969) (-605.103) * (-605.824) [-605.384] (-605.176) (-606.410) -- 0:00:31
      482000 -- (-607.273) [-607.161] (-604.881) (-604.482) * (-605.558) (-603.933) [-607.443] (-609.022) -- 0:00:31
      482500 -- (-608.030) (-607.901) (-603.675) [-605.604] * (-605.082) [-606.901] (-606.828) (-604.022) -- 0:00:32
      483000 -- (-619.232) (-614.148) (-607.298) [-603.786] * (-607.507) [-607.625] (-604.775) (-607.554) -- 0:00:32
      483500 -- [-604.890] (-608.741) (-609.509) (-604.467) * (-605.242) (-607.346) [-604.027] (-606.862) -- 0:00:32
      484000 -- (-608.025) (-605.128) (-610.281) [-604.085] * [-603.964] (-605.747) (-605.595) (-608.022) -- 0:00:31
      484500 -- (-604.488) (-607.175) [-604.216] (-606.433) * (-606.225) (-605.620) [-607.655] (-607.170) -- 0:00:31
      485000 -- (-606.945) (-605.261) (-604.538) [-605.520] * (-608.197) (-605.178) [-605.378] (-608.488) -- 0:00:31

      Average standard deviation of split frequencies: 0.012185

      485500 -- (-604.056) (-606.164) [-606.068] (-606.936) * (-604.252) (-608.066) (-605.875) [-604.509] -- 0:00:31
      486000 -- (-604.690) [-610.630] (-604.353) (-608.036) * (-605.001) (-604.615) [-604.689] (-606.663) -- 0:00:31
      486500 -- (-605.371) (-606.699) (-604.543) [-606.855] * (-605.968) [-605.785] (-603.634) (-605.976) -- 0:00:31
      487000 -- (-605.516) (-606.518) [-604.658] (-606.602) * (-606.092) (-607.135) (-606.531) [-608.890] -- 0:00:31
      487500 -- (-604.364) (-604.088) (-605.776) [-605.755] * (-610.042) [-605.887] (-603.783) (-608.925) -- 0:00:31
      488000 -- [-605.847] (-607.785) (-606.443) (-608.571) * (-604.937) (-603.973) [-607.477] (-604.139) -- 0:00:31
      488500 -- (-605.992) [-607.394] (-606.860) (-607.288) * [-604.611] (-604.055) (-608.254) (-605.068) -- 0:00:31
      489000 -- (-604.884) [-605.894] (-605.218) (-607.010) * (-604.734) (-605.094) [-606.192] (-603.794) -- 0:00:31
      489500 -- (-605.505) [-604.582] (-604.772) (-605.042) * (-607.963) (-604.762) [-604.100] (-609.048) -- 0:00:31
      490000 -- [-604.672] (-605.140) (-605.209) (-607.927) * [-605.031] (-604.011) (-605.746) (-606.440) -- 0:00:31

      Average standard deviation of split frequencies: 0.012249

      490500 -- (-605.828) (-605.265) [-605.890] (-605.345) * [-605.642] (-604.378) (-606.289) (-609.509) -- 0:00:31
      491000 -- (-608.195) (-604.277) (-605.718) [-608.236] * (-607.554) [-603.996] (-606.534) (-608.978) -- 0:00:31
      491500 -- (-606.507) (-603.767) (-604.375) [-604.141] * [-608.975] (-608.565) (-603.998) (-604.406) -- 0:00:31
      492000 -- [-604.535] (-604.768) (-605.224) (-606.560) * (-607.027) (-606.493) (-608.440) [-605.869] -- 0:00:30
      492500 -- [-604.419] (-605.616) (-604.846) (-606.151) * (-606.208) (-605.753) [-607.586] (-604.712) -- 0:00:30
      493000 -- (-604.867) (-604.703) (-606.512) [-605.391] * (-605.302) (-607.347) (-607.229) [-605.575] -- 0:00:30
      493500 -- (-609.360) (-604.968) (-607.057) [-606.707] * (-605.488) (-606.396) [-604.883] (-603.988) -- 0:00:30
      494000 -- [-609.061] (-608.675) (-606.568) (-603.902) * (-605.352) (-609.660) (-605.532) [-605.657] -- 0:00:30
      494500 -- [-606.514] (-609.732) (-606.759) (-605.429) * (-605.675) (-610.550) [-604.923] (-605.345) -- 0:00:30
      495000 -- [-604.844] (-606.513) (-605.570) (-604.825) * (-607.746) (-606.181) (-611.165) [-607.592] -- 0:00:30

      Average standard deviation of split frequencies: 0.011405

      495500 -- (-610.380) (-605.015) [-604.121] (-607.891) * [-608.826] (-606.403) (-608.657) (-610.461) -- 0:00:30
      496000 -- (-605.810) (-608.759) (-604.634) [-606.882] * (-607.150) [-606.884] (-606.160) (-607.366) -- 0:00:30
      496500 -- [-604.358] (-605.519) (-604.467) (-604.669) * (-604.433) [-610.988] (-605.833) (-604.474) -- 0:00:30
      497000 -- (-605.222) (-606.496) (-606.015) [-604.628] * (-604.630) [-605.422] (-606.611) (-605.973) -- 0:00:30
      497500 -- (-608.522) (-604.408) [-604.102] (-605.716) * [-606.478] (-607.112) (-610.347) (-606.599) -- 0:00:31
      498000 -- [-605.854] (-605.249) (-604.276) (-604.773) * [-609.837] (-607.336) (-611.662) (-604.107) -- 0:00:31
      498500 -- (-605.539) (-607.238) [-607.968] (-605.362) * [-608.693] (-609.479) (-607.217) (-607.430) -- 0:00:31
      499000 -- (-609.540) [-604.256] (-604.280) (-606.287) * (-606.262) (-609.195) (-605.725) [-606.615] -- 0:00:31
      499500 -- [-608.649] (-605.169) (-603.919) (-607.127) * (-609.943) (-605.104) (-606.243) [-607.917] -- 0:00:31
      500000 -- [-605.754] (-606.281) (-607.731) (-604.547) * [-606.651] (-609.652) (-606.683) (-605.388) -- 0:00:31

      Average standard deviation of split frequencies: 0.011769

      500500 -- (-607.181) (-607.255) [-605.650] (-606.543) * (-605.638) (-605.917) [-605.365] (-604.684) -- 0:00:30
      501000 -- [-604.745] (-606.799) (-606.939) (-606.625) * (-608.014) (-605.569) (-607.518) [-605.459] -- 0:00:30
      501500 -- [-604.328] (-605.997) (-606.752) (-604.559) * [-607.812] (-605.474) (-606.456) (-604.856) -- 0:00:30
      502000 -- [-605.435] (-605.044) (-606.255) (-603.656) * [-606.769] (-610.995) (-606.729) (-608.846) -- 0:00:30
      502500 -- (-605.090) (-607.764) (-608.845) [-604.497] * (-608.094) (-607.815) [-604.289] (-604.598) -- 0:00:30
      503000 -- (-604.211) (-606.717) (-605.256) [-605.648] * (-604.793) (-608.991) [-606.444] (-606.043) -- 0:00:30
      503500 -- (-606.636) (-610.938) (-606.014) [-607.244] * (-605.999) [-608.113] (-604.260) (-604.671) -- 0:00:30
      504000 -- [-606.392] (-615.577) (-606.045) (-605.498) * (-605.589) [-607.026] (-605.187) (-605.065) -- 0:00:30
      504500 -- (-604.269) [-606.610] (-605.293) (-606.187) * (-607.822) (-607.558) (-606.177) [-606.675] -- 0:00:30
      505000 -- [-604.350] (-612.410) (-605.847) (-610.023) * (-606.471) (-611.071) [-604.619] (-605.983) -- 0:00:30

      Average standard deviation of split frequencies: 0.011412

      505500 -- [-605.707] (-605.814) (-608.440) (-606.837) * (-604.237) (-611.005) (-609.727) [-605.529] -- 0:00:30
      506000 -- [-608.562] (-605.034) (-606.388) (-607.246) * (-604.630) (-607.110) [-605.449] (-605.678) -- 0:00:30
      506500 -- (-606.260) (-605.790) [-605.818] (-605.791) * [-603.815] (-605.515) (-606.967) (-608.587) -- 0:00:30
      507000 -- [-605.899] (-605.282) (-609.014) (-609.930) * (-607.505) (-604.442) (-604.556) [-605.483] -- 0:00:30
      507500 -- (-606.318) (-606.041) (-604.766) [-607.726] * (-604.841) (-605.621) (-605.391) [-604.387] -- 0:00:30
      508000 -- (-608.187) (-608.350) (-604.973) [-607.846] * (-611.334) (-605.840) [-607.279] (-607.259) -- 0:00:30
      508500 -- (-605.412) (-606.404) [-604.354] (-608.482) * (-605.323) (-609.059) (-607.287) [-604.985] -- 0:00:29
      509000 -- (-606.576) (-607.439) [-607.437] (-608.771) * (-605.316) [-605.418] (-606.470) (-603.643) -- 0:00:29
      509500 -- [-604.201] (-605.879) (-603.979) (-605.935) * (-607.364) [-606.371] (-605.765) (-603.609) -- 0:00:29
      510000 -- (-605.271) (-604.116) (-610.222) [-604.842] * (-609.767) (-605.000) [-603.880] (-605.976) -- 0:00:29

      Average standard deviation of split frequencies: 0.011943

      510500 -- (-607.029) [-606.307] (-608.458) (-604.445) * (-609.549) [-605.858] (-606.635) (-605.725) -- 0:00:29
      511000 -- (-610.172) [-605.003] (-604.925) (-603.880) * (-604.616) [-604.955] (-604.168) (-607.294) -- 0:00:29
      511500 -- [-606.895] (-606.916) (-606.764) (-603.787) * [-604.685] (-603.631) (-605.282) (-606.206) -- 0:00:29
      512000 -- (-608.723) (-609.093) (-607.929) [-603.856] * (-607.044) (-604.619) [-606.211] (-607.995) -- 0:00:29
      512500 -- (-606.336) (-607.117) (-608.443) [-604.260] * [-603.831] (-607.701) (-606.104) (-608.083) -- 0:00:29
      513000 -- [-606.201] (-604.702) (-607.120) (-605.880) * (-605.539) (-605.757) [-607.334] (-607.401) -- 0:00:29
      513500 -- (-603.925) [-604.539] (-605.056) (-605.701) * (-606.934) (-606.660) (-606.142) [-604.699] -- 0:00:29
      514000 -- (-603.598) (-605.831) (-606.105) [-604.850] * (-608.223) [-607.353] (-604.761) (-605.361) -- 0:00:30
      514500 -- (-604.269) (-606.916) [-605.996] (-609.800) * (-609.827) (-604.958) (-603.804) [-604.875] -- 0:00:30
      515000 -- (-605.223) [-606.918] (-604.342) (-611.607) * (-607.644) (-603.760) (-607.512) [-606.616] -- 0:00:30

