--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:36:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplM/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -605.14 -610.19
2 -605.11 -607.99
--------------------------------------
TOTAL -605.12 -609.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898308 0.090977 0.365075 1.510573 0.865391 1501.00 1501.00 1.000
r(A<->C){all} 0.175530 0.022589 0.000007 0.478553 0.134240 169.20 220.16 1.000
r(A<->G){all} 0.153115 0.018024 0.000035 0.411630 0.117519 258.27 294.88 1.000
r(A<->T){all} 0.163054 0.018777 0.000176 0.436573 0.125057 182.43 186.53 1.000
r(C<->G){all} 0.159555 0.018120 0.000104 0.418225 0.127729 169.88 263.96 1.020
r(C<->T){all} 0.172276 0.019422 0.000148 0.449490 0.140200 207.82 295.01 1.002
r(G<->T){all} 0.176469 0.021434 0.000089 0.466227 0.140129 156.48 183.23 1.003
pi(A){all} 0.224695 0.000381 0.187534 0.264837 0.224461 1210.12 1231.41 1.000
pi(C){all} 0.312469 0.000502 0.267378 0.355640 0.311544 1068.93 1134.43 1.000
pi(G){all} 0.274353 0.000457 0.232881 0.316174 0.274477 1371.31 1395.57 1.000
pi(T){all} 0.188483 0.000358 0.150893 0.224365 0.188059 1357.27 1410.00 1.000
alpha{1,2} 0.407076 0.217556 0.000182 1.346624 0.241369 1259.58 1279.58 1.000
alpha{3} 0.446580 0.234095 0.000145 1.375782 0.285265 1006.90 1161.05 1.001
pinvar{all} 0.996395 0.000020 0.988595 0.999993 0.997842 1175.27 1254.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -577.120878
Model 2: PositiveSelection -577.120899
Model 0: one-ratio -577.120914
Model 7: beta -577.120878
Model 8: beta&w>1 -577.120878
Model 0 vs 1 7.200000004559115E-5
Model 2 vs 1 4.200000012133387E-5
Model 8 vs 7 0.0
>C1
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C2
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C3
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C4
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C5
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C6
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
C1 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C2 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C3 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C4 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C5 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C6 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
**************************************************
C1 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C2 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C3 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C4 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C5 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C6 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
**************************************************
C1 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C2 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C3 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C4 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C5 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C6 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4410]--->[4410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.456 Mb, Max= 30.670 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C2 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C3 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C4 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C5 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
C6 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
**************************************************
C1 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C2 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C3 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C4 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C5 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
C6 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
**************************************************
C1 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C2 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C3 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C4 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C5 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
C6 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C2 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C3 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C4 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C5 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
C6 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
**************************************************
C1 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C2 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C3 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C4 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C5 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
C6 CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
**************************************************
C1 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C2 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C3 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C4 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C5 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
C6 CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
**************************************************
C1 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C2 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C3 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C4 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C5 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
C6 GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
**************************************************
C1 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C2 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C3 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C4 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C5 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
C6 TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
**************************************************
C1 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C2 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C3 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C4 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C5 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
C6 TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
**************************************************
C1 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C2 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C3 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C4 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C5 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
C6 GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
**************************************************
C1 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C2 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C3 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C4 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C5 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
C6 GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
**************************************************
C1 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C2 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C3 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C4 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C5 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
C6 CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
*****************************************
>C1
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C2
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C3
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C4
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C5
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C6
GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT
CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA
CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC
GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA
TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT
TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC
GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA
GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG
CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>C1
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C2
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C3
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C4
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C5
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
>C6
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 441 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790115
Setting output file names to "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 13450136
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0486216105
Seed = 288243108
Swapseed = 1579790115
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -986.979145 -- -24.965149
Chain 2 -- -986.979145 -- -24.965149
Chain 3 -- -986.979088 -- -24.965149
Chain 4 -- -986.979088 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -986.978994 -- -24.965149
Chain 2 -- -986.979145 -- -24.965149
Chain 3 -- -986.979145 -- -24.965149
Chain 4 -- -986.978994 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-986.979] (-986.979) (-986.979) (-986.979) * [-986.979] (-986.979) (-986.979) (-986.979)
500 -- (-613.909) (-616.262) (-615.808) [-614.533] * (-630.356) [-613.625] (-613.820) (-613.081) -- 0:00:00
1000 -- (-617.192) (-613.657) (-614.968) [-614.563] * (-615.351) [-611.900] (-617.297) (-619.264) -- 0:16:39
1500 -- (-609.001) (-612.812) [-612.477] (-622.938) * [-613.510] (-617.663) (-619.379) (-615.470) -- 0:11:05
2000 -- (-619.489) [-611.894] (-620.112) (-611.177) * [-611.727] (-611.272) (-615.145) (-616.968) -- 0:08:19
2500 -- (-614.129) (-622.785) (-611.746) [-617.903] * (-608.536) (-617.893) (-610.891) [-610.472] -- 0:06:39
3000 -- (-617.530) [-614.231] (-614.799) (-611.982) * (-613.636) (-617.452) (-613.604) [-608.388] -- 0:05:32
3500 -- (-619.313) (-616.529) (-622.465) [-620.002] * (-613.020) [-618.249] (-616.822) (-619.229) -- 0:04:44
4000 -- (-621.721) (-613.995) (-616.412) [-613.651] * (-615.884) (-612.183) [-613.965] (-611.066) -- 0:04:09
4500 -- (-611.277) (-614.813) (-616.625) [-608.541] * (-613.556) (-620.334) [-610.691] (-611.164) -- 0:03:41
5000 -- [-615.804] (-616.093) (-617.976) (-620.622) * (-618.463) (-618.100) (-613.174) [-627.507] -- 0:03:19
Average standard deviation of split frequencies: 0.081983