      Average standard deviation of split frequencies: 0.012619

      515500 -- (-604.869) [-605.307] (-605.936) (-606.268) * (-604.500) (-604.472) (-608.463) [-604.870] -- 0:00:30
      516000 -- (-604.198) (-605.058) [-604.448] (-604.915) * (-604.822) [-605.252] (-605.916) (-605.907) -- 0:00:30
      516500 -- (-604.435) [-603.476] (-604.445) (-605.518) * [-605.571] (-604.156) (-606.926) (-606.681) -- 0:00:29
      517000 -- (-605.364) [-609.973] (-607.954) (-606.352) * (-605.287) (-604.946) [-604.198] (-606.467) -- 0:00:29
      517500 -- (-606.096) (-607.146) [-605.795] (-605.640) * (-613.288) [-603.829] (-605.346) (-610.209) -- 0:00:29
      518000 -- (-606.919) (-606.087) [-607.198] (-607.031) * [-604.065] (-605.830) (-604.964) (-613.635) -- 0:00:29
      518500 -- [-604.091] (-605.041) (-604.256) (-606.589) * (-606.110) (-613.021) (-603.926) [-609.490] -- 0:00:29
      519000 -- (-607.210) [-607.674] (-604.840) (-605.723) * (-605.369) (-603.942) [-608.204] (-606.079) -- 0:00:29
      519500 -- (-604.954) (-605.223) (-605.372) [-607.253] * [-604.394] (-604.616) (-605.405) (-604.667) -- 0:00:29
      520000 -- (-610.785) (-605.350) [-605.837] (-609.694) * (-603.769) (-604.957) (-603.989) [-605.444] -- 0:00:29

      Average standard deviation of split frequencies: 0.011996

      520500 -- (-605.024) (-604.890) [-605.437] (-604.101) * (-604.208) [-607.841] (-605.796) (-606.090) -- 0:00:29
      521000 -- (-606.736) (-606.956) (-606.569) [-604.786] * (-604.581) (-609.563) (-605.160) [-604.152] -- 0:00:29
      521500 -- (-605.548) (-609.003) [-606.788] (-604.274) * (-606.358) [-605.172] (-607.018) (-605.095) -- 0:00:29
      522000 -- (-605.134) (-604.823) [-607.246] (-605.315) * (-604.548) (-604.425) (-605.719) [-606.045] -- 0:00:29
      522500 -- (-606.470) [-604.843] (-605.204) (-605.340) * [-607.375] (-604.509) (-613.056) (-604.199) -- 0:00:29
      523000 -- (-605.123) (-606.128) (-605.007) [-606.646] * (-604.167) [-604.822] (-609.325) (-611.277) -- 0:00:29
      523500 -- (-608.253) [-604.565] (-604.287) (-604.110) * (-605.794) (-609.957) (-607.658) [-606.431] -- 0:00:29
      524000 -- (-610.852) (-606.004) (-605.459) [-603.988] * (-607.041) (-610.898) (-605.564) [-606.688] -- 0:00:29
      524500 -- (-604.360) [-606.667] (-605.168) (-605.005) * [-605.776] (-606.507) (-605.734) (-605.876) -- 0:00:29
      525000 -- (-606.942) [-604.184] (-605.147) (-605.744) * (-606.564) (-606.018) (-606.497) [-605.331] -- 0:00:28

      Average standard deviation of split frequencies: 0.011427

      525500 -- (-604.118) (-604.670) [-604.504] (-604.756) * [-606.764] (-605.285) (-606.324) (-607.773) -- 0:00:28
      526000 -- [-604.110] (-606.442) (-604.094) (-603.500) * (-606.204) [-605.071] (-608.322) (-605.787) -- 0:00:28
      526500 -- (-606.994) (-608.843) (-604.032) [-605.144] * (-604.948) (-604.036) [-607.052] (-610.876) -- 0:00:28
      527000 -- (-609.272) (-608.632) [-604.815] (-604.397) * [-608.800] (-604.386) (-607.308) (-604.558) -- 0:00:28
      527500 -- (-604.391) [-604.794] (-603.844) (-606.109) * (-606.177) (-605.697) (-607.347) [-604.101] -- 0:00:28
      528000 -- (-607.256) [-605.855] (-605.200) (-605.076) * (-608.674) (-607.222) (-608.722) [-606.861] -- 0:00:28
      528500 -- (-605.256) [-606.452] (-607.018) (-605.758) * (-603.857) (-607.882) (-608.922) [-609.219] -- 0:00:28
      529000 -- [-606.272] (-606.528) (-606.475) (-604.997) * (-604.957) (-606.877) [-607.788] (-609.271) -- 0:00:28
      529500 -- [-605.621] (-608.844) (-605.853) (-605.542) * [-604.575] (-611.432) (-607.114) (-608.699) -- 0:00:28
      530000 -- (-610.521) (-608.033) (-607.914) [-606.483] * [-606.396] (-610.225) (-605.752) (-605.254) -- 0:00:28

      Average standard deviation of split frequencies: 0.011604

      530500 -- [-605.014] (-605.110) (-607.203) (-608.107) * (-606.224) (-604.462) (-608.401) [-604.702] -- 0:00:29
      531000 -- [-605.379] (-604.995) (-606.461) (-604.876) * (-606.552) (-607.322) (-606.702) [-605.729] -- 0:00:29
      531500 -- (-608.921) [-612.505] (-606.963) (-604.777) * (-606.794) (-606.499) [-604.732] (-607.597) -- 0:00:29
      532000 -- (-608.243) (-605.898) [-604.843] (-607.979) * (-607.457) [-604.896] (-606.280) (-604.994) -- 0:00:29
      532500 -- (-611.837) (-605.529) (-603.932) [-606.415] * [-605.219] (-607.325) (-607.569) (-605.618) -- 0:00:28
      533000 -- (-609.430) (-604.134) (-605.037) [-606.598] * (-605.638) (-611.775) (-605.912) [-608.866] -- 0:00:28
      533500 -- (-605.852) (-606.186) [-608.918] (-606.363) * (-607.775) (-609.415) [-607.058] (-611.184) -- 0:00:28
      534000 -- [-604.099] (-606.149) (-608.054) (-608.898) * (-606.923) [-605.227] (-606.435) (-607.985) -- 0:00:28
      534500 -- [-604.130] (-607.212) (-604.359) (-605.282) * (-604.384) [-605.676] (-606.574) (-607.082) -- 0:00:28
      535000 -- (-605.982) [-605.616] (-607.451) (-604.061) * (-605.522) (-607.872) (-606.763) [-605.057] -- 0:00:28

      Average standard deviation of split frequencies: 0.011378

      535500 -- [-603.457] (-606.504) (-606.279) (-604.184) * (-605.489) (-607.066) (-606.655) [-605.271] -- 0:00:28
      536000 -- (-606.084) (-606.877) (-604.702) [-609.339] * (-607.615) [-605.741] (-605.290) (-605.506) -- 0:00:28
      536500 -- (-606.329) (-607.768) [-604.244] (-607.123) * [-604.751] (-604.944) (-604.886) (-604.628) -- 0:00:28
      537000 -- [-604.913] (-605.959) (-604.956) (-605.321) * (-604.708) (-604.482) [-605.386] (-606.558) -- 0:00:28
      537500 -- [-604.781] (-609.781) (-610.021) (-607.346) * [-609.433] (-605.373) (-605.039) (-606.275) -- 0:00:28
      538000 -- (-603.753) (-608.330) [-607.016] (-604.467) * (-605.919) (-605.520) [-605.124] (-606.900) -- 0:00:28
      538500 -- (-608.275) (-605.353) [-606.108] (-604.662) * [-607.194] (-606.019) (-606.418) (-605.672) -- 0:00:28
      539000 -- (-607.835) [-605.077] (-607.070) (-604.032) * (-604.390) (-606.623) [-606.612] (-607.163) -- 0:00:28
      539500 -- (-607.190) (-605.132) [-606.293] (-605.690) * (-604.690) (-605.994) (-603.615) [-604.781] -- 0:00:28
      540000 -- [-606.378] (-604.221) (-605.360) (-608.020) * (-613.582) (-604.560) [-606.374] (-605.942) -- 0:00:28

      Average standard deviation of split frequencies: 0.011226

      540500 -- (-607.233) (-604.464) (-606.557) [-604.438] * (-614.867) [-606.408] (-604.302) (-605.141) -- 0:00:28
      541000 -- (-606.976) (-604.240) [-605.435] (-607.373) * (-610.313) (-606.959) [-605.308] (-608.158) -- 0:00:27
      541500 -- (-606.641) (-607.736) (-604.865) [-605.231] * (-605.635) (-604.550) [-605.442] (-606.570) -- 0:00:27
      542000 -- (-607.789) (-605.259) [-605.738] (-604.423) * (-605.656) (-603.901) (-607.719) [-606.871] -- 0:00:27
      542500 -- (-606.531) [-604.520] (-606.943) (-605.966) * (-607.703) [-610.803] (-606.102) (-605.301) -- 0:00:27
      543000 -- (-606.481) (-611.319) (-603.882) [-606.890] * (-606.185) (-605.400) (-604.008) [-607.200] -- 0:00:27
      543500 -- (-607.293) (-606.588) (-608.597) [-605.136] * (-605.843) (-609.178) (-604.932) [-607.439] -- 0:00:27
      544000 -- [-607.182] (-604.659) (-605.776) (-606.406) * (-603.996) (-606.006) [-606.212] (-607.183) -- 0:00:27
      544500 -- (-605.012) (-606.667) (-606.138) [-604.246] * (-603.625) (-605.019) [-605.082] (-609.811) -- 0:00:27
      545000 -- (-604.697) (-606.063) [-605.356] (-606.525) * [-603.967] (-606.053) (-608.547) (-604.398) -- 0:00:27

      Average standard deviation of split frequencies: 0.011386

      545500 -- (-605.452) (-605.437) (-604.351) [-609.899] * (-605.284) [-604.509] (-607.043) (-604.165) -- 0:00:27
      546000 -- (-605.216) [-604.661] (-603.964) (-605.262) * (-607.582) [-606.458] (-606.831) (-606.895) -- 0:00:28
      546500 -- (-604.362) (-604.643) [-603.894] (-604.075) * (-604.954) [-604.616] (-606.722) (-604.979) -- 0:00:28
      547000 -- (-612.396) [-604.268] (-604.469) (-604.167) * [-604.375] (-606.817) (-607.431) (-607.275) -- 0:00:28
      547500 -- [-608.024] (-604.601) (-604.381) (-609.058) * (-604.194) [-605.083] (-606.738) (-604.301) -- 0:00:28
      548000 -- (-606.459) [-604.200] (-604.978) (-606.701) * (-604.526) (-604.612) (-604.373) [-604.764] -- 0:00:28
      548500 -- (-605.057) (-604.578) (-607.507) [-605.217] * [-605.997] (-605.821) (-604.668) (-609.943) -- 0:00:27
      549000 -- (-604.490) (-604.643) [-605.531] (-605.885) * (-609.855) (-604.605) [-604.876] (-606.425) -- 0:00:27
      549500 -- (-606.344) (-607.037) [-605.363] (-605.335) * (-606.428) (-604.409) (-604.807) [-604.951] -- 0:00:27
      550000 -- (-604.363) (-604.848) (-606.740) [-604.179] * (-608.381) (-608.273) (-608.357) [-605.428] -- 0:00:27

      Average standard deviation of split frequencies: 0.011557

      550500 -- (-604.872) (-607.141) (-606.579) [-604.054] * [-609.844] (-605.750) (-605.855) (-610.912) -- 0:00:27
      551000 -- [-603.650] (-607.212) (-605.713) (-604.200) * (-607.650) (-604.866) (-606.348) [-611.378] -- 0:00:27
      551500 -- (-604.873) [-608.388] (-606.696) (-603.729) * [-606.787] (-607.356) (-607.008) (-604.497) -- 0:00:27
      552000 -- (-605.234) (-605.618) [-606.031] (-605.519) * (-603.587) (-605.493) (-604.558) [-604.584] -- 0:00:27
      552500 -- [-605.788] (-603.921) (-608.049) (-604.043) * [-604.901] (-604.949) (-606.736) (-605.521) -- 0:00:27
      553000 -- (-607.517) [-608.069] (-606.416) (-605.792) * (-604.129) [-606.105] (-604.273) (-603.656) -- 0:00:27
      553500 -- (-606.983) (-608.437) (-606.049) [-606.005] * [-603.802] (-606.272) (-610.215) (-604.374) -- 0:00:27
      554000 -- [-606.460] (-616.120) (-607.134) (-609.907) * [-605.917] (-612.313) (-607.442) (-604.432) -- 0:00:27
      554500 -- (-604.468) (-607.852) (-607.051) [-603.974] * (-605.489) [-606.489] (-606.038) (-606.872) -- 0:00:27
      555000 -- (-606.203) (-605.248) [-607.837] (-603.716) * [-606.313] (-606.480) (-607.509) (-607.004) -- 0:00:27

      Average standard deviation of split frequencies: 0.011552

      555500 -- (-607.347) [-605.751] (-604.515) (-605.089) * (-605.403) [-605.405] (-610.815) (-612.489) -- 0:00:27
      556000 -- (-609.701) (-606.070) [-605.646] (-607.324) * (-608.805) [-604.949] (-610.713) (-608.313) -- 0:00:27
      556500 -- (-606.222) (-606.527) [-604.798] (-610.984) * (-604.391) [-607.627] (-607.980) (-604.697) -- 0:00:27
      557000 -- (-605.480) (-609.478) [-603.724] (-608.556) * (-607.486) (-606.247) (-604.936) [-604.192] -- 0:00:27
      557500 -- (-607.286) (-605.966) [-605.611] (-604.809) * (-608.625) [-606.289] (-605.248) (-605.761) -- 0:00:26
      558000 -- (-605.643) (-604.796) [-606.089] (-607.977) * [-606.057] (-608.200) (-604.859) (-604.457) -- 0:00:26
      558500 -- [-605.944] (-605.386) (-607.350) (-609.582) * [-605.262] (-607.423) (-605.136) (-609.311) -- 0:00:26
      559000 -- (-606.970) [-605.354] (-605.971) (-607.403) * (-609.304) (-604.538) (-604.742) [-604.897] -- 0:00:26
      559500 -- (-605.086) (-606.107) (-605.512) [-604.553] * (-605.893) [-604.481] (-608.295) (-611.612) -- 0:00:26
      560000 -- (-604.739) (-604.532) [-604.284] (-604.971) * [-609.511] (-607.498) (-608.912) (-611.159) -- 0:00:26

      Average standard deviation of split frequencies: 0.011246

      560500 -- (-604.788) (-605.308) [-603.827] (-604.681) * [-604.180] (-606.969) (-608.239) (-611.017) -- 0:00:26
      561000 -- (-605.972) (-610.733) [-606.329] (-603.823) * (-603.529) (-606.446) (-605.699) [-604.782] -- 0:00:26
      561500 -- [-604.386] (-609.367) (-605.786) (-608.955) * [-605.222] (-606.150) (-604.356) (-608.302) -- 0:00:26
      562000 -- [-605.416] (-605.428) (-606.136) (-605.978) * (-603.611) (-607.224) (-604.254) [-605.019] -- 0:00:26
      562500 -- [-609.787] (-605.944) (-605.619) (-608.963) * [-607.219] (-604.599) (-604.825) (-605.767) -- 0:00:27
      563000 -- (-605.474) (-604.120) (-605.773) [-611.920] * (-606.371) (-603.614) (-604.764) [-604.818] -- 0:00:27
      563500 -- (-606.130) (-604.873) [-604.564] (-606.653) * (-606.165) [-606.984] (-608.053) (-605.672) -- 0:00:27
      564000 -- (-606.160) (-604.711) [-604.029] (-606.941) * (-606.958) (-607.327) (-608.419) [-605.822] -- 0:00:27
      564500 -- [-605.311] (-607.994) (-603.942) (-605.685) * (-605.250) (-605.437) (-609.081) [-605.596] -- 0:00:27
      565000 -- [-604.381] (-605.301) (-603.720) (-605.505) * (-604.364) (-611.998) (-604.724) [-607.197] -- 0:00:26

      Average standard deviation of split frequencies: 0.011504

      565500 -- [-607.436] (-606.523) (-605.200) (-608.173) * (-605.011) (-605.141) (-609.515) [-608.094] -- 0:00:26
      566000 -- (-604.228) [-605.415] (-603.781) (-606.454) * (-609.988) (-606.703) [-604.600] (-610.686) -- 0:00:26
      566500 -- [-604.046] (-604.956) (-605.736) (-605.328) * (-608.689) (-603.715) [-603.791] (-606.629) -- 0:00:26
      567000 -- (-604.012) (-609.473) (-603.830) [-607.823] * (-604.789) [-603.662] (-604.912) (-605.199) -- 0:00:26
      567500 -- [-607.152] (-605.321) (-604.249) (-604.925) * [-605.211] (-604.910) (-604.035) (-607.882) -- 0:00:26
      568000 -- [-608.644] (-604.487) (-604.658) (-605.453) * (-609.582) [-609.390] (-607.608) (-605.845) -- 0:00:26
      568500 -- (-604.862) (-603.805) [-607.272] (-609.861) * (-606.952) (-607.077) (-612.457) [-605.592] -- 0:00:26
      569000 -- (-604.747) (-605.072) (-605.847) [-604.303] * [-605.523] (-605.146) (-609.697) (-604.580) -- 0:00:26
      569500 -- (-606.438) (-604.961) (-610.477) [-604.882] * (-605.969) [-605.755] (-609.064) (-604.142) -- 0:00:26
      570000 -- (-606.482) (-606.161) (-614.570) [-607.911] * (-607.336) (-608.610) (-605.364) [-605.062] -- 0:00:26

      Average standard deviation of split frequencies: 0.011203

      570500 -- (-607.184) (-606.396) [-606.819] (-606.385) * [-604.865] (-607.697) (-605.799) (-607.025) -- 0:00:26
      571000 -- (-605.584) (-606.200) (-604.376) [-603.605] * [-606.747] (-604.725) (-606.524) (-605.494) -- 0:00:26
      571500 -- (-605.513) (-603.765) (-606.604) [-604.829] * [-606.600] (-604.812) (-605.001) (-604.596) -- 0:00:26
      572000 -- (-605.018) [-604.821] (-604.320) (-604.626) * [-607.614] (-607.015) (-605.928) (-605.707) -- 0:00:26
      572500 -- (-606.276) (-607.171) [-605.004] (-605.801) * (-604.897) [-606.526] (-605.861) (-606.777) -- 0:00:26
      573000 -- (-605.903) (-604.724) (-605.298) [-604.854] * [-606.217] (-605.888) (-605.904) (-607.089) -- 0:00:26
      573500 -- (-605.532) [-605.240] (-605.963) (-603.932) * (-611.039) (-607.354) (-607.081) [-604.810] -- 0:00:26
      574000 -- (-605.647) [-604.445] (-605.997) (-606.163) * (-611.242) (-606.641) (-606.430) [-604.003] -- 0:00:25
      574500 -- (-605.872) [-603.890] (-606.204) (-607.960) * (-607.413) (-604.556) (-606.049) [-604.125] -- 0:00:25
      575000 -- [-604.302] (-606.621) (-607.174) (-605.568) * (-608.803) (-604.286) (-606.566) [-607.424] -- 0:00:25

      Average standard deviation of split frequencies: 0.011151

      575500 -- (-605.305) (-603.983) (-605.132) [-605.128] * (-610.307) (-610.610) (-606.331) [-605.454] -- 0:00:25
      576000 -- (-605.368) (-603.917) (-607.354) [-603.984] * [-611.383] (-605.637) (-609.773) (-607.384) -- 0:00:25
      576500 -- (-606.080) (-606.398) [-606.499] (-604.589) * (-608.647) (-606.573) (-608.369) [-605.055] -- 0:00:25
      577000 -- (-604.558) (-606.196) [-607.059] (-605.100) * (-609.306) (-604.182) [-607.978] (-607.080) -- 0:00:25
      577500 -- (-606.606) (-606.262) (-607.224) [-604.263] * [-607.974] (-604.606) (-604.494) (-605.268) -- 0:00:25
      578000 -- (-606.872) [-604.848] (-605.896) (-605.044) * (-604.681) (-604.550) (-609.187) [-604.606] -- 0:00:25
      578500 -- (-605.312) (-611.136) [-605.200] (-605.803) * [-607.993] (-604.558) (-608.132) (-604.338) -- 0:00:25
      579000 -- [-605.060] (-608.087) (-606.289) (-605.882) * (-607.829) [-604.526] (-606.504) (-611.008) -- 0:00:26
      579500 -- (-605.381) (-607.861) [-606.301] (-606.783) * (-605.656) (-605.049) [-606.896] (-610.970) -- 0:00:26
      580000 -- [-604.875] (-608.855) (-608.767) (-604.677) * (-606.316) [-605.356] (-607.999) (-608.250) -- 0:00:26

      Average standard deviation of split frequencies: 0.011315

      580500 -- (-607.775) (-605.357) (-608.219) [-605.108] * (-607.467) [-604.925] (-604.679) (-609.508) -- 0:00:26
      581000 -- (-606.679) [-605.442] (-607.267) (-605.126) * (-605.611) (-605.306) [-608.832] (-604.261) -- 0:00:25
      581500 -- (-605.511) [-609.591] (-605.115) (-605.009) * (-606.613) (-606.464) [-606.053] (-607.580) -- 0:00:25
      582000 -- (-607.180) (-610.699) [-605.688] (-606.537) * (-604.420) [-604.698] (-608.478) (-607.315) -- 0:00:25
      582500 -- (-607.771) (-608.862) [-606.475] (-606.988) * (-605.181) [-606.079] (-608.864) (-605.299) -- 0:00:25
      583000 -- (-606.559) (-604.804) (-607.457) [-606.259] * (-607.730) (-610.825) (-606.353) [-607.065] -- 0:00:25
      583500 -- (-604.500) (-604.494) [-605.759] (-604.370) * (-608.502) (-604.231) (-606.189) [-607.036] -- 0:00:25
      584000 -- [-604.866] (-603.934) (-608.410) (-604.721) * [-606.728] (-604.289) (-607.812) (-605.545) -- 0:00:25
      584500 -- (-609.594) [-604.767] (-605.105) (-605.149) * (-604.259) (-605.299) (-605.178) [-605.570] -- 0:00:25
      585000 -- (-605.172) (-604.831) (-604.738) [-607.443] * (-604.259) [-604.380] (-605.867) (-604.955) -- 0:00:25

      Average standard deviation of split frequencies: 0.011664

      585500 -- [-608.028] (-606.066) (-610.104) (-607.841) * [-604.447] (-604.677) (-606.680) (-607.346) -- 0:00:25
      586000 -- [-606.433] (-604.260) (-608.507) (-606.197) * (-605.828) (-605.426) [-607.420] (-605.919) -- 0:00:25
      586500 -- [-605.694] (-608.974) (-606.051) (-604.819) * (-604.400) [-607.729] (-609.441) (-608.214) -- 0:00:25
      587000 -- (-604.745) (-605.144) [-604.717] (-607.483) * (-605.587) (-607.644) [-606.478] (-609.031) -- 0:00:25
      587500 -- (-604.715) [-605.814] (-605.143) (-607.483) * (-606.865) [-607.470] (-612.759) (-608.637) -- 0:00:25
      588000 -- (-604.809) (-605.395) (-604.761) [-604.809] * (-605.952) (-607.485) [-606.831] (-607.019) -- 0:00:25
      588500 -- [-606.427] (-604.534) (-605.474) (-608.485) * (-604.344) (-609.684) [-605.122] (-609.489) -- 0:00:25
      589000 -- (-614.492) (-607.837) [-604.707] (-606.612) * (-605.754) [-604.601] (-605.404) (-608.795) -- 0:00:25
      589500 -- (-606.385) (-605.472) (-605.449) [-604.077] * (-607.983) [-607.810] (-604.195) (-607.182) -- 0:00:25
      590000 -- (-605.052) (-607.782) (-605.084) [-605.874] * (-605.636) [-605.602] (-604.210) (-606.464) -- 0:00:25