5500 -- (-622.390) [-619.466] (-614.649) (-623.827) * [-614.795] (-616.211) (-615.363) (-627.217) -- 0:03:00
6000 -- [-611.211] (-613.301) (-621.329) (-622.637) * (-619.349) (-620.027) [-614.234] (-616.850) -- 0:02:45
6500 -- (-617.643) [-621.492] (-619.496) (-617.371) * [-613.067] (-613.502) (-619.767) (-612.806) -- 0:02:32
7000 -- (-614.063) (-611.831) (-614.080) [-612.864] * (-615.215) (-626.809) [-611.819] (-612.303) -- 0:02:21
7500 -- [-613.373] (-611.595) (-616.979) (-620.913) * (-615.047) [-611.600] (-614.058) (-624.471) -- 0:02:12
8000 -- (-611.966) (-617.189) (-614.600) [-615.892] * [-616.408] (-630.153) (-617.968) (-620.947) -- 0:02:04
8500 -- (-613.470) (-620.605) [-615.264] (-615.581) * (-621.761) (-620.298) (-612.643) [-615.705] -- 0:01:56
9000 -- (-617.723) (-612.764) (-617.138) [-609.563] * (-616.274) (-613.113) (-617.266) [-608.804] -- 0:01:50
9500 -- (-621.428) (-619.223) [-622.379] (-620.875) * (-615.398) [-615.465] (-614.495) (-617.180) -- 0:01:44
10000 -- (-618.465) (-619.206) (-619.573) [-609.327] * (-618.463) (-614.943) (-614.626) [-611.245] -- 0:01:39
Average standard deviation of split frequencies: 0.082864
10500 -- (-620.818) (-618.308) [-610.652] (-618.190) * (-610.693) (-619.194) [-612.894] (-613.701) -- 0:01:34
11000 -- [-611.065] (-615.871) (-611.831) (-623.696) * (-606.071) (-619.228) [-612.064] (-621.843) -- 0:01:29
11500 -- (-619.605) [-621.369] (-609.951) (-617.218) * (-606.473) (-613.406) [-618.929] (-619.688) -- 0:01:25
12000 -- [-613.744] (-613.096) (-617.139) (-613.405) * [-606.626] (-612.634) (-607.964) (-617.890) -- 0:01:22
12500 -- (-620.623) (-623.024) [-620.084] (-611.463) * [-603.932] (-614.517) (-622.143) (-616.230) -- 0:01:19
13000 -- (-617.966) (-616.313) [-616.849] (-615.773) * (-605.603) (-614.749) (-617.331) [-618.315] -- 0:01:15
13500 -- (-618.320) (-614.243) (-614.857) [-611.375] * (-605.412) (-612.152) (-617.137) [-615.662] -- 0:01:13
14000 -- (-622.467) (-627.504) (-612.732) [-618.913] * (-609.316) (-619.814) [-618.660] (-614.691) -- 0:01:10
14500 -- (-608.987) (-609.370) [-610.597] (-611.129) * (-607.891) (-613.310) (-616.519) [-613.330] -- 0:01:07
15000 -- [-616.087] (-608.806) (-617.861) (-612.218) * [-607.752] (-612.484) (-611.124) (-614.213) -- 0:01:05
Average standard deviation of split frequencies: 0.038670
15500 -- (-624.851) (-604.452) [-611.505] (-609.967) * (-607.424) (-616.241) (-614.233) [-612.343] -- 0:01:03
16000 -- [-609.874] (-606.550) (-615.606) (-612.609) * (-607.192) [-609.417] (-611.985) (-615.121) -- 0:01:01
16500 -- (-617.778) (-607.644) [-615.283] (-621.333) * (-608.666) [-605.472] (-617.294) (-622.245) -- 0:00:59
17000 -- [-614.468] (-606.840) (-614.368) (-617.259) * [-606.733] (-608.183) (-619.593) (-617.437) -- 0:01:55
17500 -- [-609.114] (-604.881) (-612.305) (-608.873) * (-605.008) [-604.488] (-616.720) (-616.397) -- 0:01:52
18000 -- (-617.443) (-606.415) [-611.657] (-619.391) * [-603.673] (-603.927) (-617.447) (-614.211) -- 0:01:49
18500 -- (-617.939) (-608.615) (-615.745) [-609.421] * (-608.731) (-605.738) (-611.445) [-612.238] -- 0:01:46
19000 -- (-631.613) [-606.427] (-610.901) (-612.534) * (-609.736) [-606.331] (-615.740) (-617.423) -- 0:01:43
19500 -- (-634.841) (-606.525) [-616.303] (-617.971) * (-605.137) (-607.111) [-610.209] (-611.618) -- 0:01:40
20000 -- (-622.919) (-610.870) [-614.566] (-614.946) * (-604.846) (-608.904) (-618.588) [-616.013] -- 0:01:38
Average standard deviation of split frequencies: 0.072992
20500 -- (-605.477) [-608.254] (-624.045) (-614.598) * (-604.560) (-607.574) (-618.644) [-610.271] -- 0:01:35
21000 -- (-605.776) [-605.206] (-615.250) (-611.907) * (-607.143) (-609.051) [-614.273] (-612.200) -- 0:01:33
21500 -- (-604.155) (-606.382) (-613.463) [-613.601] * (-606.098) (-608.839) [-612.004] (-616.210) -- 0:01:31
22000 -- [-605.195] (-606.480) (-616.443) (-616.262) * [-608.134] (-607.821) (-620.579) (-619.159) -- 0:01:28
22500 -- (-606.996) (-606.527) [-612.175] (-616.511) * (-605.772) [-606.792] (-618.559) (-624.592) -- 0:01:26
23000 -- (-604.826) (-603.971) (-615.569) [-611.857] * (-608.821) [-604.916] (-614.394) (-619.602) -- 0:01:24
23500 -- (-604.734) [-604.222] (-618.392) (-612.021) * (-607.962) [-604.542] (-614.911) (-625.093) -- 0:01:23
24000 -- (-604.909) [-605.146] (-623.999) (-618.405) * (-605.475) (-604.148) [-616.474] (-614.710) -- 0:01:21
24500 -- [-607.133] (-605.573) (-607.966) (-609.326) * [-604.573] (-603.981) (-611.475) (-621.844) -- 0:01:19
25000 -- (-604.755) [-604.494] (-605.470) (-615.002) * (-607.796) [-606.267] (-614.176) (-617.545) -- 0:01:18
Average standard deviation of split frequencies: 0.046622
25500 -- (-607.653) (-606.251) (-605.745) [-615.771] * (-607.880) (-608.996) (-612.589) [-619.603] -- 0:01:16
26000 -- [-605.265] (-607.360) (-607.637) (-612.681) * (-607.764) (-606.903) (-613.639) [-611.295] -- 0:01:14
26500 -- (-605.475) (-604.634) (-608.220) [-613.071] * (-605.930) [-605.666] (-615.078) (-615.718) -- 0:01:13
27000 -- (-611.236) (-604.477) [-607.613] (-616.005) * (-606.288) (-605.140) (-620.873) [-620.094] -- 0:01:12
27500 -- (-603.585) (-606.373) (-607.606) [-612.328] * (-609.996) [-609.182] (-619.369) (-610.807) -- 0:01:10
28000 -- (-604.268) (-604.683) [-608.820] (-630.283) * (-607.410) (-605.596) [-615.652] (-614.184) -- 0:01:09
28500 -- [-605.758] (-606.174) (-607.621) (-614.178) * (-606.554) (-605.853) [-619.300] (-614.068) -- 0:01:08
29000 -- [-603.946] (-604.959) (-608.675) (-615.641) * (-609.936) [-606.016] (-622.384) (-617.732) -- 0:01:06
29500 -- [-604.241] (-606.088) (-606.703) (-613.731) * [-606.796] (-607.764) (-627.886) (-613.887) -- 0:01:05
30000 -- [-604.091] (-606.234) (-606.793) (-619.266) * [-605.572] (-608.128) (-617.166) (-617.025) -- 0:01:04
Average standard deviation of split frequencies: 0.049776
30500 -- (-604.129) (-606.162) [-605.874] (-621.785) * (-605.185) (-606.893) [-611.578] (-614.386) -- 0:01:03
31000 -- [-606.221] (-606.466) (-606.342) (-618.526) * [-605.592] (-606.145) (-617.794) (-615.170) -- 0:01:02
31500 -- (-610.294) (-607.483) (-605.087) [-616.774] * (-604.422) (-608.610) [-614.990] (-614.743) -- 0:01:01
32000 -- (-609.310) [-604.444] (-606.845) (-616.108) * (-605.425) (-611.730) [-613.769] (-613.412) -- 0:01:00
32500 -- (-607.027) (-607.926) [-609.364] (-613.502) * [-606.018] (-606.494) (-613.954) (-615.218) -- 0:00:59
33000 -- (-606.900) (-604.904) (-605.309) [-612.630] * (-607.602) (-606.849) (-618.270) [-607.642] -- 0:00:58
33500 -- (-606.245) [-608.048] (-604.854) (-618.606) * (-605.147) (-606.107) (-609.404) [-616.028] -- 0:00:57
34000 -- (-607.631) (-604.405) (-605.138) [-611.729] * [-606.880] (-607.099) (-609.369) (-616.220) -- 0:01:25
34500 -- (-607.078) [-604.623] (-605.634) (-613.414) * [-604.133] (-604.842) (-624.020) (-611.532) -- 0:01:23
35000 -- (-607.725) (-606.097) (-605.101) [-615.565] * [-603.762] (-603.701) (-610.623) (-616.105) -- 0:01:22
Average standard deviation of split frequencies: 0.043867
35500 -- (-610.939) (-606.202) (-605.397) [-618.064] * (-603.671) [-605.541] (-620.510) (-612.266) -- 0:01:21
36000 -- (-607.430) (-606.028) [-605.655] (-614.958) * (-609.662) (-607.389) [-613.185] (-618.257) -- 0:01:20
36500 -- (-604.869) (-604.682) (-604.584) [-614.439] * (-606.611) (-605.451) (-618.278) [-613.080] -- 0:01:19
37000 -- (-604.463) [-606.165] (-608.463) (-617.107) * [-606.020] (-604.427) (-614.863) (-612.793) -- 0:01:18
37500 -- [-606.738] (-607.950) (-606.282) (-612.217) * [-607.048] (-604.274) (-616.884) (-609.717) -- 0:01:17
38000 -- [-604.726] (-605.825) (-603.839) (-621.146) * [-604.222] (-604.260) (-617.429) (-624.267) -- 0:01:15
38500 -- (-604.629) (-605.485) [-605.908] (-613.226) * (-604.476) [-604.812] (-613.838) (-628.739) -- 0:01:14
39000 -- (-604.804) [-607.125] (-612.779) (-613.969) * [-604.640] (-606.715) (-610.366) (-622.205) -- 0:01:13
39500 -- (-610.934) (-605.154) (-605.013) [-610.844] * (-605.520) [-604.779] (-614.729) (-621.217) -- 0:01:12
40000 -- (-605.005) (-603.994) (-604.023) [-617.170] * (-606.263) (-606.049) [-610.229] (-604.192) -- 0:01:12
Average standard deviation of split frequencies: 0.029895
40500 -- (-605.101) [-608.991] (-607.268) (-617.788) * (-607.260) (-606.243) [-612.598] (-606.008) -- 0:01:11
41000 -- (-608.631) (-607.126) (-608.032) [-613.185] * (-606.484) [-605.251] (-617.581) (-607.255) -- 0:01:10
41500 -- [-606.927] (-606.145) (-606.610) (-611.816) * (-605.584) [-604.099] (-620.191) (-604.246) -- 0:01:09
42000 -- (-606.789) [-604.466] (-608.215) (-615.827) * (-607.385) [-605.465] (-620.910) (-606.543) -- 0:01:08
42500 -- (-605.098) (-605.564) (-607.074) [-619.433] * [-605.707] (-606.556) (-625.254) (-606.519) -- 0:01:07
43000 -- (-607.882) (-604.579) (-607.440) [-613.254] * (-608.797) (-609.725) (-619.438) [-612.996] -- 0:01:06
43500 -- (-607.654) (-604.905) [-607.246] (-619.150) * (-607.490) [-609.288] (-619.471) (-606.828) -- 0:01:05
44000 -- [-604.346] (-604.195) (-605.986) (-619.849) * (-606.386) (-610.049) (-609.862) [-606.301] -- 0:01:05
44500 -- (-604.497) (-609.998) (-607.950) [-615.072] * [-606.303] (-610.045) (-613.729) (-604.098) -- 0:01:04
45000 -- (-604.350) (-609.143) [-609.157] (-610.950) * (-608.891) (-606.439) [-621.162] (-605.392) -- 0:01:03
Average standard deviation of split frequencies: 0.025864
45500 -- (-604.878) [-612.520] (-607.061) (-622.817) * (-605.026) (-606.117) [-618.056] (-604.614) -- 0:01:02
46000 -- [-605.700] (-605.706) (-607.830) (-620.940) * (-604.783) [-604.898] (-615.117) (-604.753) -- 0:01:02
46500 -- (-604.058) [-603.870] (-605.978) (-617.422) * (-606.023) (-605.886) [-613.307] (-604.568) -- 0:01:01
47000 -- [-606.462] (-607.297) (-607.481) (-622.960) * (-606.535) (-606.213) [-613.073] (-606.448) -- 0:01:00
47500 -- (-604.880) [-606.152] (-605.490) (-614.680) * [-604.556] (-606.941) (-616.377) (-607.888) -- 0:01:00
48000 -- [-604.166] (-606.636) (-606.221) (-617.970) * (-608.887) [-609.795] (-613.406) (-605.781) -- 0:00:59
48500 -- (-604.663) (-605.557) (-604.549) [-614.591] * [-604.595] (-612.609) (-617.086) (-608.756) -- 0:00:58
49000 -- (-604.906) (-606.072) [-606.472] (-612.938) * [-605.996] (-609.345) (-615.582) (-607.446) -- 0:00:58
49500 -- (-605.690) (-605.392) (-603.822) [-610.910] * (-607.437) (-606.161) (-615.469) [-605.515] -- 0:00:57
50000 -- (-606.467) [-607.260] (-605.594) (-608.595) * (-605.959) (-605.587) (-617.626) [-603.589] -- 0:00:57
Average standard deviation of split frequencies: 0.023260
50500 -- (-605.444) (-607.014) [-605.619] (-611.839) * (-604.885) (-608.550) (-615.728) [-604.783] -- 0:00:56
51000 -- (-604.609) (-609.643) (-605.619) [-616.247] * (-604.401) (-605.124) (-619.661) [-604.036] -- 0:01:14
51500 -- (-605.500) [-604.393] (-608.660) (-613.877) * (-606.594) [-606.995] (-616.603) (-605.781) -- 0:01:13
52000 -- (-604.727) (-604.532) (-606.051) [-617.617] * (-606.892) (-604.061) (-615.689) [-604.907] -- 0:01:12