      Average standard deviation of split frequencies: 0.010475

      590500 -- (-604.180) (-607.239) [-607.652] (-605.669) * [-609.258] (-604.949) (-604.211) (-607.171) -- 0:00:24
      591000 -- (-605.937) [-606.138] (-607.342) (-606.642) * (-609.505) (-604.300) (-604.532) [-607.721] -- 0:00:24
      591500 -- [-603.894] (-606.277) (-606.806) (-608.751) * (-605.073) (-604.925) [-603.736] (-609.806) -- 0:00:24
      592000 -- (-606.010) [-604.284] (-609.076) (-604.328) * [-604.149] (-606.769) (-604.844) (-613.963) -- 0:00:24
      592500 -- (-605.903) [-605.291] (-603.974) (-606.458) * (-610.703) (-606.047) [-605.581] (-605.642) -- 0:00:24
      593000 -- (-606.538) [-611.536] (-604.809) (-604.791) * (-607.017) [-605.889] (-607.720) (-604.673) -- 0:00:24
      593500 -- (-606.145) (-606.466) (-608.172) [-607.203] * (-605.282) (-606.633) (-609.518) [-604.833] -- 0:00:24
      594000 -- (-609.015) (-609.359) [-608.974] (-607.077) * (-606.298) (-604.803) [-605.442] (-605.135) -- 0:00:24
      594500 -- (-604.589) [-610.973] (-608.202) (-605.206) * (-607.726) (-606.073) (-605.616) [-604.552] -- 0:00:24
      595000 -- (-606.435) (-607.554) [-608.301] (-605.882) * [-605.356] (-604.180) (-604.040) (-605.571) -- 0:00:24

      Average standard deviation of split frequencies: 0.010332

      595500 -- [-605.489] (-605.488) (-604.734) (-607.672) * [-605.827] (-607.934) (-604.429) (-605.666) -- 0:00:25
      596000 -- (-604.509) (-604.539) (-604.832) [-605.935] * (-605.720) (-604.764) (-607.855) [-606.054] -- 0:00:25
      596500 -- [-604.384] (-604.888) (-604.936) (-604.726) * [-605.930] (-604.173) (-605.590) (-605.691) -- 0:00:25
      597000 -- (-605.701) (-604.652) [-606.814] (-604.059) * (-604.835) [-608.361] (-608.541) (-611.588) -- 0:00:24
      597500 -- [-604.123] (-604.618) (-607.161) (-604.552) * (-604.519) (-607.694) [-606.965] (-611.819) -- 0:00:24
      598000 -- (-603.764) [-605.308] (-607.032) (-607.084) * [-604.292] (-605.300) (-606.362) (-608.516) -- 0:00:24
      598500 -- [-604.969] (-608.412) (-606.418) (-604.088) * (-607.066) (-607.078) (-605.451) [-607.162] -- 0:00:24
      599000 -- [-604.088] (-606.047) (-610.831) (-608.294) * [-606.119] (-605.524) (-605.182) (-606.266) -- 0:00:24
      599500 -- (-607.129) (-603.513) [-606.583] (-608.195) * (-605.597) (-604.856) [-605.148] (-604.425) -- 0:00:24
      600000 -- (-606.390) (-606.592) (-604.725) [-606.679] * (-607.810) (-609.440) [-606.876] (-608.112) -- 0:00:24

      Average standard deviation of split frequencies: 0.009510

      600500 -- (-605.336) (-605.473) [-605.565] (-607.541) * (-605.611) (-606.525) (-603.899) [-604.903] -- 0:00:24
      601000 -- (-604.659) [-603.956] (-607.163) (-604.267) * (-603.947) [-604.541] (-609.899) (-606.446) -- 0:00:24
      601500 -- (-605.397) (-604.796) [-606.255] (-604.210) * [-608.244] (-608.690) (-607.068) (-606.372) -- 0:00:24
      602000 -- (-604.475) (-606.487) (-607.372) [-603.624] * (-604.372) (-605.574) [-603.801] (-606.164) -- 0:00:24
      602500 -- (-607.157) (-609.587) [-605.332] (-603.493) * [-605.699] (-604.271) (-609.423) (-605.289) -- 0:00:24
      603000 -- [-604.436] (-606.332) (-606.554) (-606.873) * [-605.650] (-604.171) (-603.619) (-604.969) -- 0:00:24
      603500 -- (-608.329) (-609.486) (-604.357) [-604.994] * (-608.917) (-604.545) [-605.423] (-608.072) -- 0:00:24
      604000 -- (-606.747) (-608.493) [-604.287] (-605.146) * [-610.560] (-605.754) (-605.230) (-605.371) -- 0:00:24
      604500 -- (-608.185) (-610.478) (-604.222) [-605.197] * [-605.359] (-604.417) (-608.377) (-603.816) -- 0:00:24
      605000 -- [-606.026] (-607.246) (-605.712) (-606.462) * (-606.953) [-606.077] (-604.884) (-605.365) -- 0:00:24

      Average standard deviation of split frequencies: 0.009243

      605500 -- (-606.904) (-604.605) (-604.347) [-607.630] * [-607.125] (-605.748) (-607.846) (-605.777) -- 0:00:24
      606000 -- [-604.707] (-603.967) (-608.498) (-604.989) * (-612.488) [-604.050] (-606.533) (-605.565) -- 0:00:24
      606500 -- (-604.664) (-606.466) [-605.017] (-605.155) * (-606.097) (-608.701) [-605.104] (-606.316) -- 0:00:24
      607000 -- (-605.399) [-604.066] (-608.345) (-605.208) * (-603.842) (-606.724) [-606.096] (-608.359) -- 0:00:23
      607500 -- (-604.457) (-604.146) [-606.875] (-606.350) * (-606.192) (-605.123) [-605.583] (-605.239) -- 0:00:23
      608000 -- (-604.209) [-605.088] (-605.234) (-608.998) * (-604.853) (-604.868) [-604.136] (-604.357) -- 0:00:23
      608500 -- [-605.468] (-605.272) (-606.906) (-605.485) * (-605.645) (-604.216) [-607.535] (-605.761) -- 0:00:23
      609000 -- [-605.812] (-606.983) (-607.103) (-605.750) * (-605.043) (-604.848) (-606.509) [-604.219] -- 0:00:23
      609500 -- [-607.228] (-605.336) (-604.184) (-614.092) * (-604.289) [-604.685] (-608.977) (-607.410) -- 0:00:23
      610000 -- (-607.567) [-604.516] (-607.557) (-605.691) * (-603.789) (-604.984) [-605.365] (-603.915) -- 0:00:23

      Average standard deviation of split frequencies: 0.009173

      610500 -- (-608.714) (-604.867) (-604.341) [-608.362] * [-603.627] (-607.767) (-604.976) (-606.015) -- 0:00:23
      611000 -- [-607.326] (-611.465) (-606.157) (-608.143) * [-607.082] (-605.323) (-605.195) (-603.769) -- 0:00:23
      611500 -- (-607.087) (-606.554) (-607.031) [-606.002] * (-608.314) (-605.545) [-604.226] (-605.325) -- 0:00:23
      612000 -- (-603.625) (-607.305) [-605.328] (-607.152) * [-605.297] (-607.939) (-604.487) (-606.152) -- 0:00:23
      612500 -- (-604.408) [-604.343] (-605.799) (-610.341) * (-605.147) (-605.630) [-604.871] (-604.633) -- 0:00:24
      613000 -- (-604.064) (-608.772) [-603.827] (-609.240) * (-606.424) (-612.281) (-606.321) [-604.032] -- 0:00:23
      613500 -- [-606.648] (-615.997) (-604.279) (-605.447) * (-606.712) (-610.830) (-606.210) [-604.816] -- 0:00:23
      614000 -- (-608.188) (-604.994) [-603.965] (-606.715) * (-608.743) (-606.674) [-605.001] (-605.860) -- 0:00:23
      614500 -- (-605.703) (-604.497) (-604.009) [-605.334] * (-604.072) (-607.305) [-606.036] (-606.638) -- 0:00:23
      615000 -- (-604.889) (-605.126) [-611.060] (-609.321) * [-604.418] (-606.086) (-604.727) (-606.123) -- 0:00:23

      Average standard deviation of split frequencies: 0.009279

      615500 -- (-604.882) (-605.977) [-605.103] (-606.031) * (-604.471) (-605.900) (-605.587) [-605.262] -- 0:00:23
      616000 -- (-606.844) [-606.131] (-607.175) (-605.281) * (-604.312) (-606.737) (-607.089) [-605.944] -- 0:00:23
      616500 -- (-608.415) [-605.947] (-606.345) (-605.927) * (-603.760) (-607.354) (-606.273) [-607.532] -- 0:00:23
      617000 -- (-607.272) (-605.117) [-604.266] (-609.141) * (-606.591) (-605.695) [-605.780] (-605.922) -- 0:00:23
      617500 -- (-606.678) (-607.187) (-611.362) [-604.162] * (-605.255) [-604.783] (-606.507) (-607.995) -- 0:00:23
      618000 -- (-609.833) (-608.402) (-605.405) [-605.214] * (-607.244) (-606.139) [-604.759] (-607.561) -- 0:00:23
      618500 -- (-611.548) (-605.325) (-608.960) [-605.278] * (-608.742) (-607.573) (-605.273) [-607.308] -- 0:00:23
      619000 -- (-607.147) (-606.086) [-604.619] (-604.170) * (-611.499) [-604.558] (-606.571) (-603.700) -- 0:00:23
      619500 -- (-607.713) (-606.919) [-604.550] (-612.478) * (-607.588) (-606.647) [-603.999] (-604.962) -- 0:00:23
      620000 -- [-604.505] (-604.606) (-604.254) (-604.911) * (-605.162) [-605.421] (-604.796) (-607.779) -- 0:00:23

      Average standard deviation of split frequencies: 0.009067

      620500 -- (-608.273) (-608.188) [-604.229] (-610.395) * [-607.370] (-606.492) (-605.728) (-606.961) -- 0:00:23
      621000 -- (-604.594) (-607.795) [-608.854] (-605.602) * (-605.901) [-606.382] (-607.271) (-609.611) -- 0:00:23
      621500 -- [-609.288] (-605.585) (-604.866) (-609.818) * (-604.752) [-604.934] (-608.620) (-605.377) -- 0:00:23
      622000 -- (-608.520) (-604.807) [-604.850] (-604.495) * (-605.404) [-608.447] (-609.979) (-604.882) -- 0:00:23
      622500 -- (-611.025) (-604.245) (-608.724) [-603.546] * (-608.688) (-606.529) [-609.598] (-604.333) -- 0:00:23
      623000 -- (-608.557) (-605.043) [-605.458] (-604.794) * (-609.947) [-606.181] (-606.108) (-603.577) -- 0:00:22
      623500 -- [-605.106] (-603.771) (-610.183) (-604.824) * [-612.002] (-605.229) (-607.240) (-605.021) -- 0:00:22
      624000 -- (-605.345) (-605.917) (-607.563) [-607.818] * (-609.020) [-604.723] (-606.474) (-605.359) -- 0:00:22
      624500 -- (-603.867) [-608.968] (-607.884) (-604.090) * (-611.798) (-604.431) [-605.528] (-605.304) -- 0:00:22
      625000 -- (-605.173) [-605.911] (-609.495) (-609.429) * (-607.250) [-606.047] (-605.869) (-605.063) -- 0:00:22

      Average standard deviation of split frequencies: 0.009460

      625500 -- [-605.703] (-603.862) (-609.059) (-608.376) * (-605.387) (-611.816) [-604.819] (-603.726) -- 0:00:22
      626000 -- (-609.609) (-604.076) [-604.550] (-607.012) * (-604.108) (-607.043) [-606.218] (-606.062) -- 0:00:22
      626500 -- (-605.093) (-605.567) [-607.004] (-607.826) * (-606.928) (-605.627) (-605.884) [-605.928] -- 0:00:22
      627000 -- [-605.369] (-610.189) (-605.307) (-606.218) * (-605.811) (-610.538) [-605.502] (-605.145) -- 0:00:22
      627500 -- (-605.418) (-604.852) [-608.126] (-609.241) * (-606.766) [-605.931] (-605.260) (-606.597) -- 0:00:22
      628000 -- [-604.524] (-604.710) (-610.639) (-605.539) * (-612.191) (-606.381) (-607.446) [-605.905] -- 0:00:22
      628500 -- (-604.640) (-605.007) (-606.175) [-605.230] * (-609.096) (-605.360) [-608.149] (-604.283) -- 0:00:22
      629000 -- [-606.765] (-604.740) (-605.681) (-604.053) * (-605.260) [-605.193] (-605.952) (-607.554) -- 0:00:23
      629500 -- (-606.185) (-605.881) [-604.287] (-607.559) * [-607.967] (-605.477) (-606.043) (-605.397) -- 0:00:22
      630000 -- (-603.985) (-604.995) [-604.290] (-609.596) * [-606.531] (-605.752) (-606.541) (-604.796) -- 0:00:22

      Average standard deviation of split frequencies: 0.009670

      630500 -- (-607.303) (-605.337) (-607.245) [-607.153] * (-605.202) (-604.352) [-605.822] (-604.807) -- 0:00:22
      631000 -- [-605.982] (-609.896) (-605.373) (-607.329) * [-607.280] (-605.236) (-608.899) (-607.652) -- 0:00:22
      631500 -- (-604.385) (-607.043) [-604.982] (-604.413) * (-605.256) (-606.411) (-603.826) [-605.490] -- 0:00:22
      632000 -- (-605.376) [-607.323] (-608.583) (-604.596) * [-605.366] (-604.958) (-604.090) (-604.736) -- 0:00:22
      632500 -- [-606.413] (-604.280) (-605.609) (-603.996) * (-606.795) (-606.612) (-604.168) [-606.006] -- 0:00:22
      633000 -- (-605.747) (-609.241) (-605.416) [-606.346] * (-604.851) [-607.237] (-607.954) (-605.282) -- 0:00:22
      633500 -- (-603.638) (-607.185) [-608.028] (-606.209) * [-604.091] (-608.893) (-604.626) (-605.037) -- 0:00:22
      634000 -- (-606.791) (-607.866) [-607.797] (-610.486) * (-604.077) (-607.871) (-605.722) [-606.579] -- 0:00:22
      634500 -- (-603.896) (-605.676) [-607.436] (-606.286) * (-604.095) (-609.144) [-604.369] (-605.174) -- 0:00:22
      635000 -- [-603.885] (-607.030) (-605.185) (-604.168) * (-605.021) (-614.328) (-605.613) [-604.245] -- 0:00:22

      Average standard deviation of split frequencies: 0.009589

      635500 -- (-606.257) (-604.131) [-605.829] (-604.173) * (-606.409) [-605.679] (-606.627) (-607.149) -- 0:00:22
      636000 -- [-606.204] (-605.154) (-606.163) (-605.174) * (-607.423) (-604.566) (-604.944) [-607.625] -- 0:00:22
      636500 -- (-605.207) [-605.917] (-604.362) (-605.346) * (-605.066) (-605.455) (-603.799) [-604.097] -- 0:00:22
      637000 -- (-606.693) [-605.174] (-604.321) (-605.460) * [-605.235] (-608.061) (-604.008) (-604.321) -- 0:00:22
      637500 -- (-605.163) [-607.460] (-606.455) (-607.313) * [-606.141] (-604.537) (-607.798) (-604.835) -- 0:00:22
      638000 -- [-605.978] (-605.356) (-606.880) (-607.556) * (-604.325) (-607.191) [-604.203] (-607.716) -- 0:00:22
      638500 -- (-605.362) [-604.981] (-605.159) (-608.419) * (-607.957) [-605.119] (-605.283) (-606.488) -- 0:00:22
      639000 -- (-604.750) (-604.323) [-606.205] (-606.554) * (-605.357) [-606.340] (-605.759) (-606.356) -- 0:00:22
      639500 -- [-604.927] (-611.953) (-611.517) (-608.045) * [-607.339] (-606.131) (-604.260) (-606.649) -- 0:00:21
      640000 -- (-608.064) (-608.435) (-606.310) [-606.130] * [-607.125] (-605.612) (-605.859) (-605.429) -- 0:00:21

      Average standard deviation of split frequencies: 0.009565

      640500 -- (-605.526) [-606.802] (-611.751) (-605.157) * [-609.644] (-604.110) (-605.054) (-609.383) -- 0:00:21
      641000 -- (-605.525) [-604.816] (-612.756) (-605.322) * (-607.396) (-604.371) [-605.425] (-606.726) -- 0:00:21
      641500 -- [-605.252] (-606.550) (-605.090) (-607.843) * (-607.307) (-605.212) [-604.230] (-609.144) -- 0:00:21
      642000 -- (-605.196) [-607.099] (-605.591) (-605.346) * (-609.891) (-604.663) [-606.645] (-607.898) -- 0:00:21
      642500 -- (-604.905) (-604.423) [-607.513] (-606.597) * (-609.341) (-605.452) [-604.863] (-604.924) -- 0:00:21
      643000 -- (-604.492) (-606.198) [-609.428] (-606.307) * [-604.740] (-603.912) (-605.495) (-606.982) -- 0:00:21
      643500 -- (-606.455) (-605.568) [-606.123] (-605.388) * (-606.591) (-605.048) [-609.903] (-606.481) -- 0:00:21
      644000 -- (-606.385) (-605.516) [-610.640] (-605.858) * (-606.666) (-605.294) (-606.826) [-605.557] -- 0:00:21
      644500 -- (-608.659) (-605.018) [-607.880] (-605.387) * [-605.099] (-606.393) (-603.613) (-604.967) -- 0:00:21
      645000 -- (-607.300) (-606.271) [-606.463] (-606.297) * (-606.762) (-605.051) [-604.528] (-605.159) -- 0:00:21

      Average standard deviation of split frequencies: 0.009395

      645500 -- (-605.814) [-603.991] (-606.038) (-609.116) * [-607.800] (-606.870) (-605.145) (-606.897) -- 0:00:21
      646000 -- (-605.322) [-606.135] (-606.693) (-608.345) * [-605.437] (-606.096) (-606.900) (-605.808) -- 0:00:21
      646500 -- (-607.075) [-605.671] (-605.754) (-605.290) * (-604.467) (-611.977) (-605.227) [-604.762] -- 0:00:21
      647000 -- (-603.780) (-606.233) [-605.685] (-604.614) * (-606.258) [-607.346] (-603.827) (-605.295) -- 0:00:21
      647500 -- (-605.505) (-603.718) (-607.035) [-605.743] * (-608.959) (-605.484) (-604.402) [-606.956] -- 0:00:21
      648000 -- [-606.309] (-605.122) (-603.880) (-607.142) * (-609.558) (-606.177) [-605.344] (-608.421) -- 0:00:21
      648500 -- (-603.820) (-605.058) (-606.583) [-603.847] * [-605.114] (-607.334) (-605.266) (-606.865) -- 0:00:21
      649000 -- (-606.195) (-606.217) (-607.228) [-605.204] * (-606.028) (-610.476) (-604.339) [-607.726] -- 0:00:21
      649500 -- [-604.076] (-605.817) (-604.797) (-606.412) * (-605.059) [-604.265] (-603.816) (-604.727) -- 0:00:21
      650000 -- [-606.947] (-604.850) (-606.199) (-608.733) * (-604.562) (-605.057) [-605.117] (-605.495) -- 0:00:21

      Average standard deviation of split frequencies: 0.009101

      650500 -- (-604.490) (-607.146) (-606.482) [-604.431] * (-604.716) (-608.789) [-605.410] (-605.468) -- 0:00:21
      651000 -- [-605.853] (-604.864) (-605.196) (-611.017) * (-605.030) [-608.287] (-605.305) (-609.877) -- 0:00:21
      651500 -- [-607.117] (-606.909) (-605.385) (-604.541) * (-610.817) (-604.166) (-605.399) [-608.954] -- 0:00:21
      652000 -- (-609.641) [-605.317] (-605.295) (-604.494) * [-606.848] (-605.422) (-605.653) (-607.161) -- 0:00:21
      652500 -- (-610.249) [-606.392] (-604.701) (-605.208) * (-606.878) (-609.984) (-606.147) [-608.231] -- 0:00:21
      653000 -- (-607.772) [-609.595] (-606.423) (-604.623) * (-606.155) [-605.823] (-606.844) (-604.272) -- 0:00:21
      653500 -- (-605.769) [-607.461] (-606.991) (-604.873) * (-604.792) (-605.803) (-604.713) [-605.590] -- 0:00:21
      654000 -- (-606.180) (-608.543) [-607.099] (-604.518) * (-604.157) (-604.179) (-605.859) [-607.862] -- 0:00:21
      654500 -- (-606.898) (-604.920) (-607.360) [-608.007] * (-604.080) [-604.450] (-604.693) (-606.481) -- 0:00:21
      655000 -- (-606.997) (-608.902) [-606.919] (-604.706) * (-604.444) (-606.432) [-606.739] (-606.988) -- 0:00:21

      Average standard deviation of split frequencies: 0.009387

      655500 -- (-605.197) [-610.462] (-611.077) (-605.345) * [-604.659] (-605.334) (-603.851) (-605.080) -- 0:00:21
      656000 -- (-607.612) (-609.910) (-605.971) [-606.232] * (-606.339) (-612.589) (-604.902) [-604.216] -- 0:00:20
      656500 -- (-607.499) [-609.228] (-608.878) (-604.037) * [-609.916] (-608.075) (-607.482) (-605.311) -- 0:00:20
      657000 -- (-609.287) (-605.983) (-606.931) [-605.091] * [-606.435] (-605.899) (-604.287) (-605.284) -- 0:00:20
      657500 -- [-605.514] (-607.437) (-604.256) (-606.905) * [-605.459] (-606.133) (-604.383) (-606.747) -- 0:00:20
      658000 -- (-608.209) (-608.093) [-605.070] (-605.021) * (-607.494) (-609.466) (-605.252) [-608.820] -- 0:00:20
      658500 -- (-607.340) [-607.267] (-606.559) (-604.999) * (-608.996) (-609.204) [-604.956] (-605.657) -- 0:00:20
      659000 -- (-607.899) [-605.243] (-607.288) (-605.562) * (-606.313) [-609.663] (-604.129) (-604.341) -- 0:00:20
      659500 -- (-607.036) [-604.530] (-607.073) (-606.904) * (-605.731) (-605.821) (-604.354) [-604.202] -- 0:00:20
      660000 -- [-606.192] (-604.535) (-605.027) (-603.630) * (-608.759) (-605.594) [-605.686] (-605.347) -- 0:00:20