52500 -- (-611.110) (-604.276) (-605.363) [-611.944] * (-608.601) (-604.446) [-619.867] (-606.164) -- 0:01:12
53000 -- (-604.416) [-604.302] (-606.669) (-615.690) * (-608.682) (-605.276) (-612.931) [-609.719] -- 0:01:11
53500 -- (-604.500) [-604.330] (-608.393) (-617.959) * (-605.804) (-606.739) (-615.474) [-605.055] -- 0:01:10
54000 -- (-604.966) (-605.917) [-606.714] (-619.333) * (-606.200) (-605.678) (-617.125) [-604.453] -- 0:01:10
54500 -- [-605.186] (-609.671) (-607.848) (-633.282) * (-606.306) [-608.453] (-609.116) (-604.427) -- 0:01:09
55000 -- (-606.841) (-609.591) [-604.544] (-613.714) * (-607.605) [-605.617] (-611.216) (-604.727) -- 0:01:08
Average standard deviation of split frequencies: 0.027258
55500 -- (-606.788) (-611.862) [-605.356] (-606.427) * (-606.907) (-606.097) (-612.629) [-606.550] -- 0:01:08
56000 -- (-607.778) [-605.801] (-605.001) (-603.410) * (-605.455) (-606.127) [-612.654] (-606.482) -- 0:01:07
56500 -- (-606.402) (-604.846) [-604.421] (-607.615) * (-606.251) [-605.762] (-615.881) (-605.975) -- 0:01:06
57000 -- (-604.997) (-604.823) (-604.452) [-607.071] * (-605.054) (-605.806) (-616.071) [-605.853] -- 0:01:06
57500 -- (-604.314) (-605.202) (-608.526) [-606.491] * [-604.487] (-606.324) (-620.918) (-605.097) -- 0:01:05
58000 -- (-603.859) (-607.049) [-608.428] (-610.904) * (-606.667) [-604.502] (-613.647) (-607.763) -- 0:01:04
58500 -- (-604.837) [-604.351] (-607.038) (-608.801) * (-606.719) (-605.032) (-620.108) [-608.374] -- 0:01:04
59000 -- (-605.194) [-605.613] (-606.948) (-604.208) * [-605.498] (-606.473) (-613.650) (-605.385) -- 0:01:03
59500 -- (-605.703) (-605.241) (-605.386) [-605.709] * [-605.482] (-605.882) (-618.545) (-606.768) -- 0:01:03
60000 -- [-604.345] (-609.865) (-608.846) (-606.133) * (-605.865) (-607.391) (-615.191) [-604.844] -- 0:01:02
Average standard deviation of split frequencies: 0.031788
60500 -- (-605.241) (-607.064) (-606.041) [-609.761] * (-605.559) (-604.620) [-617.033] (-605.245) -- 0:01:02
61000 -- (-605.445) [-604.601] (-606.828) (-611.342) * (-607.931) (-607.830) (-619.565) [-604.651] -- 0:01:01
61500 -- (-608.092) [-605.289] (-604.738) (-607.806) * [-605.518] (-606.451) (-620.163) (-605.117) -- 0:01:01
62000 -- (-613.889) (-606.213) [-606.644] (-604.517) * (-606.526) [-606.089] (-614.738) (-605.183) -- 0:01:00
62500 -- (-607.842) [-608.330] (-604.008) (-604.539) * (-609.778) (-605.762) (-617.450) [-604.209] -- 0:01:00
63000 -- (-604.499) [-605.392] (-606.409) (-604.607) * (-608.667) [-604.692] (-621.309) (-605.076) -- 0:00:59
63500 -- (-604.732) (-607.884) [-604.710] (-605.717) * (-607.643) (-604.390) [-610.499] (-606.356) -- 0:00:58
64000 -- (-605.310) (-605.959) [-606.741] (-609.052) * (-604.550) [-603.783] (-620.291) (-606.095) -- 0:00:58
64500 -- [-605.458] (-605.575) (-605.211) (-605.904) * [-605.482] (-605.083) (-621.469) (-606.580) -- 0:00:58
65000 -- (-606.711) (-607.185) [-611.572] (-606.375) * (-604.167) [-605.462] (-614.280) (-606.770) -- 0:00:57
Average standard deviation of split frequencies: 0.031167
65500 -- [-603.528] (-606.659) (-606.191) (-609.566) * [-608.432] (-607.598) (-616.896) (-606.850) -- 0:00:57
66000 -- (-605.130) [-605.445] (-609.068) (-604.961) * [-606.158] (-604.179) (-616.067) (-605.742) -- 0:00:56
66500 -- (-606.406) (-604.795) [-606.086] (-605.028) * (-604.820) (-606.813) (-617.372) [-606.496] -- 0:00:56
67000 -- (-607.082) [-604.714] (-604.464) (-608.232) * [-603.496] (-604.123) (-615.079) (-605.058) -- 0:00:55
67500 -- (-609.730) (-605.464) [-605.829] (-606.676) * (-604.389) (-604.074) (-616.429) [-604.643] -- 0:00:55
68000 -- (-607.345) [-604.277] (-610.160) (-604.621) * [-604.023] (-604.439) (-619.853) (-605.992) -- 0:01:08
68500 -- (-608.730) (-604.703) (-608.189) [-605.659] * (-604.882) (-609.029) (-611.680) [-606.155] -- 0:01:07
69000 -- (-608.859) (-604.828) [-605.740] (-605.458) * [-603.816] (-604.941) (-622.949) (-604.954) -- 0:01:07
69500 -- (-607.118) (-605.544) [-606.451] (-607.157) * [-604.523] (-608.665) (-615.673) (-608.721) -- 0:01:06
70000 -- (-605.873) (-609.960) (-604.278) [-606.575] * [-605.614] (-606.294) (-613.889) (-607.387) -- 0:01:06
Average standard deviation of split frequencies: 0.027017
70500 -- [-607.006] (-605.392) (-606.405) (-606.923) * (-605.960) (-605.721) [-617.508] (-608.199) -- 0:01:05
71000 -- (-605.265) (-604.738) (-606.505) [-604.289] * (-605.047) (-605.234) [-612.233] (-607.648) -- 0:01:05
71500 -- (-605.352) [-604.853] (-608.479) (-605.830) * (-603.736) (-603.583) (-617.514) [-606.390] -- 0:01:04
72000 -- (-607.024) (-604.234) [-605.204] (-604.197) * (-604.937) (-606.535) (-616.177) [-604.422] -- 0:01:04
72500 -- (-603.888) [-605.490] (-604.529) (-605.670) * (-606.680) (-606.709) (-616.095) [-604.657] -- 0:01:03
73000 -- (-605.234) [-609.710] (-604.422) (-604.739) * [-605.227] (-605.112) (-629.311) (-605.755) -- 0:01:03
73500 -- (-608.868) (-606.203) [-605.182] (-607.928) * [-605.310] (-604.316) (-615.954) (-604.223) -- 0:01:03
74000 -- [-605.169] (-605.070) (-605.494) (-609.102) * [-605.256] (-605.876) (-612.645) (-606.829) -- 0:01:02
74500 -- (-606.485) (-604.054) (-609.074) [-605.193] * (-606.843) (-606.223) [-614.018] (-610.606) -- 0:01:02
75000 -- (-606.518) (-605.489) (-610.276) [-607.072] * (-609.056) (-606.883) (-631.020) [-604.805] -- 0:01:01
Average standard deviation of split frequencies: 0.022950
75500 -- [-605.096] (-605.110) (-611.326) (-605.690) * (-607.494) (-605.363) (-625.933) [-604.381] -- 0:01:01
76000 -- [-604.906] (-604.833) (-606.326) (-610.977) * [-605.918] (-607.895) (-612.905) (-604.543) -- 0:01:00
76500 -- [-604.469] (-604.083) (-606.326) (-608.062) * [-605.457] (-605.067) (-604.338) (-606.776) -- 0:01:00
77000 -- (-605.002) (-604.563) [-607.497] (-606.161) * (-605.932) (-607.881) [-604.635] (-605.019) -- 0:00:59
77500 -- (-607.049) (-605.369) (-604.915) [-607.493] * (-604.415) (-605.003) [-604.163] (-604.155) -- 0:00:59
78000 -- [-607.302] (-605.046) (-606.583) (-605.063) * (-606.041) (-605.916) (-608.321) [-605.081] -- 0:00:59
78500 -- [-603.946] (-608.254) (-605.451) (-606.558) * (-607.041) (-604.809) [-607.133] (-606.689) -- 0:00:58
79000 -- [-607.153] (-604.435) (-608.794) (-608.687) * (-608.954) (-604.006) [-604.580] (-604.199) -- 0:00:58
79500 -- (-606.099) [-604.178] (-607.419) (-604.792) * [-606.862] (-608.006) (-609.203) (-604.802) -- 0:00:57
80000 -- (-607.805) (-604.994) (-605.512) [-605.013] * [-606.062] (-606.455) (-605.170) (-607.232) -- 0:00:57
Average standard deviation of split frequencies: 0.024913
80500 -- (-607.016) [-604.426] (-605.585) (-605.934) * (-605.027) [-608.280] (-607.170) (-605.828) -- 0:00:57
81000 -- [-608.409] (-604.316) (-606.207) (-606.716) * (-608.139) (-605.206) [-605.619] (-606.083) -- 0:00:56
81500 -- (-605.871) (-606.716) (-607.275) [-607.182] * (-606.210) [-604.511] (-605.233) (-605.146) -- 0:00:56
82000 -- (-605.221) (-610.414) [-604.800] (-609.607) * [-603.642] (-606.337) (-605.264) (-604.578) -- 0:00:55
82500 -- [-605.588] (-608.316) (-604.712) (-608.880) * [-603.936] (-604.583) (-608.494) (-603.654) -- 0:00:55
83000 -- [-606.451] (-604.471) (-605.064) (-606.605) * [-606.512] (-604.043) (-605.993) (-604.985) -- 0:00:55
83500 -- [-604.230] (-606.947) (-605.842) (-610.270) * [-605.680] (-608.825) (-606.210) (-608.116) -- 0:00:54
84000 -- (-604.228) [-604.043] (-612.142) (-605.319) * [-604.787] (-605.095) (-606.210) (-606.033) -- 0:00:54
84500 -- [-604.564] (-605.242) (-605.909) (-607.510) * (-605.423) (-606.347) (-604.745) [-605.562] -- 0:00:54
85000 -- [-606.679] (-603.784) (-610.066) (-613.039) * [-606.465] (-604.983) (-604.143) (-608.723) -- 0:01:04
Average standard deviation of split frequencies: 0.024797
85500 -- (-606.488) [-604.679] (-608.347) (-605.404) * (-613.089) [-605.564] (-607.083) (-611.223) -- 0:01:04
86000 -- (-603.951) [-604.064] (-607.136) (-605.121) * (-604.003) [-608.807] (-604.231) (-606.507) -- 0:01:03
86500 -- (-604.941) (-604.628) [-605.371] (-605.062) * (-606.542) (-606.806) (-606.584) [-604.773] -- 0:01:03
87000 -- (-603.885) (-604.629) [-605.702] (-607.099) * (-606.196) [-605.948] (-606.630) (-606.428) -- 0:01:02
87500 -- (-609.085) (-606.404) [-604.640] (-606.509) * (-606.448) (-603.683) (-608.535) [-604.920] -- 0:01:02
88000 -- (-608.337) (-607.052) [-603.974] (-605.366) * (-611.267) (-606.110) (-608.228) [-604.112] -- 0:01:02
88500 -- (-607.788) (-609.576) (-606.572) [-604.839] * (-604.878) (-606.874) [-606.387] (-613.631) -- 0:01:01
89000 -- (-607.883) (-608.231) [-606.777] (-606.574) * (-603.564) [-607.157] (-606.400) (-611.536) -- 0:01:01
89500 -- (-606.407) (-603.992) (-605.968) [-605.813] * (-604.394) (-607.014) (-604.947) [-603.580] -- 0:01:01
90000 -- [-606.818] (-604.941) (-607.879) (-606.290) * (-608.538) [-607.179] (-605.466) (-607.739) -- 0:01:00
Average standard deviation of split frequencies: 0.025997
90500 -- (-605.798) (-609.048) [-606.849] (-606.897) * (-606.903) (-604.253) [-606.814] (-607.445) -- 0:01:00
91000 -- (-605.512) (-607.083) [-607.015] (-605.082) * [-605.569] (-608.348) (-605.110) (-608.219) -- 0:00:59
91500 -- (-608.610) (-605.363) [-606.173] (-604.155) * (-605.352) (-606.598) [-607.069] (-606.182) -- 0:00:59
92000 -- (-612.025) (-606.119) (-608.464) [-604.558] * [-606.344] (-606.170) (-605.151) (-606.581) -- 0:00:59
92500 -- (-608.465) (-606.889) [-604.350] (-604.248) * (-606.880) (-606.744) (-607.120) [-604.171] -- 0:00:58
93000 -- (-606.794) (-604.712) [-607.142] (-607.834) * (-614.477) [-605.660] (-605.489) (-604.909) -- 0:00:58
93500 -- (-604.050) (-606.958) [-606.966] (-606.252) * (-604.897) (-606.897) [-607.293] (-607.567) -- 0:00:58
94000 -- [-603.731] (-608.436) (-605.384) (-608.430) * [-604.459] (-608.091) (-606.565) (-606.164) -- 0:00:57
94500 -- [-606.227] (-604.867) (-608.766) (-612.323) * (-605.077) (-604.193) (-607.076) [-604.944] -- 0:00:57
95000 -- (-607.634) (-607.292) [-606.806] (-604.505) * (-607.224) [-605.330] (-606.755) (-605.260) -- 0:00:57
Average standard deviation of split frequencies: 0.025069
95500 -- (-604.834) (-608.419) [-606.476] (-605.066) * (-604.740) [-605.445] (-607.049) (-605.377) -- 0:00:56
96000 -- (-603.894) (-607.155) (-606.725) [-604.157] * (-608.187) (-606.373) (-604.952) [-606.435] -- 0:00:56
96500 -- (-607.688) (-605.450) (-608.167) [-609.263] * (-607.309) (-605.744) (-604.945) [-603.830] -- 0:00:56
97000 -- (-606.104) (-608.321) [-605.198] (-610.578) * [-605.454] (-608.701) (-607.664) (-603.766) -- 0:00:55
97500 -- [-605.215] (-606.286) (-605.733) (-604.774) * (-605.028) [-606.496] (-607.336) (-605.298) -- 0:00:55
98000 -- (-604.954) [-605.072] (-606.268) (-605.726) * (-607.594) (-604.558) [-605.448] (-605.239) -- 0:00:55
98500 -- [-607.015] (-605.461) (-609.649) (-607.003) * (-604.947) [-604.629] (-607.193) (-605.360) -- 0:00:54