      Average standard deviation of split frequencies: 0.009454

      660500 -- (-605.001) [-605.105] (-610.888) (-604.185) * (-604.791) (-605.409) [-605.343] (-604.370) -- 0:00:20
      661000 -- (-607.295) (-604.288) [-607.741] (-604.868) * (-608.579) (-604.519) [-607.619] (-611.238) -- 0:00:20
      661500 -- (-604.246) (-603.817) [-607.186] (-606.174) * (-606.325) [-604.642] (-604.848) (-605.151) -- 0:00:20
      662000 -- (-603.772) (-604.922) (-607.669) [-603.831] * [-609.523] (-608.308) (-605.616) (-604.413) -- 0:00:20
      662500 -- (-604.267) (-607.028) [-606.264] (-606.313) * (-608.862) (-604.601) [-604.306] (-605.150) -- 0:00:20
      663000 -- (-604.802) [-606.875] (-609.777) (-605.072) * (-606.089) (-604.040) (-605.192) [-608.434] -- 0:00:20
      663500 -- (-606.064) (-607.475) [-604.562] (-607.161) * (-604.966) [-605.604] (-607.873) (-610.427) -- 0:00:20
      664000 -- (-610.840) [-607.577] (-605.589) (-606.895) * (-606.114) (-605.825) [-605.219] (-609.834) -- 0:00:20
      664500 -- (-607.231) (-605.157) (-605.949) [-605.467] * (-605.335) [-606.059] (-607.360) (-608.703) -- 0:00:20
      665000 -- [-606.524] (-604.330) (-612.534) (-608.818) * [-606.836] (-604.822) (-607.346) (-607.934) -- 0:00:20

      Average standard deviation of split frequencies: 0.009600

      665500 -- (-608.108) [-605.979] (-614.132) (-603.990) * (-604.370) (-609.442) (-610.116) [-606.116] -- 0:00:20
      666000 -- (-605.598) (-604.939) [-609.458] (-604.448) * (-606.706) (-607.519) (-606.785) [-604.379] -- 0:00:20
      666500 -- (-606.592) (-605.471) [-609.414] (-605.055) * (-613.421) (-607.622) (-606.936) [-605.925] -- 0:00:20
      667000 -- (-603.616) (-607.110) (-604.427) [-606.002] * (-608.873) (-606.607) [-605.875] (-604.759) -- 0:00:20
      667500 -- (-606.063) (-605.863) (-604.968) [-604.423] * (-603.563) (-606.223) (-604.285) [-603.934] -- 0:00:20
      668000 -- (-606.309) (-605.452) [-604.482] (-606.933) * [-604.669] (-605.162) (-604.644) (-607.809) -- 0:00:20
      668500 -- [-605.143] (-605.571) (-615.984) (-607.002) * [-604.927] (-604.720) (-607.548) (-604.599) -- 0:00:20
      669000 -- [-611.027] (-604.197) (-605.554) (-604.230) * (-609.223) (-607.870) (-605.383) [-604.949] -- 0:00:20
      669500 -- (-606.310) (-604.565) (-603.997) [-605.589] * (-604.986) [-610.868] (-604.739) (-607.510) -- 0:00:20
      670000 -- (-605.507) (-605.520) (-609.200) [-605.127] * (-606.446) [-604.424] (-607.231) (-607.708) -- 0:00:20

      Average standard deviation of split frequencies: 0.009138

      670500 -- (-607.579) (-606.892) [-604.842] (-605.287) * [-604.453] (-605.032) (-605.905) (-611.262) -- 0:00:20
      671000 -- (-609.869) (-604.408) (-604.869) [-608.108] * (-604.698) (-604.952) (-604.647) [-604.255] -- 0:00:20
      671500 -- (-610.405) (-608.221) (-604.370) [-606.984] * [-604.660] (-603.944) (-605.666) (-605.173) -- 0:00:20
      672000 -- (-605.921) [-605.858] (-604.300) (-611.514) * (-605.488) [-604.577] (-606.569) (-604.063) -- 0:00:20
      672500 -- [-606.529] (-604.458) (-606.121) (-608.427) * (-606.245) (-606.157) (-606.022) [-606.214] -- 0:00:19
      673000 -- (-606.990) (-605.667) [-605.166] (-604.156) * (-606.321) (-604.354) (-608.893) [-605.248] -- 0:00:19
      673500 -- (-604.383) [-608.637] (-606.054) (-603.807) * [-609.051] (-603.963) (-606.980) (-604.781) -- 0:00:19
      674000 -- (-605.247) [-606.473] (-609.705) (-604.754) * (-617.245) [-604.469] (-606.570) (-609.953) -- 0:00:19
      674500 -- (-611.552) [-604.561] (-609.476) (-604.392) * (-608.809) [-604.370] (-604.482) (-608.678) -- 0:00:19
      675000 -- (-604.369) (-606.094) [-605.472] (-605.144) * [-605.717] (-605.462) (-605.329) (-609.394) -- 0:00:19

      Average standard deviation of split frequencies: 0.009437

      675500 -- (-604.298) [-606.762] (-606.372) (-604.067) * (-608.812) [-606.116] (-606.076) (-604.558) -- 0:00:19
      676000 -- [-604.493] (-607.420) (-605.274) (-606.125) * (-609.738) (-609.446) [-604.829] (-605.795) -- 0:00:19
      676500 -- [-605.662] (-608.673) (-606.984) (-608.993) * (-605.264) (-606.363) (-605.046) [-606.429] -- 0:00:19
      677000 -- [-604.562] (-607.171) (-608.745) (-609.219) * (-608.166) (-604.968) (-606.586) [-605.868] -- 0:00:19
      677500 -- (-608.469) (-607.007) (-607.105) [-604.291] * (-604.762) [-603.853] (-610.203) (-611.237) -- 0:00:19
      678000 -- (-606.434) (-605.077) [-606.192] (-605.779) * (-605.256) [-604.951] (-606.837) (-611.967) -- 0:00:19
      678500 -- (-605.225) [-607.458] (-607.827) (-605.764) * (-606.352) [-604.601] (-605.328) (-605.962) -- 0:00:19
      679000 -- [-605.309] (-605.095) (-607.431) (-605.366) * (-607.047) [-607.675] (-605.019) (-605.259) -- 0:00:19
      679500 -- (-608.396) [-612.441] (-606.560) (-610.784) * (-608.984) (-606.059) [-610.175] (-604.443) -- 0:00:19
      680000 -- (-607.416) (-605.785) [-609.090] (-606.728) * (-606.217) (-609.137) [-608.557] (-606.742) -- 0:00:19

      Average standard deviation of split frequencies: 0.009049

      680500 -- (-609.818) [-604.399] (-604.306) (-605.707) * (-606.439) (-605.493) [-606.858] (-612.090) -- 0:00:19
      681000 -- (-606.848) (-607.149) (-609.920) [-606.540] * (-605.813) [-604.852] (-605.770) (-610.579) -- 0:00:19
      681500 -- [-607.419] (-605.111) (-611.758) (-605.755) * [-605.585] (-604.617) (-608.700) (-604.842) -- 0:00:19
      682000 -- (-604.295) [-604.652] (-608.781) (-603.921) * (-606.616) (-604.173) [-604.445] (-603.600) -- 0:00:19
      682500 -- [-604.600] (-606.827) (-608.504) (-604.187) * (-604.558) [-604.163] (-604.184) (-604.370) -- 0:00:19
      683000 -- (-604.276) [-604.739] (-605.300) (-609.058) * (-605.695) (-604.517) (-606.254) [-606.498] -- 0:00:19
      683500 -- (-603.935) (-605.889) [-606.874] (-604.353) * [-604.154] (-609.795) (-609.977) (-610.114) -- 0:00:19
      684000 -- [-605.125] (-608.443) (-604.453) (-606.198) * (-604.810) [-608.492] (-607.734) (-606.820) -- 0:00:19
      684500 -- (-606.079) (-608.907) (-604.616) [-605.845] * [-605.147] (-603.522) (-605.590) (-607.771) -- 0:00:19
      685000 -- (-607.093) (-605.159) (-603.807) [-607.246] * (-605.484) [-606.159] (-606.266) (-606.874) -- 0:00:19

      Average standard deviation of split frequencies: 0.009071

      685500 -- [-605.320] (-610.112) (-604.012) (-609.977) * [-605.865] (-604.210) (-604.604) (-603.905) -- 0:00:19
      686000 -- (-604.747) (-605.172) (-603.884) [-607.158] * (-605.746) [-604.161] (-606.546) (-607.102) -- 0:00:19
      686500 -- (-604.587) (-605.696) (-606.920) [-605.201] * (-609.880) [-605.991] (-604.207) (-606.467) -- 0:00:19
      687000 -- (-607.613) (-606.227) [-609.051] (-604.477) * [-605.145] (-604.191) (-604.772) (-608.329) -- 0:00:19
      687500 -- (-608.621) (-608.108) [-607.259] (-605.330) * (-605.782) [-605.212] (-606.859) (-605.597) -- 0:00:19
      688000 -- (-610.496) (-606.802) [-604.953] (-605.050) * [-605.683] (-604.812) (-609.176) (-604.652) -- 0:00:19
      688500 -- (-604.911) [-606.416] (-605.990) (-608.160) * [-605.020] (-607.367) (-605.589) (-608.951) -- 0:00:19
      689000 -- (-604.510) [-604.269] (-604.561) (-605.029) * (-606.352) (-608.805) (-604.966) [-604.679] -- 0:00:18
      689500 -- (-604.431) (-607.270) [-605.413] (-606.842) * (-603.887) [-605.350] (-606.300) (-604.252) -- 0:00:18
      690000 -- (-604.945) (-607.935) (-604.267) [-604.318] * (-605.465) (-608.252) (-606.571) [-606.456] -- 0:00:18

      Average standard deviation of split frequencies: 0.009191

      690500 -- (-605.380) [-606.772] (-605.258) (-606.472) * (-604.219) (-607.499) [-605.995] (-606.695) -- 0:00:18
      691000 -- [-606.867] (-607.255) (-604.463) (-605.659) * [-604.065] (-605.214) (-608.079) (-604.726) -- 0:00:18
      691500 -- (-607.084) [-605.942] (-605.413) (-609.342) * (-605.753) (-604.211) (-610.752) [-605.924] -- 0:00:18
      692000 -- [-605.984] (-607.987) (-605.504) (-605.163) * (-605.034) [-603.661] (-606.364) (-606.485) -- 0:00:18
      692500 -- (-606.430) [-605.400] (-605.811) (-608.707) * (-605.169) [-603.654] (-609.523) (-604.079) -- 0:00:18
      693000 -- (-608.129) (-606.638) (-606.161) [-604.916] * (-604.364) (-607.137) (-606.213) [-604.516] -- 0:00:18
      693500 -- [-606.259] (-607.590) (-607.933) (-605.421) * (-604.759) [-604.632] (-610.146) (-604.597) -- 0:00:18
      694000 -- (-607.732) (-609.490) [-606.298] (-606.143) * [-606.586] (-605.461) (-604.790) (-606.042) -- 0:00:18
      694500 -- [-605.049] (-611.272) (-608.898) (-608.064) * [-604.802] (-603.849) (-603.718) (-606.901) -- 0:00:18
      695000 -- [-604.777] (-610.242) (-606.555) (-607.894) * (-605.190) (-607.646) [-603.725] (-607.400) -- 0:00:18

      Average standard deviation of split frequencies: 0.010114

      695500 -- [-604.297] (-605.877) (-606.113) (-606.873) * (-604.080) [-605.003] (-605.120) (-603.852) -- 0:00:18
      696000 -- (-608.100) [-604.559] (-603.600) (-606.421) * (-604.557) (-605.596) [-604.496] (-604.702) -- 0:00:18
      696500 -- [-605.753] (-607.207) (-606.228) (-607.488) * (-606.761) [-604.427] (-604.685) (-604.541) -- 0:00:18
      697000 -- (-608.977) [-608.042] (-604.572) (-607.996) * (-607.216) [-603.800] (-607.176) (-604.863) -- 0:00:18
      697500 -- [-604.825] (-605.833) (-605.281) (-607.487) * [-604.463] (-607.650) (-604.622) (-605.840) -- 0:00:18
      698000 -- (-603.795) [-608.989] (-605.340) (-606.649) * (-606.785) (-605.647) [-605.811] (-604.650) -- 0:00:18
      698500 -- (-605.601) (-606.372) [-606.412] (-605.833) * (-610.112) (-604.401) (-604.339) [-605.968] -- 0:00:18
      699000 -- (-604.877) [-605.052] (-606.716) (-606.486) * (-603.888) (-604.232) (-606.640) [-605.071] -- 0:00:18
      699500 -- (-604.808) (-607.902) [-604.016] (-606.471) * (-604.284) (-605.201) (-608.082) [-604.810] -- 0:00:18
      700000 -- (-604.112) (-605.041) [-604.396] (-611.265) * [-604.624] (-604.792) (-610.426) (-605.522) -- 0:00:18