99000 -- (-606.679) (-605.162) (-605.884) [-605.061] * (-603.861) (-604.937) (-607.042) [-603.500] -- 0:00:54
99500 -- (-606.272) (-603.861) (-605.633) [-604.992] * [-604.472] (-607.817) (-609.114) (-603.581) -- 0:00:54
100000 -- (-605.993) (-605.299) (-604.476) [-607.984] * (-604.054) (-609.784) (-608.940) [-604.724] -- 0:00:54
Average standard deviation of split frequencies: 0.024715
100500 -- (-605.388) (-606.435) [-606.388] (-603.909) * (-606.241) (-606.697) (-609.609) [-605.669] -- 0:00:53
101000 -- (-604.479) (-606.696) (-604.413) [-604.583] * (-607.164) (-605.986) (-608.737) [-607.907] -- 0:00:53
101500 -- (-606.088) (-606.268) [-609.564] (-609.454) * (-604.708) [-604.891] (-604.876) (-606.563) -- 0:01:01
102000 -- (-606.114) (-606.080) (-609.492) [-604.981] * (-604.582) (-607.908) [-606.282] (-608.015) -- 0:01:01
102500 -- (-604.616) (-605.005) [-606.212] (-606.789) * (-605.679) (-608.499) (-604.935) [-606.732] -- 0:01:01
103000 -- (-607.200) (-606.015) (-606.601) [-605.015] * [-604.877] (-607.319) (-606.749) (-607.585) -- 0:01:00
103500 -- (-604.907) (-605.814) [-605.755] (-608.677) * [-604.495] (-604.310) (-605.738) (-605.186) -- 0:01:00
104000 -- [-606.060] (-607.150) (-605.787) (-606.723) * (-604.914) [-605.354] (-608.468) (-604.846) -- 0:01:00
104500 -- (-604.996) (-610.519) [-607.758] (-604.280) * [-603.630] (-608.203) (-604.989) (-605.835) -- 0:00:59
105000 -- (-603.724) (-608.084) [-605.850] (-606.064) * (-604.431) [-606.530] (-606.346) (-605.504) -- 0:00:59
Average standard deviation of split frequencies: 0.022236
105500 -- (-608.536) (-607.848) (-604.349) [-604.891] * [-603.623] (-607.505) (-605.883) (-604.776) -- 0:00:59
106000 -- (-610.968) (-607.964) [-607.121] (-603.539) * (-604.780) (-605.188) [-606.579] (-604.893) -- 0:00:59
106500 -- (-608.918) [-607.004] (-607.062) (-606.067) * [-604.344] (-606.790) (-605.436) (-604.378) -- 0:00:58
107000 -- (-605.164) (-607.105) (-607.107) [-607.222] * (-607.005) (-605.485) (-604.666) [-605.624] -- 0:00:58
107500 -- (-606.143) (-604.815) [-605.033] (-606.988) * [-605.337] (-604.884) (-610.559) (-606.487) -- 0:00:58
108000 -- (-605.959) [-605.833] (-606.471) (-607.285) * (-605.921) [-606.871] (-609.760) (-607.103) -- 0:00:57
108500 -- (-605.873) (-605.897) [-605.442] (-605.798) * (-604.987) (-607.140) (-606.813) [-606.528] -- 0:00:57
109000 -- (-606.510) (-605.110) [-603.694] (-607.883) * (-606.475) (-606.028) [-605.441] (-605.198) -- 0:00:57
109500 -- (-608.102) (-604.363) (-604.356) [-607.542] * [-607.140] (-605.652) (-607.878) (-605.436) -- 0:00:56
110000 -- (-607.358) (-605.787) [-604.277] (-604.904) * [-604.828] (-605.976) (-608.234) (-605.424) -- 0:00:56
Average standard deviation of split frequencies: 0.023540
110500 -- (-606.080) [-604.966] (-605.105) (-606.377) * [-604.784] (-604.798) (-606.924) (-604.381) -- 0:00:56
111000 -- (-607.942) (-604.482) [-604.848] (-611.371) * (-608.361) (-604.188) (-607.576) [-604.949] -- 0:00:56
111500 -- (-604.973) [-604.322] (-604.416) (-607.717) * (-609.332) [-606.666] (-610.711) (-604.731) -- 0:00:55
112000 -- (-604.242) (-612.183) [-603.709] (-608.507) * (-607.102) [-606.133] (-604.982) (-611.559) -- 0:00:55
112500 -- (-603.924) (-607.522) (-604.803) [-609.248] * (-606.349) [-606.937] (-604.038) (-605.684) -- 0:00:55
113000 -- (-605.762) (-608.018) (-605.896) [-607.721] * [-606.055] (-606.292) (-608.314) (-608.561) -- 0:00:54
113500 -- (-605.421) (-615.120) [-606.176] (-605.918) * [-605.556] (-604.537) (-605.539) (-606.518) -- 0:00:54
114000 -- (-607.134) (-612.882) (-608.675) [-605.559] * (-606.499) (-607.301) [-604.622] (-605.201) -- 0:00:54
114500 -- (-605.831) (-609.067) (-608.218) [-604.453] * (-605.073) (-604.945) [-608.919] (-604.475) -- 0:00:54
115000 -- (-605.728) (-605.084) [-606.380] (-604.092) * (-606.310) [-605.391] (-605.860) (-604.073) -- 0:00:53
Average standard deviation of split frequencies: 0.021900
115500 -- (-605.642) (-608.093) (-604.039) [-605.718] * [-603.624] (-605.155) (-604.232) (-605.867) -- 0:00:53
116000 -- (-604.670) (-605.444) (-608.588) [-608.641] * (-604.166) (-606.767) [-604.737] (-604.446) -- 0:00:53
116500 -- [-605.623] (-604.104) (-611.246) (-603.843) * [-605.825] (-604.180) (-606.052) (-605.159) -- 0:00:53
117000 -- (-605.802) (-604.226) (-605.472) [-603.820] * (-604.864) (-604.731) (-604.787) [-604.079] -- 0:00:52
117500 -- (-607.743) (-604.751) (-605.399) [-606.881] * [-606.570] (-607.917) (-604.248) (-605.600) -- 0:00:52
118000 -- (-610.167) [-603.616] (-604.839) (-604.383) * (-607.246) [-607.184] (-606.602) (-604.785) -- 0:00:52
118500 -- (-613.335) (-607.224) (-610.240) [-603.868] * (-609.267) (-605.975) [-605.593] (-605.566) -- 0:00:59
119000 -- (-609.244) (-606.522) (-607.900) [-604.485] * (-604.046) [-603.581] (-605.872) (-605.375) -- 0:00:59
119500 -- [-605.542] (-604.546) (-605.480) (-605.084) * [-603.966] (-607.209) (-607.120) (-605.691) -- 0:00:58
120000 -- [-606.250] (-604.675) (-606.231) (-612.649) * (-604.128) (-606.719) (-605.977) [-605.240] -- 0:00:58
Average standard deviation of split frequencies: 0.022412
120500 -- (-606.703) [-605.306] (-606.150) (-606.267) * (-605.774) (-608.061) (-609.028) [-605.138] -- 0:00:58
121000 -- [-606.940] (-604.996) (-605.521) (-606.661) * (-609.340) (-607.775) [-607.604] (-609.422) -- 0:00:58
121500 -- (-606.126) [-605.992] (-604.910) (-606.674) * (-609.062) (-607.620) (-604.865) [-604.615] -- 0:00:57
122000 -- (-605.256) (-605.137) [-607.559] (-605.652) * (-604.161) (-605.205) [-604.927] (-610.080) -- 0:00:57
122500 -- (-604.479) (-606.184) [-605.862] (-605.053) * (-607.452) [-606.550] (-603.784) (-608.450) -- 0:00:57
123000 -- (-604.054) (-606.756) [-604.552] (-605.745) * [-604.865] (-608.483) (-605.803) (-608.456) -- 0:00:57
123500 -- [-603.887] (-604.019) (-604.794) (-605.831) * (-606.798) [-604.317] (-605.532) (-609.625) -- 0:00:56
124000 -- [-607.208] (-603.949) (-605.573) (-606.009) * [-605.634] (-605.273) (-604.887) (-608.506) -- 0:00:56
124500 -- (-607.839) (-604.777) (-610.510) [-606.142] * (-605.087) [-604.142] (-604.340) (-608.236) -- 0:00:56
125000 -- [-604.996] (-606.821) (-611.495) (-606.430) * (-607.314) (-605.246) [-605.135] (-606.576) -- 0:00:56
Average standard deviation of split frequencies: 0.019888
125500 -- (-607.636) (-607.548) [-605.606] (-608.376) * (-605.456) [-604.333] (-604.897) (-606.064) -- 0:00:55
126000 -- (-603.969) (-604.860) [-606.762] (-605.901) * (-606.318) (-604.323) (-606.184) [-605.706] -- 0:00:55
126500 -- (-606.041) (-604.481) (-610.116) [-605.034] * [-605.593] (-606.130) (-609.595) (-605.178) -- 0:00:55
127000 -- (-609.607) (-604.731) (-607.263) [-606.893] * [-604.203] (-607.067) (-604.840) (-605.918) -- 0:00:54
127500 -- (-610.221) (-607.290) (-607.229) [-607.936] * (-603.801) (-605.768) [-605.318] (-606.670) -- 0:00:54
128000 -- (-605.864) (-605.726) [-607.887] (-613.735) * (-604.238) [-605.397] (-606.017) (-603.975) -- 0:00:54
128500 -- (-606.341) [-605.964] (-606.717) (-606.579) * (-606.075) (-608.534) [-606.568] (-605.048) -- 0:00:54
129000 -- [-603.988] (-608.284) (-605.814) (-606.663) * (-610.754) (-604.692) [-606.198] (-609.039) -- 0:00:54
129500 -- (-604.632) (-607.248) [-605.114] (-607.995) * (-609.497) [-606.395] (-603.628) (-607.442) -- 0:00:53
130000 -- (-604.902) [-607.370] (-606.263) (-603.909) * (-605.141) (-606.618) (-608.360) [-606.417] -- 0:00:53
Average standard deviation of split frequencies: 0.018439
130500 -- (-608.221) (-606.277) [-603.540] (-604.114) * (-607.109) (-605.967) (-604.954) [-605.929] -- 0:00:53
131000 -- (-604.933) [-605.100] (-608.778) (-606.707) * [-604.516] (-608.453) (-606.141) (-604.355) -- 0:00:53
131500 -- (-606.282) (-604.669) (-607.487) [-605.457] * [-604.413] (-609.964) (-606.513) (-605.238) -- 0:00:52
132000 -- (-608.586) (-604.861) [-604.272] (-604.051) * (-611.144) (-612.052) [-607.781] (-607.632) -- 0:00:52
132500 -- (-605.244) (-605.369) (-608.846) [-603.995] * (-607.847) (-605.786) [-606.297] (-606.373) -- 0:00:52
133000 -- (-609.892) (-604.603) (-603.846) [-604.956] * [-604.961] (-605.957) (-604.122) (-604.868) -- 0:00:52
133500 -- (-604.681) (-604.267) (-612.239) [-605.289] * [-606.436] (-603.865) (-603.945) (-604.298) -- 0:00:51
134000 -- [-604.223] (-605.025) (-606.151) (-604.797) * [-606.983] (-604.573) (-606.618) (-606.254) -- 0:00:51
134500 -- [-604.146] (-610.317) (-610.996) (-606.359) * (-613.063) [-605.199] (-605.995) (-608.329) -- 0:00:51
135000 -- (-603.916) (-606.054) [-605.208] (-606.924) * [-604.875] (-605.821) (-604.416) (-606.826) -- 0:00:51
Average standard deviation of split frequencies: 0.017716
135500 -- (-607.075) (-605.983) (-604.392) [-604.273] * [-606.066] (-607.072) (-604.853) (-608.841) -- 0:00:57
136000 -- (-606.571) [-605.074] (-603.924) (-604.793) * [-605.385] (-606.709) (-604.122) (-617.350) -- 0:00:57
136500 -- (-605.653) (-605.991) (-606.657) [-606.487] * (-605.483) (-608.558) (-604.666) [-606.495] -- 0:00:56
137000 -- (-607.139) (-604.164) (-604.987) [-607.893] * (-606.997) (-605.507) [-604.996] (-606.380) -- 0:00:56
137500 -- (-604.231) [-604.310] (-604.929) (-608.456) * (-606.446) [-607.812] (-606.840) (-608.102) -- 0:00:56
138000 -- [-604.256] (-604.799) (-604.225) (-607.794) * (-603.988) [-604.589] (-604.149) (-606.988) -- 0:00:56
138500 -- (-605.679) (-604.053) (-605.575) [-606.283] * (-604.032) (-606.613) [-604.645] (-605.737) -- 0:00:55
139000 -- (-609.109) (-604.682) [-605.215] (-604.760) * (-604.747) (-603.916) (-604.537) [-604.779] -- 0:00:55
139500 -- [-604.181] (-604.855) (-604.917) (-605.877) * (-604.144) [-607.640] (-606.105) (-608.334) -- 0:00:55
140000 -- (-604.947) (-604.592) [-606.807] (-604.529) * [-603.977] (-607.699) (-604.521) (-605.204) -- 0:00:55
Average standard deviation of split frequencies: 0.017501
140500 -- [-605.542] (-605.924) (-607.526) (-613.089) * (-607.629) [-607.310] (-606.881) (-604.954) -- 0:00:55
141000 -- (-606.141) (-605.605) (-605.057) [-607.752] * (-605.303) (-609.453) (-603.684) [-604.581] -- 0:00:54
141500 -- (-605.006) (-604.787) (-605.128) [-606.955] * (-606.383) (-611.186) (-603.702) [-607.410] -- 0:00:54
142000 -- (-604.918) (-607.886) [-605.367] (-605.262) * (-604.694) (-605.576) (-604.988) [-607.307] -- 0:00:54
142500 -- (-605.859) (-607.110) (-606.386) [-605.710] * (-606.380) (-606.781) (-605.156) [-604.186] -- 0:00:54
143000 -- (-605.492) (-607.084) (-606.899) [-604.366] * (-608.022) (-605.283) (-604.092) [-605.377] -- 0:00:53
143500 -- [-606.690] (-608.571) (-605.088) (-603.939) * [-606.497] (-605.798) (-604.772) (-605.757) -- 0:00:53
144000 -- (-606.763) (-606.254) [-604.958] (-604.509) * (-605.866) [-605.136] (-604.502) (-610.081) -- 0:00:53
144500 -- [-604.233] (-610.541) (-604.141) (-604.498) * [-606.408] (-604.994) (-606.286) (-609.260) -- 0:00:53
145000 -- (-603.722) (-607.292) [-605.691] (-607.632) * [-605.055] (-607.248) (-608.312) (-606.881) -- 0:00:53