      Average standard deviation of split frequencies: 0.010137

      700500 -- (-606.414) (-605.664) [-605.274] (-604.336) * (-607.648) (-606.576) (-607.420) [-606.944] -- 0:00:18
      701000 -- [-604.832] (-605.157) (-604.338) (-605.308) * [-606.018] (-605.717) (-605.762) (-610.248) -- 0:00:18
      701500 -- (-605.857) [-606.957] (-607.922) (-606.603) * (-605.307) [-605.958] (-605.866) (-606.149) -- 0:00:18
      702000 -- (-603.672) (-607.628) [-605.929] (-603.996) * (-604.667) (-608.249) (-611.234) [-604.419] -- 0:00:18
      702500 -- (-604.567) [-612.564] (-608.093) (-604.981) * (-606.676) (-605.501) [-605.249] (-606.489) -- 0:00:18
      703000 -- (-605.558) (-606.016) (-607.138) [-604.327] * (-607.165) [-605.257] (-606.067) (-604.653) -- 0:00:18
      703500 -- [-604.693] (-607.640) (-611.417) (-603.704) * (-608.620) (-604.534) (-607.916) [-608.953] -- 0:00:18
      704000 -- (-604.561) [-604.849] (-607.082) (-605.663) * (-606.803) (-609.997) (-607.479) [-606.225] -- 0:00:18
      704500 -- [-605.363] (-604.409) (-605.817) (-604.660) * [-607.518] (-605.279) (-609.494) (-607.405) -- 0:00:18
      705000 -- [-611.064] (-606.059) (-606.775) (-610.076) * [-607.282] (-606.270) (-605.934) (-605.849) -- 0:00:17

      Average standard deviation of split frequencies: 0.010772

      705500 -- (-606.138) (-605.428) [-605.373] (-605.666) * (-604.746) (-605.974) (-607.532) [-606.517] -- 0:00:17
      706000 -- (-605.643) (-605.688) (-607.187) [-606.442] * (-604.627) (-605.721) (-606.716) [-608.043] -- 0:00:17
      706500 -- [-605.460] (-604.929) (-605.152) (-605.130) * (-604.922) (-604.107) [-603.991] (-604.168) -- 0:00:17
      707000 -- (-605.990) (-604.522) (-606.036) [-605.839] * (-605.420) [-604.684] (-607.434) (-606.932) -- 0:00:17
      707500 -- (-607.375) (-605.105) (-608.817) [-604.209] * [-605.577] (-605.107) (-609.972) (-606.447) -- 0:00:17
      708000 -- (-610.402) [-604.479] (-606.509) (-604.634) * (-604.002) [-606.055] (-605.369) (-603.861) -- 0:00:17
      708500 -- (-604.728) [-605.647] (-606.575) (-604.665) * (-604.366) (-608.369) (-607.054) [-603.807] -- 0:00:17
      709000 -- (-605.224) (-604.564) (-603.908) [-605.179] * (-608.551) (-606.550) [-606.593] (-605.716) -- 0:00:17
      709500 -- [-606.738] (-606.066) (-605.121) (-608.331) * (-606.810) (-604.107) (-603.829) [-605.400] -- 0:00:17
      710000 -- (-604.624) (-608.567) [-604.364] (-605.460) * (-604.824) [-604.474] (-606.226) (-610.185) -- 0:00:17

      Average standard deviation of split frequencies: 0.010171

      710500 -- (-605.851) (-604.024) [-604.485] (-604.103) * (-605.958) (-605.106) [-606.239] (-604.901) -- 0:00:17
      711000 -- [-604.814] (-605.061) (-604.275) (-606.204) * (-603.908) (-604.520) [-607.435] (-604.696) -- 0:00:17
      711500 -- (-604.315) (-605.397) (-605.952) [-604.203] * (-603.931) (-606.065) [-605.377] (-606.100) -- 0:00:17
      712000 -- (-612.617) [-606.559] (-604.626) (-605.242) * (-604.505) [-604.759] (-607.955) (-605.476) -- 0:00:17
      712500 -- (-607.162) (-606.067) (-607.178) [-604.791] * [-605.704] (-605.861) (-604.564) (-606.652) -- 0:00:17
      713000 -- [-607.387] (-608.343) (-605.221) (-606.534) * (-607.227) (-607.312) [-604.574] (-606.442) -- 0:00:17
      713500 -- (-604.609) (-605.470) [-609.582] (-605.272) * (-605.285) (-607.402) (-603.791) [-609.928] -- 0:00:17
      714000 -- [-605.270] (-605.015) (-607.524) (-603.995) * [-607.805] (-605.424) (-609.994) (-611.207) -- 0:00:17
      714500 -- [-605.741] (-607.216) (-603.676) (-604.337) * (-604.693) [-604.322] (-610.494) (-607.008) -- 0:00:17
      715000 -- [-605.469] (-605.300) (-604.696) (-604.643) * (-604.713) [-605.178] (-606.360) (-603.463) -- 0:00:17

      Average standard deviation of split frequencies: 0.010622

      715500 -- (-608.128) (-605.881) (-605.609) [-606.416] * (-604.333) [-607.203] (-605.389) (-606.581) -- 0:00:17
      716000 -- (-606.416) (-604.977) [-604.978] (-604.543) * (-604.465) [-605.266] (-603.888) (-606.333) -- 0:00:17
      716500 -- (-605.650) (-606.210) [-604.655] (-605.789) * (-607.970) (-605.672) (-603.849) [-604.945] -- 0:00:17
      717000 -- (-606.201) (-605.532) [-606.709] (-608.591) * [-606.521] (-605.116) (-607.339) (-604.891) -- 0:00:17
      717500 -- (-610.551) (-605.642) [-604.215] (-605.757) * [-605.220] (-605.651) (-604.178) (-603.885) -- 0:00:17
      718000 -- (-608.256) (-606.462) (-603.989) [-607.020] * (-607.736) (-605.386) (-606.738) [-603.936] -- 0:00:17
      718500 -- [-606.720] (-605.659) (-603.521) (-607.221) * (-609.481) (-605.283) [-607.413] (-608.449) -- 0:00:17
      719000 -- (-606.709) (-604.445) (-610.491) [-604.466] * (-611.189) (-605.334) (-609.218) [-605.271] -- 0:00:17
      719500 -- (-604.820) (-605.031) (-604.992) [-613.330] * (-604.371) [-605.981] (-604.723) (-606.821) -- 0:00:17
      720000 -- [-608.134] (-606.465) (-607.893) (-606.739) * [-606.796] (-605.403) (-606.836) (-605.915) -- 0:00:17

      Average standard deviation of split frequencies: 0.010793

      720500 -- (-606.798) (-606.196) (-604.867) [-608.938] * (-605.740) (-604.276) [-606.281] (-605.547) -- 0:00:17
      721000 -- [-607.562] (-604.210) (-605.108) (-604.398) * (-606.184) [-604.139] (-605.425) (-605.597) -- 0:00:17
      721500 -- [-605.445] (-605.832) (-606.482) (-604.545) * (-609.633) (-605.737) (-607.921) [-607.287] -- 0:00:16
      722000 -- [-604.833] (-610.382) (-606.838) (-608.469) * (-607.866) (-606.579) (-611.840) [-603.899] -- 0:00:16
      722500 -- (-604.637) [-605.400] (-604.887) (-607.007) * [-611.614] (-604.849) (-605.652) (-603.703) -- 0:00:16
      723000 -- [-603.927] (-606.418) (-605.107) (-607.647) * (-604.914) (-607.086) [-605.899] (-604.179) -- 0:00:16
      723500 -- (-611.252) (-607.467) (-605.461) [-604.600] * [-605.177] (-605.072) (-606.244) (-605.605) -- 0:00:16
      724000 -- [-605.825] (-611.205) (-605.282) (-608.134) * (-608.713) (-608.200) [-604.311] (-606.525) -- 0:00:16
      724500 -- [-605.873] (-605.925) (-608.874) (-604.327) * (-608.266) (-609.493) [-605.169] (-604.558) -- 0:00:16
      725000 -- (-603.817) (-606.984) [-604.629] (-604.327) * (-610.932) [-606.860] (-604.051) (-607.087) -- 0:00:16

      Average standard deviation of split frequencies: 0.011255

      725500 -- [-604.552] (-604.804) (-604.229) (-605.538) * (-607.382) (-607.388) [-604.200] (-607.526) -- 0:00:16
      726000 -- (-606.122) [-605.864] (-604.270) (-608.636) * (-607.416) (-605.914) [-605.233] (-607.356) -- 0:00:16
      726500 -- [-607.268] (-604.645) (-605.477) (-605.743) * (-606.542) [-606.065] (-607.192) (-607.072) -- 0:00:16
      727000 -- (-604.246) [-607.129] (-604.423) (-606.587) * [-606.070] (-608.381) (-604.025) (-605.286) -- 0:00:16
      727500 -- [-604.945] (-607.864) (-603.886) (-605.650) * [-605.987] (-609.557) (-603.490) (-608.840) -- 0:00:16
      728000 -- [-606.097] (-604.407) (-604.359) (-606.404) * (-604.870) [-605.273] (-604.694) (-607.125) -- 0:00:16
      728500 -- (-606.903) (-606.774) [-604.121] (-606.093) * (-605.121) [-606.896] (-604.834) (-603.973) -- 0:00:16
      729000 -- (-605.264) (-607.907) (-605.954) [-606.908] * (-605.743) (-606.326) [-604.247] (-605.021) -- 0:00:16
      729500 -- (-609.839) [-605.878] (-605.183) (-606.659) * (-606.235) (-604.373) [-604.224] (-605.858) -- 0:00:16
      730000 -- (-606.770) (-605.675) (-605.824) [-604.562] * (-607.056) (-605.145) [-603.912] (-605.191) -- 0:00:16

      Average standard deviation of split frequencies: 0.010645

      730500 -- (-604.759) [-607.833] (-605.843) (-605.869) * (-605.768) (-611.786) [-605.205] (-609.358) -- 0:00:16
      731000 -- (-605.980) [-605.353] (-604.697) (-604.522) * [-604.526] (-606.823) (-609.898) (-605.434) -- 0:00:16
      731500 -- [-606.745] (-607.511) (-605.253) (-605.583) * [-605.011] (-607.176) (-605.874) (-605.333) -- 0:00:16
      732000 -- [-606.755] (-605.652) (-604.892) (-604.109) * [-604.173] (-604.700) (-605.354) (-604.203) -- 0:00:16
      732500 -- (-609.693) (-607.088) [-604.969] (-604.474) * [-605.937] (-605.122) (-607.850) (-606.359) -- 0:00:16
      733000 -- [-608.337] (-606.484) (-607.348) (-605.502) * [-606.274] (-604.326) (-609.113) (-607.584) -- 0:00:16
      733500 -- [-607.047] (-604.030) (-604.039) (-606.079) * (-604.652) [-604.784] (-605.671) (-604.047) -- 0:00:16
      734000 -- (-606.164) [-607.885] (-605.758) (-605.325) * [-606.129] (-606.845) (-609.541) (-605.058) -- 0:00:16
      734500 -- (-606.745) (-607.240) (-605.398) [-605.183] * (-610.604) [-604.314] (-604.354) (-606.175) -- 0:00:16
      735000 -- (-608.551) (-605.972) [-606.106] (-605.235) * (-605.483) (-605.605) (-606.595) [-608.114] -- 0:00:16