Average standard deviation of split frequencies: 0.016503
145500 -- [-605.085] (-606.934) (-606.224) (-606.872) * (-604.756) [-604.985] (-604.410) (-605.892) -- 0:00:52
146000 -- (-604.187) (-606.260) (-605.474) [-603.936] * (-605.096) (-605.973) [-603.947] (-606.817) -- 0:00:52
146500 -- (-607.061) (-607.472) [-606.321] (-604.698) * [-605.386] (-605.988) (-604.540) (-604.262) -- 0:00:52
147000 -- (-604.410) (-604.099) (-604.185) [-604.134] * [-605.081] (-607.357) (-604.098) (-604.978) -- 0:00:52
147500 -- (-604.589) (-605.773) (-606.168) [-606.175] * [-608.881] (-605.364) (-604.457) (-606.983) -- 0:00:52
148000 -- (-607.810) (-605.550) (-605.999) [-605.499] * (-605.243) (-605.450) [-605.132] (-605.131) -- 0:00:51
148500 -- (-604.368) [-609.181] (-605.776) (-603.674) * [-605.450] (-606.018) (-605.588) (-607.866) -- 0:00:51
149000 -- (-604.747) (-609.417) (-606.485) [-605.717] * (-608.668) (-608.220) (-605.305) [-606.394] -- 0:00:51
149500 -- [-604.365] (-607.830) (-605.841) (-604.407) * (-609.179) (-609.294) [-605.700] (-606.592) -- 0:00:51
150000 -- (-608.408) [-603.576] (-603.837) (-607.996) * (-608.270) (-606.659) (-604.718) [-605.872] -- 0:00:51
Average standard deviation of split frequencies: 0.017556
150500 -- [-605.417] (-605.406) (-610.113) (-608.640) * [-605.003] (-606.729) (-607.651) (-604.583) -- 0:00:50
151000 -- (-606.781) [-604.753] (-612.402) (-606.668) * (-605.448) (-605.493) (-607.668) [-607.401] -- 0:00:50
151500 -- (-604.963) (-606.914) [-604.358] (-607.220) * (-607.324) (-605.874) (-607.523) [-607.604] -- 0:00:50
152000 -- (-605.743) (-607.174) [-606.006] (-604.992) * (-610.914) (-604.733) (-607.541) [-607.104] -- 0:00:55
152500 -- (-604.147) (-606.174) [-606.530] (-605.408) * (-614.199) (-607.107) [-603.879] (-611.944) -- 0:00:55
153000 -- (-604.684) (-605.690) (-605.507) [-605.455] * [-606.882] (-609.360) (-605.207) (-609.628) -- 0:00:55
153500 -- (-603.875) [-605.087] (-604.780) (-604.854) * [-604.177] (-605.576) (-609.381) (-605.136) -- 0:00:55
154000 -- [-606.071] (-604.317) (-604.415) (-606.035) * (-604.739) (-604.490) [-607.110] (-605.242) -- 0:00:54
154500 -- (-606.789) (-607.339) [-604.716] (-609.561) * (-607.957) (-605.870) [-606.068] (-606.011) -- 0:00:54
155000 -- (-607.080) (-606.567) (-604.018) [-607.140] * (-612.330) (-605.760) (-605.267) [-607.489] -- 0:00:54
Average standard deviation of split frequencies: 0.017627
155500 -- (-605.464) (-606.380) (-608.324) [-605.634] * [-604.650] (-604.122) (-606.012) (-604.741) -- 0:00:54
156000 -- [-603.580] (-608.534) (-607.097) (-606.756) * [-603.722] (-604.942) (-609.628) (-606.373) -- 0:00:54
156500 -- (-603.854) (-605.815) [-606.242] (-612.347) * (-604.496) (-605.539) (-606.929) [-604.691] -- 0:00:53
157000 -- (-604.405) (-608.001) (-604.704) [-606.138] * (-603.840) (-607.191) (-606.204) [-605.989] -- 0:00:53
157500 -- (-605.199) (-607.192) (-605.592) [-604.653] * (-603.954) (-605.178) [-603.951] (-607.914) -- 0:00:53
158000 -- [-603.555] (-605.715) (-606.133) (-605.385) * [-605.647] (-603.590) (-603.763) (-607.430) -- 0:00:53
158500 -- (-606.087) (-604.321) (-604.145) [-606.769] * (-608.247) (-604.874) (-605.850) [-603.389] -- 0:00:53
159000 -- [-604.992] (-607.504) (-605.060) (-606.050) * [-608.147] (-607.226) (-609.229) (-605.049) -- 0:00:52
159500 -- (-609.933) (-607.277) (-607.944) [-604.790] * (-606.344) (-604.741) (-609.450) [-604.609] -- 0:00:52
160000 -- (-607.073) (-609.837) [-603.680] (-605.996) * (-605.736) (-606.243) [-607.317] (-604.314) -- 0:00:52
Average standard deviation of split frequencies: 0.019071
160500 -- (-608.593) (-606.074) [-606.220] (-607.767) * [-605.247] (-604.122) (-607.851) (-607.207) -- 0:00:52
161000 -- (-604.490) (-605.008) (-605.339) [-605.267] * [-605.138] (-604.239) (-605.055) (-606.830) -- 0:00:52
161500 -- (-606.555) [-603.679] (-606.948) (-604.686) * (-604.393) (-607.565) [-605.018] (-604.815) -- 0:00:51
162000 -- (-604.932) [-604.361] (-605.231) (-605.762) * [-610.814] (-605.791) (-605.362) (-606.927) -- 0:00:51
162500 -- (-605.258) [-604.752] (-605.927) (-605.253) * (-605.441) [-605.299] (-605.023) (-607.951) -- 0:00:51
163000 -- (-604.370) [-605.522] (-604.357) (-605.495) * (-603.673) [-605.447] (-605.092) (-604.341) -- 0:00:51
163500 -- (-605.076) [-606.483] (-605.395) (-610.537) * (-607.898) (-605.692) [-605.325] (-605.908) -- 0:00:51
164000 -- (-604.482) (-604.382) [-608.995] (-609.750) * (-609.653) (-605.005) [-604.389] (-606.488) -- 0:00:50
164500 -- (-604.523) (-605.210) [-605.308] (-610.207) * (-607.835) [-607.817] (-606.468) (-607.102) -- 0:00:50
165000 -- (-606.283) (-605.510) (-609.348) [-607.314] * (-607.761) [-604.193] (-605.916) (-609.039) -- 0:00:50
Average standard deviation of split frequencies: 0.017828
165500 -- (-607.016) (-605.431) (-608.274) [-609.598] * (-604.568) (-604.197) [-605.076] (-604.618) -- 0:00:50
166000 -- (-606.384) (-606.149) (-609.235) [-609.052] * (-605.812) (-605.474) (-605.549) [-604.389] -- 0:00:50
166500 -- (-606.667) [-604.175] (-606.192) (-607.350) * (-603.723) (-607.699) (-607.298) [-606.082] -- 0:00:50
167000 -- (-604.567) (-603.616) [-605.897] (-608.976) * [-608.056] (-604.775) (-604.508) (-606.364) -- 0:00:49
167500 -- (-611.292) [-606.285] (-607.205) (-605.115) * (-609.909) (-610.853) [-604.436] (-605.697) -- 0:00:49
168000 -- (-604.831) (-605.727) (-607.628) [-605.686] * (-608.243) (-610.121) (-606.155) [-607.280] -- 0:00:49
168500 -- (-608.120) (-608.374) (-607.344) [-605.929] * [-604.789] (-606.704) (-604.845) (-607.031) -- 0:00:49
169000 -- (-603.691) [-608.285] (-605.299) (-605.959) * (-604.099) (-606.087) (-607.822) [-605.303] -- 0:00:54
169500 -- [-603.650] (-611.189) (-604.868) (-616.952) * (-603.871) [-604.910] (-606.191) (-607.437) -- 0:00:53
170000 -- (-604.125) [-606.914] (-604.638) (-612.287) * (-604.198) [-604.319] (-604.812) (-609.494) -- 0:00:53
Average standard deviation of split frequencies: 0.016137
170500 -- (-604.214) [-605.622] (-604.351) (-610.100) * (-604.156) (-604.618) (-608.862) [-605.151] -- 0:00:53
171000 -- [-607.794] (-605.281) (-603.956) (-604.671) * (-606.368) (-604.064) (-606.652) [-607.675] -- 0:00:53
171500 -- (-606.054) [-607.197] (-606.364) (-604.518) * (-606.369) [-604.064] (-609.361) (-605.064) -- 0:00:53
172000 -- (-604.847) [-604.198] (-605.308) (-606.169) * (-606.406) [-604.763] (-609.234) (-616.429) -- 0:00:52
172500 -- (-606.525) [-603.897] (-604.942) (-608.613) * (-605.879) [-604.945] (-613.157) (-604.512) -- 0:00:52
173000 -- (-604.722) (-604.286) (-605.318) [-607.066] * [-604.388] (-604.502) (-607.970) (-603.748) -- 0:00:52
173500 -- (-604.849) (-604.434) (-605.300) [-606.183] * [-606.303] (-606.645) (-610.631) (-603.977) -- 0:00:52
174000 -- (-604.716) (-605.363) [-605.550] (-606.346) * (-606.565) (-608.440) (-607.444) [-604.080] -- 0:00:52
174500 -- (-606.143) (-605.769) [-604.535] (-604.492) * (-604.898) (-605.472) (-603.866) [-605.375] -- 0:00:52
175000 -- (-611.194) (-604.273) [-604.717] (-606.434) * (-604.923) (-610.820) (-605.391) [-605.454] -- 0:00:51
Average standard deviation of split frequencies: 0.014802
175500 -- (-607.960) [-604.231] (-606.745) (-604.523) * [-604.665] (-606.197) (-605.331) (-608.498) -- 0:00:51
176000 -- [-605.352] (-604.897) (-605.313) (-608.782) * (-607.084) [-606.257] (-605.574) (-608.699) -- 0:00:51
176500 -- (-605.126) [-606.004] (-607.508) (-604.598) * (-609.028) (-606.826) (-607.803) [-607.292] -- 0:00:51
177000 -- (-605.319) [-607.256] (-605.982) (-606.869) * (-607.906) (-607.197) (-610.110) [-606.176] -- 0:00:51
177500 -- (-605.770) (-605.788) (-605.090) [-604.247] * (-607.000) (-603.916) [-604.255] (-605.057) -- 0:00:50
178000 -- (-604.381) [-607.265] (-609.502) (-607.098) * (-603.996) (-607.954) (-606.913) [-604.264] -- 0:00:50
178500 -- [-609.916] (-607.200) (-607.128) (-606.123) * (-609.735) (-605.121) [-609.002] (-603.985) -- 0:00:50
179000 -- (-604.289) [-605.791] (-607.295) (-606.621) * (-607.215) (-605.760) [-603.909] (-604.600) -- 0:00:50
179500 -- (-604.578) (-610.370) (-606.106) [-607.234] * [-605.269] (-607.299) (-603.914) (-606.154) -- 0:00:50
180000 -- (-607.256) [-605.964] (-607.414) (-604.620) * (-610.355) [-606.092] (-605.716) (-607.323) -- 0:00:50
Average standard deviation of split frequencies: 0.014351
180500 -- [-606.282] (-606.772) (-609.513) (-604.916) * [-605.408] (-604.753) (-604.885) (-604.065) -- 0:00:49
181000 -- (-604.784) [-607.168] (-606.423) (-606.059) * (-605.909) (-604.770) [-604.312] (-604.083) -- 0:00:49
181500 -- (-603.889) [-605.580] (-608.966) (-606.129) * (-604.600) (-607.362) [-608.409] (-604.536) -- 0:00:49
182000 -- (-605.516) (-603.733) [-604.186] (-604.985) * [-604.411] (-605.559) (-606.443) (-608.938) -- 0:00:49
182500 -- (-604.688) (-606.384) [-604.538] (-605.500) * (-603.948) [-603.762] (-606.801) (-605.295) -- 0:00:49
183000 -- (-604.364) (-605.169) (-606.071) [-604.633] * (-605.432) [-606.401] (-607.236) (-606.246) -- 0:00:49
183500 -- (-605.466) (-605.396) [-605.460] (-604.581) * (-609.669) [-606.734] (-610.273) (-605.588) -- 0:00:48
184000 -- (-603.895) (-604.552) (-603.675) [-605.688] * [-605.194] (-605.423) (-607.929) (-608.549) -- 0:00:48
184500 -- [-606.079] (-604.543) (-605.952) (-607.919) * [-605.694] (-605.357) (-608.746) (-608.930) -- 0:00:48
185000 -- (-604.443) (-604.046) [-605.823] (-610.235) * (-604.714) (-605.364) [-606.332] (-604.745) -- 0:00:48
Average standard deviation of split frequencies: 0.015740
185500 -- (-604.987) (-605.725) (-607.184) [-607.110] * (-606.532) [-605.335] (-604.990) (-605.647) -- 0:00:52
186000 -- (-611.822) (-604.858) (-607.507) [-605.412] * (-605.423) (-605.485) (-606.981) [-606.300] -- 0:00:52
186500 -- [-605.380] (-604.562) (-606.124) (-606.097) * [-606.297] (-608.122) (-604.123) (-606.629) -- 0:00:52
187000 -- [-605.899] (-607.480) (-608.293) (-607.050) * (-608.390) (-608.202) (-605.669) [-605.830] -- 0:00:52
187500 -- (-610.302) (-605.646) [-604.789] (-612.912) * [-604.550] (-605.782) (-609.421) (-609.052) -- 0:00:52
188000 -- (-607.017) [-607.847] (-607.803) (-609.471) * (-606.360) (-608.174) [-604.439] (-607.728) -- 0:00:51
188500 -- (-606.743) (-610.782) (-604.574) [-606.651] * [-605.570] (-608.391) (-606.294) (-604.988) -- 0:00:51
189000 -- (-606.986) (-608.080) (-606.645) [-605.770] * (-606.871) (-603.741) (-609.644) [-606.616] -- 0:00:51
189500 -- [-605.815] (-605.410) (-606.607) (-605.903) * (-604.574) (-605.479) (-607.185) [-605.191] -- 0:00:51
190000 -- (-604.022) (-606.394) [-604.170] (-604.632) * [-605.915] (-607.759) (-604.573) (-605.268) -- 0:00:51
Average standard deviation of split frequencies: 0.015225
190500 -- (-604.635) [-605.287] (-604.070) (-605.212) * (-606.793) (-605.858) (-607.783) [-604.447] -- 0:00:50
191000 -- (-607.036) (-605.597) [-605.970] (-606.672) * (-605.661) (-603.854) (-612.417) [-604.374] -- 0:00:50