      Average standard deviation of split frequencies: 0.010408

      735500 -- (-605.275) (-605.339) (-606.106) [-606.511] * (-607.102) [-604.594] (-609.869) (-604.316) -- 0:00:16
      736000 -- [-607.344] (-604.824) (-608.611) (-605.315) * (-609.120) [-605.227] (-605.989) (-604.122) -- 0:00:16
      736500 -- (-606.636) (-605.011) [-606.501] (-604.363) * [-606.477] (-604.952) (-605.373) (-606.288) -- 0:00:16
      737000 -- [-605.103] (-604.748) (-606.013) (-607.183) * (-607.521) (-605.236) [-605.562] (-606.031) -- 0:00:16
      737500 -- [-607.622] (-606.258) (-604.484) (-608.109) * (-606.465) [-605.044] (-607.410) (-605.463) -- 0:00:16
      738000 -- (-608.131) (-609.169) (-604.857) [-606.088] * [-606.388] (-605.416) (-604.557) (-604.283) -- 0:00:15
      738500 -- (-603.940) (-604.317) [-605.548] (-605.630) * [-610.313] (-605.719) (-606.434) (-609.640) -- 0:00:15
      739000 -- (-603.769) (-604.688) [-610.868] (-609.699) * (-610.634) [-606.235] (-604.474) (-604.308) -- 0:00:15
      739500 -- (-604.353) (-607.908) [-605.577] (-612.766) * (-606.438) [-605.979] (-605.189) (-605.645) -- 0:00:15
      740000 -- [-605.283] (-608.174) (-609.185) (-605.859) * (-606.000) (-606.246) (-607.491) [-604.247] -- 0:00:15

      Average standard deviation of split frequencies: 0.010064

      740500 -- (-605.019) [-605.339] (-605.481) (-607.285) * [-604.934] (-605.256) (-604.002) (-606.308) -- 0:00:15
      741000 -- (-605.794) (-605.600) [-605.869] (-604.666) * (-607.010) (-605.685) [-605.645] (-604.038) -- 0:00:15
      741500 -- (-610.318) [-605.879] (-607.275) (-605.522) * [-609.322] (-605.836) (-604.855) (-607.357) -- 0:00:15
      742000 -- (-603.896) [-603.984] (-605.121) (-608.915) * (-608.269) (-607.424) [-605.267] (-605.771) -- 0:00:15
      742500 -- [-606.057] (-607.329) (-603.877) (-606.274) * [-607.320] (-604.644) (-606.968) (-608.869) -- 0:00:15
      743000 -- (-607.011) [-605.826] (-604.996) (-605.310) * (-605.099) (-604.939) [-605.900] (-606.792) -- 0:00:15
      743500 -- [-606.480] (-605.694) (-605.261) (-608.030) * (-607.630) [-606.168] (-604.679) (-609.976) -- 0:00:15
      744000 -- (-612.496) (-607.001) [-606.157] (-604.234) * [-605.079] (-603.650) (-607.505) (-603.836) -- 0:00:15
      744500 -- (-606.217) (-607.382) (-604.817) [-608.040] * [-604.494] (-603.793) (-606.064) (-603.894) -- 0:00:15
      745000 -- (-607.506) (-606.034) [-607.071] (-607.450) * (-605.322) (-606.169) (-605.900) [-605.295] -- 0:00:15

      Average standard deviation of split frequencies: 0.010150

      745500 -- (-604.451) (-605.422) [-605.469] (-605.612) * [-605.928] (-604.463) (-604.736) (-606.750) -- 0:00:15
      746000 -- (-605.133) (-604.580) [-606.289] (-604.640) * (-605.660) (-605.031) [-605.869] (-605.551) -- 0:00:15
      746500 -- (-606.440) [-606.373] (-614.391) (-604.759) * (-609.222) (-609.102) [-604.474] (-605.717) -- 0:00:15
      747000 -- (-611.189) (-606.068) (-610.227) [-610.473] * (-606.955) (-605.856) (-609.714) [-607.254] -- 0:00:15
      747500 -- (-612.939) (-608.742) (-608.118) [-610.480] * (-606.958) [-608.203] (-604.530) (-614.163) -- 0:00:15
      748000 -- (-616.195) (-606.061) [-606.866] (-606.541) * (-607.175) (-604.083) [-605.828] (-606.185) -- 0:00:15
      748500 -- (-604.844) (-604.804) [-605.022] (-608.694) * (-607.263) (-604.494) [-609.194] (-606.608) -- 0:00:15
      749000 -- (-605.706) (-605.344) [-607.378] (-609.278) * (-606.769) [-604.454] (-607.864) (-607.919) -- 0:00:15
      749500 -- [-604.653] (-607.097) (-610.743) (-604.121) * [-609.262] (-604.646) (-605.816) (-605.318) -- 0:00:15
      750000 -- (-603.916) (-604.201) (-605.324) [-605.099] * (-606.735) (-605.526) (-605.137) [-604.503] -- 0:00:15

      Average standard deviation of split frequencies: 0.009891

      750500 -- (-608.467) (-606.659) [-604.924] (-606.362) * [-605.204] (-605.227) (-605.296) (-608.316) -- 0:00:15
      751000 -- (-607.206) [-607.942] (-603.841) (-604.510) * (-606.257) (-604.745) [-605.175] (-604.017) -- 0:00:15
      751500 -- (-605.806) (-611.716) (-604.183) [-604.506] * [-605.867] (-604.130) (-606.025) (-605.183) -- 0:00:15
      752000 -- (-604.719) [-604.736] (-607.174) (-606.655) * (-604.196) [-610.570] (-604.898) (-604.964) -- 0:00:15
      752500 -- (-604.325) [-606.111] (-605.211) (-604.393) * (-605.808) [-607.312] (-607.315) (-607.289) -- 0:00:15
      753000 -- (-604.703) [-605.229] (-606.406) (-607.461) * (-604.612) [-604.807] (-608.345) (-607.200) -- 0:00:15
      753500 -- [-604.689] (-603.727) (-606.531) (-610.658) * [-604.401] (-604.910) (-606.597) (-604.512) -- 0:00:15
      754000 -- (-609.203) [-606.877] (-609.517) (-610.074) * (-607.063) (-605.019) (-607.320) [-604.928] -- 0:00:15
      754500 -- (-609.115) (-607.861) (-604.649) [-604.577] * [-606.947] (-604.665) (-606.438) (-606.559) -- 0:00:14
      755000 -- [-606.340] (-605.895) (-605.391) (-604.829) * [-607.605] (-604.728) (-605.106) (-608.594) -- 0:00:14

      Average standard deviation of split frequencies: 0.009626

      755500 -- [-606.051] (-606.051) (-605.665) (-607.335) * (-606.861) (-604.407) (-604.192) [-607.606] -- 0:00:14
      756000 -- (-604.965) (-605.583) [-604.528] (-606.702) * (-609.786) (-606.677) (-603.735) [-604.950] -- 0:00:14
      756500 -- (-605.891) (-605.421) (-603.935) [-606.216] * [-605.434] (-608.179) (-604.292) (-605.900) -- 0:00:14
      757000 -- [-604.958] (-604.141) (-606.049) (-613.505) * (-605.532) (-604.524) [-604.882] (-607.016) -- 0:00:14
      757500 -- (-608.945) (-609.739) [-604.401] (-606.010) * (-605.318) (-607.591) (-604.372) [-606.840] -- 0:00:14
      758000 -- (-607.268) [-605.688] (-605.204) (-607.653) * (-608.091) (-606.515) [-603.888] (-606.407) -- 0:00:14
      758500 -- [-604.113] (-609.344) (-605.858) (-603.942) * [-606.690] (-603.949) (-605.881) (-605.720) -- 0:00:14
      759000 -- (-609.041) (-607.635) [-605.937] (-605.461) * (-607.218) (-605.614) [-606.798] (-606.854) -- 0:00:14
      759500 -- (-604.700) (-605.911) [-604.991] (-604.962) * (-606.474) (-609.088) [-606.101] (-606.971) -- 0:00:14
      760000 -- (-605.746) (-604.809) [-604.680] (-607.510) * (-605.378) [-611.063] (-607.099) (-605.127) -- 0:00:14

      Average standard deviation of split frequencies: 0.009644

      760500 -- (-604.509) (-606.347) (-605.594) [-604.392] * [-604.020] (-603.873) (-605.153) (-605.266) -- 0:00:14
      761000 -- [-604.269] (-606.944) (-608.600) (-606.614) * (-603.654) (-606.184) (-606.360) [-605.715] -- 0:00:14
      761500 -- (-606.284) [-607.477] (-606.052) (-605.720) * (-604.149) (-607.102) [-606.507] (-607.148) -- 0:00:14
      762000 -- (-611.179) (-608.891) (-607.864) [-605.141] * [-604.490] (-604.342) (-608.227) (-607.064) -- 0:00:14
      762500 -- (-604.549) [-606.099] (-604.728) (-608.758) * [-606.340] (-604.882) (-606.330) (-606.820) -- 0:00:14
      763000 -- (-605.974) [-605.765] (-605.492) (-611.432) * (-608.424) (-605.186) [-603.679] (-607.143) -- 0:00:14
      763500 -- (-609.209) (-604.431) (-606.228) [-606.514] * (-609.410) [-603.825] (-606.295) (-605.157) -- 0:00:14
      764000 -- [-605.036] (-604.982) (-604.703) (-608.248) * (-606.788) (-605.111) [-606.667] (-608.107) -- 0:00:14
      764500 -- (-604.284) [-608.710] (-604.119) (-604.424) * (-607.246) [-606.022] (-606.591) (-605.390) -- 0:00:14
      765000 -- (-606.287) [-606.532] (-604.134) (-604.582) * (-607.073) [-604.355] (-607.170) (-606.300) -- 0:00:14

      Average standard deviation of split frequencies: 0.009270

      765500 -- (-606.110) [-604.480] (-605.020) (-606.925) * (-605.907) (-607.006) (-608.167) [-603.984] -- 0:00:14
      766000 -- (-606.029) (-609.843) (-605.255) [-605.672] * (-605.557) [-605.647] (-609.744) (-605.256) -- 0:00:14
      766500 -- (-605.582) [-605.963] (-606.204) (-605.316) * (-604.864) [-607.472] (-607.105) (-605.620) -- 0:00:14
      767000 -- (-604.991) [-603.769] (-608.563) (-603.850) * [-605.629] (-605.869) (-607.481) (-606.187) -- 0:00:14
      767500 -- (-606.560) (-604.451) (-605.175) [-608.529] * (-604.187) (-605.060) [-609.860] (-605.638) -- 0:00:14
      768000 -- (-608.089) (-607.272) (-606.000) [-607.544] * (-609.599) [-604.848] (-605.169) (-609.557) -- 0:00:14
      768500 -- (-604.494) (-607.464) [-607.419] (-609.808) * (-604.163) (-604.083) [-606.675] (-605.819) -- 0:00:14
      769000 -- (-604.916) (-606.192) [-607.285] (-604.515) * [-604.388] (-604.345) (-606.115) (-604.363) -- 0:00:14
      769500 -- (-607.142) (-609.879) (-607.206) [-603.963] * [-604.744] (-604.597) (-609.732) (-604.626) -- 0:00:14
      770000 -- (-603.855) [-606.113] (-607.870) (-604.533) * (-609.461) [-604.241] (-604.993) (-608.622) -- 0:00:14

      Average standard deviation of split frequencies: 0.