191500 -- (-607.847) [-605.299] (-604.257) (-605.774) * (-606.781) [-604.929] (-609.782) (-605.894) -- 0:00:50
192000 -- (-608.750) [-605.314] (-604.776) (-608.859) * [-605.318] (-604.499) (-609.299) (-604.551) -- 0:00:50
192500 -- (-607.936) (-605.756) (-603.709) [-606.630] * [-603.600] (-603.780) (-604.782) (-607.966) -- 0:00:50
193000 -- (-605.103) (-607.036) [-606.234] (-605.229) * (-604.992) (-605.760) (-605.155) [-606.561] -- 0:00:50
193500 -- (-604.726) (-607.577) [-605.295] (-604.912) * [-604.499] (-605.754) (-604.464) (-605.888) -- 0:00:50
194000 -- [-605.571] (-606.496) (-607.039) (-605.768) * (-604.369) (-605.716) (-606.186) [-605.345] -- 0:00:49
194500 -- [-605.164] (-608.594) (-603.978) (-604.204) * (-604.485) (-606.420) [-604.590] (-606.270) -- 0:00:49
195000 -- (-607.018) [-605.502] (-607.523) (-606.234) * (-606.459) (-610.212) (-604.148) [-605.800] -- 0:00:49
Average standard deviation of split frequencies: 0.015366
195500 -- (-607.822) [-608.580] (-603.865) (-605.825) * (-605.715) (-607.089) (-604.856) [-606.667] -- 0:00:49
196000 -- (-604.430) (-606.473) [-603.637] (-609.435) * [-606.052] (-605.238) (-605.115) (-606.793) -- 0:00:49
196500 -- (-605.480) (-610.063) (-605.087) [-604.411] * (-607.199) [-604.405] (-606.731) (-608.440) -- 0:00:49
197000 -- [-609.127] (-606.486) (-605.607) (-605.609) * (-606.417) [-605.988] (-605.695) (-607.797) -- 0:00:48
197500 -- (-604.374) (-605.634) (-606.240) [-605.443] * (-604.409) (-607.216) (-605.325) [-606.923] -- 0:00:48
198000 -- (-610.641) (-605.138) (-605.748) [-604.268] * (-605.493) (-609.422) [-605.891] (-608.556) -- 0:00:48
198500 -- (-607.914) [-607.955] (-604.405) (-607.005) * (-610.409) (-607.609) (-605.562) [-607.350] -- 0:00:48
199000 -- [-609.387] (-606.816) (-604.660) (-605.948) * (-610.509) (-611.488) (-606.296) [-604.469] -- 0:00:48
199500 -- (-605.147) (-606.578) (-608.347) [-606.391] * [-608.028] (-604.119) (-604.273) (-605.313) -- 0:00:48
200000 -- (-605.626) [-611.328] (-604.944) (-607.448) * [-610.866] (-607.264) (-606.732) (-608.524) -- 0:00:48
Average standard deviation of split frequencies: 0.016815
200500 -- (-608.607) [-606.588] (-606.244) (-608.803) * (-609.052) (-607.417) [-604.956] (-609.136) -- 0:00:47
201000 -- [-605.355] (-604.733) (-605.056) (-605.990) * (-605.249) [-604.540] (-604.307) (-611.332) -- 0:00:47
201500 -- [-605.019] (-606.069) (-606.623) (-604.149) * [-607.145] (-603.901) (-604.229) (-609.788) -- 0:00:47
202000 -- [-604.009] (-605.025) (-604.949) (-604.987) * (-612.020) (-605.766) [-603.832] (-609.076) -- 0:00:47
202500 -- [-607.444] (-604.855) (-603.399) (-607.600) * (-606.050) (-603.953) [-603.711] (-607.592) -- 0:00:51
203000 -- (-605.170) [-603.743] (-605.490) (-607.203) * (-606.120) (-604.931) (-608.037) [-605.379] -- 0:00:51
203500 -- (-605.977) (-607.445) (-606.802) [-605.415] * (-607.726) [-606.928] (-604.489) (-605.346) -- 0:00:50
204000 -- (-610.502) (-605.892) [-605.577] (-605.152) * (-608.178) (-603.884) (-605.103) [-604.100] -- 0:00:50
204500 -- (-606.237) (-605.839) (-606.635) [-604.497] * (-603.907) (-604.269) [-606.389] (-607.174) -- 0:00:50
205000 -- (-606.007) [-606.965] (-608.936) (-605.448) * (-610.489) [-606.753] (-607.562) (-609.248) -- 0:00:50
Average standard deviation of split frequencies: 0.016862
205500 -- (-606.036) [-609.444] (-605.169) (-604.734) * [-608.226] (-605.274) (-604.809) (-605.951) -- 0:00:50
206000 -- [-604.850] (-605.136) (-606.621) (-605.914) * [-605.968] (-605.767) (-607.351) (-605.004) -- 0:00:50
206500 -- (-603.758) (-608.138) (-608.308) [-608.136] * [-606.256] (-607.485) (-607.053) (-606.330) -- 0:00:49
207000 -- (-608.018) (-605.414) (-605.839) [-604.774] * (-605.324) (-605.148) [-604.169] (-607.525) -- 0:00:49
207500 -- (-605.622) (-606.436) [-606.338] (-605.722) * [-606.273] (-604.209) (-604.217) (-604.639) -- 0:00:49
208000 -- (-606.068) (-607.181) [-606.474] (-605.293) * (-605.155) (-604.012) (-605.732) [-608.568] -- 0:00:49
208500 -- (-609.363) [-607.026] (-604.108) (-610.203) * [-604.837] (-611.411) (-605.009) (-608.900) -- 0:00:49
209000 -- (-606.056) (-606.149) (-607.710) [-605.060] * (-607.506) [-603.903] (-606.358) (-606.884) -- 0:00:49
209500 -- (-609.331) (-606.209) [-605.751] (-607.419) * (-605.935) (-607.905) [-605.919] (-604.921) -- 0:00:49
210000 -- (-607.829) (-604.734) [-605.317] (-606.953) * [-604.843] (-608.018) (-605.070) (-604.304) -- 0:00:48
Average standard deviation of split frequencies: 0.016135
210500 -- (-608.420) (-604.450) (-605.705) [-604.830] * [-605.734] (-605.045) (-604.297) (-604.526) -- 0:00:48
211000 -- [-608.834] (-605.835) (-605.814) (-606.579) * (-605.184) (-605.245) (-613.683) [-605.635] -- 0:00:48
211500 -- [-606.197] (-605.295) (-604.269) (-609.434) * [-605.816] (-607.599) (-606.068) (-605.875) -- 0:00:48
212000 -- [-606.515] (-606.842) (-604.105) (-607.286) * (-605.043) (-607.523) (-605.428) [-607.365] -- 0:00:48
212500 -- [-605.689] (-606.091) (-603.665) (-607.381) * (-604.970) (-607.304) [-608.146] (-604.964) -- 0:00:48
213000 -- [-607.564] (-605.400) (-614.126) (-604.239) * (-604.894) (-605.883) (-606.255) [-604.892] -- 0:00:48
213500 -- (-607.239) (-604.168) (-610.209) [-605.587] * [-607.692] (-608.982) (-607.191) (-605.200) -- 0:00:47
214000 -- (-605.811) (-604.218) [-605.608] (-604.487) * (-608.154) (-609.334) [-608.828] (-605.704) -- 0:00:47
214500 -- (-606.928) (-603.924) [-606.251] (-605.753) * [-605.639] (-606.720) (-604.245) (-605.226) -- 0:00:47
215000 -- (-604.149) (-604.705) [-604.187] (-609.731) * (-605.024) (-607.803) [-604.181] (-604.317) -- 0:00:47
Average standard deviation of split frequencies: 0.016247
215500 -- (-605.863) (-604.689) [-610.457] (-608.417) * (-606.880) (-605.966) [-606.451] (-604.036) -- 0:00:47
216000 -- [-605.368] (-605.154) (-604.751) (-606.743) * (-604.889) (-608.266) (-606.462) [-606.843] -- 0:00:47
216500 -- (-606.682) (-607.743) [-604.881] (-605.058) * (-607.070) (-606.323) [-605.483] (-608.756) -- 0:00:47
217000 -- [-606.471] (-607.267) (-614.171) (-606.180) * (-604.451) [-604.767] (-607.899) (-605.837) -- 0:00:46
217500 -- [-604.779] (-607.225) (-613.680) (-606.195) * (-605.581) (-607.144) (-603.854) [-603.664] -- 0:00:46
218000 -- [-604.910] (-607.810) (-610.330) (-608.692) * (-605.089) [-604.876] (-603.977) (-606.280) -- 0:00:46
218500 -- [-607.642] (-609.468) (-607.588) (-605.932) * (-606.403) [-604.869] (-609.646) (-604.992) -- 0:00:46
219000 -- (-604.742) (-606.019) [-607.437] (-607.904) * (-606.537) (-605.711) (-609.096) [-605.790] -- 0:00:49
219500 -- [-606.424] (-606.362) (-606.868) (-605.894) * (-609.953) [-605.319] (-606.498) (-605.413) -- 0:00:49
220000 -- (-607.812) (-604.305) [-606.812] (-609.104) * (-603.903) (-613.598) (-606.337) [-605.923] -- 0:00:49
Average standard deviation of split frequencies: 0.016615
220500 -- (-607.833) (-603.779) (-604.728) [-606.247] * [-607.524] (-604.866) (-603.847) (-605.234) -- 0:00:49
221000 -- (-604.695) [-606.184] (-609.462) (-606.313) * (-606.432) (-609.292) (-605.075) [-606.584] -- 0:00:49
221500 -- [-609.054] (-605.030) (-604.999) (-604.595) * (-605.404) (-611.421) (-606.383) [-605.158] -- 0:00:49
222000 -- [-603.759] (-604.178) (-606.515) (-606.333) * (-604.094) (-605.420) (-606.265) [-604.986] -- 0:00:49
222500 -- (-604.987) (-604.985) [-606.409] (-607.098) * (-605.165) (-606.005) [-604.332] (-609.696) -- 0:00:48
223000 -- [-606.151] (-609.836) (-605.979) (-605.972) * (-606.785) [-605.148] (-606.587) (-606.900) -- 0:00:48
223500 -- (-605.376) (-606.606) (-604.507) [-605.469] * [-606.460] (-608.077) (-606.644) (-608.532) -- 0:00:48
224000 -- [-609.357] (-605.805) (-604.588) (-603.897) * (-606.613) (-606.547) (-605.753) [-605.692] -- 0:00:48
224500 -- (-610.644) (-606.893) (-603.892) [-604.172] * (-604.746) (-605.398) [-605.402] (-605.318) -- 0:00:48
225000 -- (-606.298) (-605.296) (-605.481) [-604.862] * (-607.826) (-607.333) (-604.890) [-603.801] -- 0:00:48
Average standard deviation of split frequencies: 0.016358
225500 -- [-607.468] (-606.282) (-603.534) (-605.654) * (-608.023) (-609.911) (-607.345) [-603.999] -- 0:00:48
226000 -- (-606.318) (-604.555) [-604.112] (-604.515) * (-609.087) (-608.551) (-604.331) [-604.797] -- 0:00:47
226500 -- (-605.616) (-605.918) (-604.599) [-603.849] * (-603.695) (-608.173) [-606.321] (-605.474) -- 0:00:47
227000 -- (-610.983) [-604.319] (-605.648) (-605.208) * (-607.877) (-608.260) [-605.136] (-605.969) -- 0:00:47
227500 -- [-607.341] (-606.346) (-604.340) (-607.068) * (-605.190) (-605.277) (-608.931) [-606.314] -- 0:00:47
228000 -- (-607.947) (-607.421) [-603.749] (-607.714) * (-604.334) [-607.156] (-608.062) (-606.606) -- 0:00:47
228500 -- [-605.070] (-607.133) (-604.613) (-607.924) * (-604.256) (-604.220) (-607.468) [-606.449] -- 0:00:47
229000 -- (-607.876) (-606.104) [-604.618] (-608.495) * (-605.786) (-609.912) (-606.293) [-604.715] -- 0:00:47
229500 -- [-605.891] (-607.650) (-605.447) (-606.548) * (-607.195) (-605.932) [-607.122] (-606.658) -- 0:00:47
230000 -- (-607.340) (-606.929) [-605.749] (-612.009) * (-604.162) (-605.934) (-604.790) [-606.323] -- 0:00:46
Average standard deviation of split frequencies: 0.016803
230500 -- [-608.204] (-605.040) (-604.726) (-605.430) * (-608.504) (-605.902) (-605.185) [-606.257] -- 0:00:46
231000 -- (-611.903) [-604.659] (-607.375) (-606.894) * (-605.276) [-605.501] (-604.072) (-608.083) -- 0:00:46
231500 -- (-604.509) (-606.506) [-605.754] (-609.049) * (-606.901) (-607.223) (-603.882) [-606.137] -- 0:00:46
232000 -- [-605.043] (-607.676) (-604.689) (-605.261) * (-607.221) (-607.287) [-608.347] (-606.472) -- 0:00:46
232500 -- [-606.547] (-605.071) (-604.254) (-603.552) * (-605.326) (-608.570) (-604.919) [-605.970] -- 0:00:46
233000 -- (-609.187) [-606.002] (-604.607) (-604.103) * (-606.993) (-606.706) [-604.952] (-604.172) -- 0:00:46
233500 -- (-604.939) (-607.127) (-604.512) [-604.533] * (-607.207) (-607.571) [-604.852] (-605.310) -- 0:00:45
234000 -- (-604.854) (-604.442) [-604.645] (-605.243) * (-608.863) (-608.737) [-604.762] (-607.916) -- 0:00:45
234500 -- (-605.410) (-604.805) (-606.447) [-603.510] * (-607.808) (-606.733) [-604.206] (-606.290) -- 0:00:45
235000 -- (-604.530) (-604.552) [-607.132] (-603.787) * (-608.475) (-606.733) [-604.115] (-608.182) -- 0:00:48
Average standard deviation of split frequencies: 0.016868
235500 -- (-607.855) (-604.883) (-604.601) [-604.486] * (-604.503) (-605.522) [-603.776] (-605.501) -- 0:00:48
236000 -- [-604.506] (-605.057) (-604.614) (-610.156) * (-604.999) (-604.201) [-604.119] (-609.914) -- 0:00:48
236500 -- [-606.901] (-607.256) (-605.835) (-605.182) * (-604.201) [-605.459] (-608.979) (-606.390) -- 0:00:48
237000 -- (-606.003) (-605.639) [-604.225] (-604.483) * (-608.024) (-606.022) (-608.637) [-605.167] -- 0:00:48
237500 -- (-605.062) (-605.808) (-610.264) [-606.007] * (-605.856) (-605.991) [-605.071] (-606.219) -- 0:00:48
238000 -- (-607.032) (-604.860) (-609.833) [-605.799] * (-604.432) (-607.118) (-607.822) [-607.477] -- 0:00:48
238500 -- [-603.875] (-607.354) (-608.284) (-604.784) * [-605.311] (-606.698) (-608.833) (-605.130) -- 0:00:47
239000 -- (-607.192) (-605.283) [-604.671] (-603.988) * (-605.849) (-603.883) (-605.379) [-603.758] -- 0:00:47
239500 -- [-606.000] (-604.572) (-605.130) (-604.777) * [-605.006] (-604.230) (-605.911) (-606.309) -- 0:00:47
240000 -- (-603.809) [-604.212] (-605.828) (-604.177) * (-604.404) (-604.367) (-605.411) [-605.384] -- 0:00:47
Average standard deviation of split frequencies: 0.016649
240500 -- [-607.752] (-606.634) (-605.542) (-607.195) * (-604.056) (-608.370) [-604.451] (-604.856) -- 0:00:47
241000 -- (-604.375) (-607.032) (-607.502) [-604.792] * (-604.145) [-605.504] (-609.321) (-604.095) -- 0:00:47
241500 -- [-604.612] (-605.143) (-604.588) (-607.162) * (-606.633) [-605.124] (-606.700) (-605.438) -- 0:00:47
242000 -- (-606.298) (-605.146) (-607.117) [-605.577] * (-612.025) (-606.493) (-610.430) [-605.455] -- 0:00:46
242500 -- (-606.762) (-612.776) (-604.760) [-605.593] * [-605.086] (-609.826) (-604.393) (-606.414) -- 0:00:46
243000 -- [-606.239] (-603.632) (-604.262) (-604.388) * (-606.658) [-607.474] (-605.751) (-604.509) -- 0:00:46
243500 -- (-604.342) [-605.152] (-604.276) (-605.504) * (-605.736) [-607.008] (-605.934) (-607.371) -- 0:00:46
244000 -- [-606.055] (-604.596) (-604.895) (-607.138) * (-604.183) (-604.877) (-604.766) [-604.956] -- 0:00:46
244500 -- (-605.328) (-607.599) [-605.744] (-605.443) * (-610.545) [-606.437] (-605.281) (-606.767) -- 0:00:46
245000 -- (-604.136) [-604.565] (-608.285) (-605.337) * (-606.993) [-605.742] (-609.574) (-604.916) -- 0:00:46
Average standard deviation of split frequencies: 0.016641
245500 -- (-607.754) [-604.428] (-608.533) (-607.070) * (-607.438) (-604.081) (-608.159) [-604.815] -- 0:00:46
246000 -- (-607.951) (-605.064) [-606.536] (-607.174) * (-606.236) (-606.524) (-606.082) [-604.574] -- 0:00:45
246500 -- [-608.197] (-607.459) (-607.651) (-608.103) * (-605.306) [-606.201] (-605.834) (-606.389) -- 0:00:45
247000 -- (-608.299) (-604.452) (-605.022) [-605.052] * (-606.636) (-604.911) [-609.156] (-604.511) -- 0:00:45
247500 -- (-603.664) [-606.219] (-605.730) (-605.434) * (-608.029) [-604.685] (-606.715) (-605.132) -- 0:00:45
248000 -- (-604.611) (-605.860) [-607.141] (-605.464) * (-605.210) (-605.365) [-609.628] (-604.703) -- 0:00:45
248500 -- (-605.588) (-605.998) (-605.395) [-605.872] * (-605.690) [-604.665] (-610.039) (-606.493) -- 0:00:45
249000 -- (-606.718) (-604.836) [-605.288] (-604.144) * (-604.978) (-605.156) (-607.116) [-606.353] -- 0:00:45
249500 -- [-606.605] (-604.782) (-605.909) (-608.476) * (-606.230) (-606.529) [-606.261] (-608.864) -- 0:00:45
250000 -- (-605.247) [-605.821] (-605.929) (-606.200) * (-605.889) (-609.608) [-605.812] (-608.167) -- 0:00:45
Average standard deviation of split frequencies: 0.016431
250500 -- (-605.101) (-608.115) (-604.809) [-607.019] * [-606.799] (-605.375) (-608.153) (-607.269) -- 0:00:44
251000 -- [-607.107] (-606.629) (-604.531) (-608.099) * (-607.355) (-606.028) (-604.380) [-604.468] -- 0:00:47
251500 -- (-606.025) [-605.915] (-607.802) (-610.565) * (-604.989) (-604.235) [-604.693] (-604.541) -- 0:00:47
252000 -- (-608.276) (-604.430) (-608.502) [-604.736] * (-606.994) (-604.572) (-606.990) [-605.165] -- 0:00:47
252500 -- (-604.482) [-604.564] (-604.497) (-604.886) * [-608.245] (-603.944) (-603.895) (-605.494) -- 0:00:47
253000 -- [-606.606] (-606.789) (-604.463) (-604.117) * (-604.824) (-605.031) [-604.449] (-606.983) -- 0:00:47
253500 -- [-604.298] (-607.366) (-603.900) (-606.311) * (-604.611) (-605.868) [-603.724] (-608.054) -- 0:00:47
254000 -- (-607.013) (-607.800) (-605.025) [-605.372] * (-606.218) [-604.623] (-607.680) (-611.500) -- 0:00:46
254500 -- (-606.050) (-607.075) (-606.398) [-607.293] * [-606.511] (-606.235) (-607.184) (-608.870) -- 0:00:46
255000 -- [-606.385] (-604.881) (-605.377) (-605.910) * (-605.990) (-608.828) [-605.741] (-607.150) -- 0:00:46
Average standard deviation of split frequencies: 0.017251
255500 -- [-606.624] (-604.741) (-607.143) (-605.791) * (-605.141) [-603.831] (-605.909) (-605.917) -- 0:00:46
256000 -- (-606.463) (-603.750) [-604.779] (-608.265) * (-604.183) [-608.636] (-603.891) (-605.686) -- 0:00:46
256500 -- (-606.524) (-605.180) [-606.599] (-609.043) * [-604.344] (-608.409) (-609.238) (-604.058) -- 0:00:46
257000 -- [-605.358] (-609.330) (-607.294) (-604.645) * (-603.985) [-605.897] (-608.003) (-605.152) -- 0:00:46
257500 -- (-605.937) [-606.979] (-606.335) (-608.188) * (-603.922) (-605.574) [-604.655] (-606.108) -- 0:00:46
258000 -- [-606.132] (-605.146) (-607.238) (-605.232) * (-604.997) (-606.001) [-605.035] (-606.080) -- 0:00:46
258500 -- (-605.642) (-604.781) (-603.957) [-605.921] * (-605.937) [-606.565] (-604.302) (-605.982) -- 0:00:45
259000 -- (-604.230) (-607.528) (-605.953) [-603.753] * (-605.286) (-610.575) [-603.929] (-604.982) -- 0:00:45
259500 -- (-605.401) (-604.686) [-605.647] (-605.364) * (-604.748) (-609.746) (-607.309) [-605.553] -- 0:00:45
260000 -- (-607.622) (-608.933) (-603.973) [-605.448] * (-607.299) (-605.449) (-608.560) [-606.870] -- 0:00:45
Average standard deviation of split frequencies: 0.016181
260500 -- (-606.937) (-610.509) [-603.819] (-607.523) * (-604.857) (-606.248) (-605.855) [-604.234] -- 0:00:45
261000 -- (-607.724) (-606.018) (-605.985) [-603.797] * (-604.964) (-606.924) (-603.671) [-603.621] -- 0:00:45
261500 -- [-605.091] (-606.764) (-605.432) (-603.942) * [-603.807] (-608.560) (-604.092) (-604.229) -- 0:00:45
262000 -- (-609.013) (-604.665) (-609.057) [-604.424] * [-606.049] (-605.399) (-605.663) (-605.486) -- 0:00:45
262500 -- (-607.504) [-603.765] (-613.292) (-605.694) * [-606.959] (-605.097) (-603.995) (-604.642) -- 0:00:44
263000 -- [-605.074] (-604.939) (-609.764) (-609.049) * [-605.039] (-607.654) (-604.000) (-606.376) -- 0:00:44
263500 -- (-604.778) (-605.159) [-604.529] (-609.592) * (-606.076) (-608.492) [-605.174] (-610.056) -- 0:00:44
264000 -- (-603.840) (-604.476) [-605.989] (-614.324) * [-605.855] (-609.353) (-605.124) (-610.455) -- 0:00:44
264500 -- [-603.945] (-604.919) (-606.064) (-608.881) * (-604.371) (-606.635) [-603.691] (-605.138) -- 0:00:44
265000 -- (-606.354) [-605.808] (-604.396) (-610.594) * (-604.327) (-606.017) (-605.529) [-606.593] -- 0:00:44
Average standard deviation of split frequencies: 0.016147
265500 -- (-605.081) (-605.701) (-604.614) [-606.518] * [-604.679] (-607.031) (-611.822) (-603.994) -- 0:00:44
266000 -- (-605.817) (-604.742) [-604.226] (-605.375) * (-604.627) (-606.694) (-608.418) [-604.814] -- 0:00:44
266500 -- (-604.628) (-604.365) (-604.226) [-604.214] * [-603.562] (-604.963) (-603.933) (-607.747) -- 0:00:44
267000 -- [-604.409] (-607.530) (-605.492) (-605.363) * [-605.313] (-604.655) (-605.415) (-607.525) -- 0:00:43
267500 -- (-604.144) (-605.933) [-606.377] (-605.849) * (-604.696) (-606.799) [-605.105] (-606.512) -- 0:00:43
268000 -- [-605.227] (-605.839) (-607.081) (-605.218) * (-604.577) (-605.294) (-604.969) [-607.597] -- 0:00:46
268500 -- (-607.141) [-605.665] (-610.644) (-607.236) * (-604.242) (-603.718) [-604.867] (-608.770) -- 0:00:46
269000 -- (-605.610) (-605.109) (-607.997) [-604.933] * (-605.356) (-604.190) (-608.088) [-604.870] -- 0:00:46
269500 -- [-609.097] (-604.898) (-604.618) (-605.200) * [-607.392] (-604.984) (-607.637) (-605.123) -- 0:00:46
270000 -- (-604.024) (-607.907) (-604.656) [-604.968] * (-608.483) (-605.822) (-605.478) [-604.703] -- 0:00:45
Average standard deviation of split frequencies: 0.015880
270500 -- (-605.835) (-607.032) (-604.687) [-604.464] * (-606.424) [-605.185] (-606.249) (-607.595) -- 0:00:45
271000 -- (-606.830) (-604.570) [-604.356] (-605.395) * (-618.658) (-605.762) [-606.987] (-607.679) -- 0:00:45
271500 -- (-606.885) (-605.219) (-607.444) [-605.120] * [-607.613] (-606.154) (-608.951) (-607.769) -- 0:00:45
272000 -- (-609.138) (-606.769) (-608.339) [-604.286] * (-605.953) (-605.677) [-606.325] (-607.595) -- 0:00:45
272500 -- (-605.848) [-608.289] (-607.210) (-606.516) * [-606.333] (-604.561) (-606.541) (-607.729) -- 0:00:45
273000 -- (-606.581) [-607.743] (-606.726) (-606.666) * [-606.190] (-607.912) (-605.652) (-606.357) -- 0:00:45
273500 -- (-607.087) (-606.014) [-606.702] (-610.517) * (-605.137) [-606.462] (-606.601) (-604.908) -- 0:00:45
274000 -- (-604.698) (-605.234) (-606.455) [-608.336] * (-609.340) (-604.742) (-606.580) [-605.477] -- 0:00:45
274500 -- (-606.422) [-607.650] (-604.593) (-606.711) * [-605.499] (-605.290) (-614.295) (-610.903) -- 0:00:44
275000 -- (-605.992) [-605.875] (-607.275) (-604.269) * [-604.960] (-605.613) (-612.472) (-605.081) -- 0:00:44
Average standard deviation of split frequencies: 0.015573
275500 -- (-604.027) [-604.490] (-604.545) (-603.917) * [-606.813] (-605.167) (-604.910) (-604.721) -- 0:00:44
276000 -- (-605.096) [-604.552] (-604.731) (-603.643) * [-603.654] (-606.377) (-605.776) (-607.203) -- 0:00:44
276500 -- (-604.631) (-606.787) (-604.295) [-606.612] * [-605.954] (-608.354) (-604.293) (-604.832) -- 0:00:44
277000 -- (-604.382) (-608.589) (-607.050) [-603.854] * (-604.724) (-609.792) (-604.439) [-606.578] -- 0:00:44
277500 -- (-603.930) (-608.797) (-605.333) [-603.877] * (-609.751) (-606.329) [-605.572] (-606.656) -- 0:00:44
278000 -- (-605.064) [-605.245] (-606.938) (-604.331) * [-604.343] (-606.273) (-604.296) (-604.983) -- 0:00:44
278500 -- (-608.544) [-608.333] (-606.036) (-607.795) * [-605.120] (-611.158) (-610.070) (-604.782) -- 0:00:44
279000 -- (-607.181) [-606.881] (-605.024) (-605.761) * (-608.305) (-607.657) [-608.051] (-604.844) -- 0:00:43
279500 -- (-604.424) (-606.108) (-604.848) [-607.754] * [-605.164] (-606.523) (-604.616) (-610.780) -- 0:00:43
280000 -- (-604.878) [-606.369] (-604.777) (-608.666) * [-604.492] (-608.311) (-606.231) (-609.623) -- 0:00:43
Average standard deviation of split frequencies: 0.015907
280500 -- (-605.219) (-609.499) [-606.307] (-603.431) * [-604.099] (-606.306) (-606.352) (-609.500) -- 0:00:43
281000 -- (-607.637) [-607.339] (-606.365) (-603.649) * (-605.292) (-608.331) (-603.719) [-605.632] -- 0:00:43
281500 -- (-605.163) [-604.741] (-605.744) (-606.828) * (-604.512) (-609.009) (-607.407) [-605.569] -- 0:00:43
282000 -- [-604.340] (-604.835) (-605.976) (-607.180) * (-603.871) [-605.710] (-605.141) (-605.891) -- 0:00:43
282500 -- (-619.359) [-604.581] (-606.026) (-607.116) * (-607.153) [-604.577] (-604.858) (-607.081) -- 0:00:43
283000 -- (-606.797) [-603.999] (-603.663) (-610.410) * (-609.811) (-605.552) (-605.656) [-605.488] -- 0:00:43
283500 -- (-604.588) [-607.125] (-604.246) (-607.687) * (-605.585) (-607.725) (-606.089) [-604.765] -- 0:00:42
284000 -- (-606.606) (-606.567) (-606.484) [-605.233] * (-604.095) (-603.953) (-604.226) [-606.558] -- 0:00:45
284500 -- (-608.301) [-606.963] (-607.957) (-605.644) * [-604.263] (-604.971) (-604.563) (-605.670) -- 0:00:45
285000 -- (-605.884) [-605.452] (-606.194) (-606.055) * (-604.171) [-604.546] (-605.771) (-603.461) -- 0:00:45
Average standard deviation of split frequencies: 0.015933
285500 -- (-606.851) [-608.481] (-604.924) (-604.969) * (-606.898) [-605.104] (-604.890) (-604.558) -- 0:00:45
286000 -- (-606.439) (-609.454) (-606.409) [-607.069] * (-607.417) [-608.545] (-603.971) (-604.180) -- 0:00:44
286500 -- (-607.754) (-603.367) (-604.237) [-605.116] * (-606.680) (-604.881) [-606.605] (-607.145) -- 0:00:44
287000 -- (-608.771) (-607.463) (-604.476) [-605.602] * (-604.331) (-607.314) (-606.018) [-605.700] -- 0:00:44
287500 -- [-604.902] (-608.159) (-604.129) (-606.334) * (-603.684) [-609.728] (-606.731) (-607.915) -- 0:00:44
288000 -- [-604.914] (-604.934) (-604.122) (-604.094) * (-607.373) (-607.939) [-606.850] (-605.624) -- 0:00:44
288500 -- (-605.394) [-606.628] (-606.521) (-603.942) * [-606.074] (-609.969) (-606.184) (-606.465) -- 0:00:44
289000 -- (-608.270) (-607.979) [-604.721] (-606.590) * [-606.295] (-607.351) (-609.505) (-607.802) -- 0:00:44
289500 -- [-604.391] (-606.788) (-604.445) (-609.141) * [-605.613] (-604.267) (-607.551) (-614.359) -- 0:00:44
290000 -- (-609.413) [-608.462] (-607.766) (-606.183) * (-604.414) [-604.343] (-607.391) (-609.632) -- 0:00:44
Average standard deviation of split frequencies: 0.016504
290500 -- (-605.430) (-609.397) [-604.244] (-604.039) * (-606.543) (-604.190) (-606.165) [-606.918] -- 0:00:43
291000 -- (-604.310) (-611.807) (-605.212) [-605.121] * [-605.846] (-605.429) (-613.887) (-604.949) -- 0:00:43
291500 -- (-606.441) (-607.824) [-605.596] (-612.356) * (-604.899) (-604.913) (-604.884) [-605.192] -- 0:00:43
292000 -- [-604.589] (-607.578) (-605.563) (-608.203) * (-605.106) (-607.795) (-605.688) [-606.184] -- 0:00:43
292500 -- [-603.661] (-607.136) (-607.123) (-611.939) * (-606.223) (-605.302) [-604.366] (-605.645) -- 0:00:43
293000 -- (-606.192) (-607.083) [-604.143] (-605.704) * [-604.597] (-608.724) (-604.975) (-605.752) -- 0:00:43
293500 -- [-606.376] (-604.099) (-606.234) (-604.332) * (-604.916) (-608.299) (-605.399) [-604.617] -- 0:00:43
294000 -- [-606.180] (-605.111) (-603.703) (-606.150) * (-604.013) (-606.703) (-606.284) [-606.729] -- 0:00:43
294500 -- (-607.926) (-604.913) (-604.359) [-605.821] * (-606.481) (-604.463) (-603.873) [-605.374] -- 0:00:43
295000 -- [-605.135] (-603.935) (-605.100) (-607.371) * (-606.156) [-605.059] (-607.284) (-608.020) -- 0:00:43
Average standard deviation of split frequencies: 0.014802
295500 -- [-604.973] (-604.753) (-606.852) (-605.603) * [-605.035] (-605.648) (-607.418) (-610.303) -- 0:00:42
296000 -- (-605.959) (-604.993) (-606.298) [-605.831] * (-606.346) (-607.451) (-606.030) [-608.036] -- 0:00:42
296500 -- (-606.006) [-606.821] (-605.873) (-603.906) * (-607.312) (-604.582) (-603.638) [-604.809] -- 0:00:42
297000 -- (-611.338) (-605.330) [-604.374] (-603.935) * (-605.182) (-607.363) (-605.796) [-605.544] -- 0:00:42
297500 -- (-608.172) [-604.981] (-604.600) (-604.962) * [-604.891] (-608.362) (-605.028) (-606.189) -- 0:00:42
298000 -- [-606.576] (-605.392) (-607.510) (-605.387) * [-605.373] (-604.149) (-610.809) (-607.871) -- 0:00:42
298500 -- (-610.560) (-609.518) (-607.669) [-605.085] * (-608.260) [-604.251] (-606.236) (-610.693) -- 0:00:42
299000 -- [-604.542] (-605.195) (-605.404) (-603.865) * [-606.144] (-605.721) (-604.244) (-606.735) -- 0:00:42
299500 -- (-606.522) [-603.956] (-611.326) (-605.137) * (-605.975) [-607.581] (-604.446) (-604.362) -- 0:00:42
300000 -- (-607.519) (-604.750) [-606.567] (-611.173) * (-604.359) (-610.881) [-606.397] (-604.158) -- 0:00:42
Average standard deviation of split frequencies: 0.014572
300500 -- (-607.182) (-605.922) [-604.520] (-604.405) * [-605.408] (-604.926) (-609.827) (-604.151) -- 0:00:41
301000 -- [-607.708] (-606.169) (-605.089) (-604.596) * (-604.745) (-612.062) [-604.764] (-607.464) -- 0:00:44
301500 -- (-610.019) (-604.850) [-606.940] (-605.170) * (-605.503) (-607.461) [-606.718] (-603.692) -- 0:00:44
302000 -- (-605.474) (-606.467) (-606.351) [-604.489] * (-606.076) (-608.152) [-604.579] (-604.358) -- 0:00:43
302500 -- (-603.663) (-606.632) [-606.942] (-606.083) * (-605.990) (-603.616) [-606.090] (-604.736) -- 0:00:43
303000 -- (-604.940) (-606.483) [-605.492] (-605.737) * (-606.753) (-603.630) [-607.927] (-604.548) -- 0:00:43
303500 -- (-605.391) (-612.649) [-609.255] (-606.946) * (-604.561) [-605.258] (-606.877) (-610.679) -- 0:00:43
304000 -- (-605.736) (-609.098) [-604.315] (-610.917) * (-605.097) (-608.728) [-606.472] (-606.695) -- 0:00:43
304500 -- (-610.146) (-605.349) (-604.364) [-609.170] * (-612.929) (-607.512) (-607.241) [-606.977] -- 0:00:43
305000 -- (-608.805) (-605.738) [-604.717] (-607.215) * (-607.168) (-610.014) (-603.982) [-605.348] -- 0:00:43
Average standard deviation of split frequencies: 0.013321
305500 -- (-610.091) [-604.705] (-606.172) (-604.699) * (-605.837) (-605.944) (-604.224) [-605.064] -- 0:00:43
306000 -- [-607.327] (-605.480) (-608.893) (-604.120) * (-605.432) (-610.195) (-605.734) [-608.964] -- 0:00:43
306500 -- (-606.854) (-604.601) [-605.200] (-606.505) * [-606.146] (-606.632) (-605.850) (-607.119) -- 0:00:42
307000 -- (-605.860) (-608.615) (-605.304) [-604.568] * (-604.571) (-605.901) (-603.943) [-607.569] -- 0:00:42
307500 -- (-606.672) (-608.059) (-605.848) [-605.114] * (-606.405) (-605.779) (-605.136) [-607.818] -- 0:00:42
308000 -- [-608.624] (-603.828) (-608.262) (-606.241) * (-605.735) (-607.108) (-605.907) [-604.961] -- 0:00:42
308500 -- (-604.538) [-603.726] (-606.422) (-605.917) * (-608.341) (-604.370) (-605.217) [-605.055] -- 0:00:42
309000 -- (-605.410) (-605.787) [-607.095] (-606.437) * (-604.720) (-603.798) (-606.705) [-605.281] -- 0:00:42
309500 -- (-604.742) (-604.412) (-606.514) [-606.488] * (-604.649) [-604.771] (-605.464) (-605.249) -- 0:00:42
310000 -- (-605.484) (-604.279) [-603.643] (-605.428) * (-605.577) (-604.340) [-606.103] (-607.327) -- 0:00:42
Average standard deviation of split frequencies: 0.013825
310500 -- (-604.066) [-607.697] (-605.543) (-605.154) * (-603.671) (-607.452) [-605.893] (-603.882) -- 0:00:42
311000 -- [-605.017] (-604.317) (-606.061) (-603.973) * (-605.285) (-605.857) (-605.605) [-610.110] -- 0:00:42
311500 -- (-606.949) (-604.911) [-605.171] (-606.619) * (-610.223) (-606.166) [-604.336] (-605.717) -- 0:00:41
312000 -- (-606.766) [-605.126] (-604.542) (-608.662) * (-609.098) (-606.410) (-604.277) [-604.895] -- 0:00:41
312500 -- [-606.276] (-605.151) (-603.867) (-604.688) * (-603.962) (-607.492) (-605.340) [-606.683] -- 0:00:41
313000 -- (-607.723) (-604.720) (-607.588) [-604.668] * (-605.980) (-612.993) (-603.886) [-612.399] -- 0:00:41
313500 -- (-605.922) (-606.143) (-604.684) [-605.642] * (-605.907) [-604.827] (-604.467) (-605.662) -- 0:00:41
314000 -- (-605.889) (-606.474) (-605.888) [-606.068] * (-608.099) (-604.387) (-607.652) [-607.124] -- 0:00:41
314500 -- (-607.379) (-605.581) (-605.765) [-606.252] * (-605.470) [-607.102] (-607.128) (-605.232) -- 0:00:41
315000 -- [-604.274] (-605.322) (-603.516) (-608.788) * (-609.141) [-603.672] (-605.616) (-605.996) -- 0:00:41
Average standard deviation of split frequencies: 0.013758
315500 -- (-604.874) [-604.229] (-605.492) (-604.006) * [-605.786] (-607.987) (-604.884) (-605.411) -- 0:00:41
316000 -- (-604.906) [-604.494] (-605.303) (-607.894) * (-605.918) [-603.741] (-607.215) (-606.540) -- 0:00:41
316500 -- [-605.433] (-605.818) (-604.948) (-606.537) * (-606.543) [-606.335] (-604.235) (-607.088) -- 0:00:41
317000 -- [-606.225] (-604.085) (-604.481) (-608.023) * [-604.821] (-603.836) (-603.948) (-604.974) -- 0:00:40
317500 -- (-606.433) [-605.923] (-604.786) (-604.235) * (-605.815) (-603.845) [-604.854] (-606.277) -- 0:00:42
318000 -- (-605.439) (-606.051) (-605.301) [-604.721] * (-611.611) (-607.229) (-607.752) [-608.739] -- 0:00:42
318500 -- (-605.765) (-604.621) (-604.647) [-605.239] * [-604.420] (-605.463) (-608.304) (-609.941) -- 0:00:42
319000 -- (-605.184) (-609.743) [-605.322] (-608.352) * (-603.664) (-604.252) [-608.535] (-607.437) -- 0:00:42
319500 -- (-604.448) [-605.415] (-604.260) (-607.130) * (-604.717) (-607.903) (-607.307) [-609.865] -- 0:00:42
320000 -- [-604.940] (-608.209) (-605.806) (-605.745) * (-603.603) (-608.856) (-604.836) [-605.123] -- 0:00:42
Average standard deviation of split frequencies: 0.013557
320500 -- (-603.995) (-605.358) (-604.889) [-604.624] * (-606.269) (-608.154) [-607.118] (-609.018) -- 0:00:42
321000 -- (-606.348) (-605.763) (-608.813) [-604.872] * (-606.229) (-606.534) [-606.108] (-609.259) -- 0:00:42
321500 -- [-604.294] (-604.909) (-604.817) (-605.234) * [-603.917] (-608.866) (-607.844) (-606.581) -- 0:00:42
322000 -- (-606.835) (-605.908) (-612.040) [-603.918] * (-604.372) [-604.525] (-605.583) (-605.475) -- 0:00:42
322500 -- (-610.576) [-604.059] (-607.290) (-608.311) * (-607.557) (-604.970) [-605.948] (-607.908) -- 0:00:42
323000 -- (-608.249) [-606.206] (-604.510) (-605.039) * [-604.365] (-605.250) (-605.208) (-604.879) -- 0:00:41
323500 -- (-604.470) (-607.210) (-605.249) [-604.906] * (-603.947) (-604.935) [-604.585] (-609.016) -- 0:00:41
324000 -- (-611.538) (-605.472) [-604.569] (-604.932) * (-604.607) [-605.137] (-604.613) (-606.395) -- 0:00:41
324500 -- (-604.158) (-605.700) [-604.978] (-604.779) * (-604.634) (-605.568) [-604.456] (-604.255) -- 0:00:41
325000 -- (-605.416) (-604.789) [-604.523] (-608.028) * (-606.043) [-608.860] (-607.080) (-604.413) -- 0:00:41
Average standard deviation of split frequencies: 0.013851
325500 -- [-604.451] (-604.230) (-605.838) (-605.840) * (-609.528) (-605.137) [-604.869] (-606.358) -- 0:00:41
326000 -- (-606.000) [-606.113] (-604.220) (-608.909) * [-604.449] (-605.144) (-605.173) (-608.287) -- 0:00:41
326500 -- (-604.820) (-605.644) [-604.887] (-607.191) * (-606.449) (-604.816) [-605.252] (-606.314) -- 0:00:41
327000 -- (-606.708) [-605.384] (-606.309) (-608.341) * [-606.639] (-604.491) (-608.787) (-606.433) -- 0:00:41
327500 -- (-603.763) (-604.664) (-603.671) [-610.808] * (-605.542) (-607.715) [-605.716] (-606.415) -- 0:00:41
328000 -- (-605.734) [-607.783] (-604.076) (-607.528) * (-605.207) [-605.469] (-606.621) (-607.380) -- 0:00:40
328500 -- (-604.690) [-607.059] (-609.411) (-604.801) * (-606.658) [-606.142] (-607.914) (-603.701) -- 0:00:40
329000 -- (-604.999) [-606.435] (-605.546) (-604.335) * (-611.264) (-604.622) (-609.332) [-605.476] -- 0:00:40
329500 -- [-605.578] (-606.079) (-614.305) (-604.246) * (-607.399) [-603.721] (-610.362) (-604.284) -- 0:00:40
330000 -- [-605.085] (-604.892) (-604.825) (-605.047) * (-605.750) (-604.832) [-608.911] (-604.549) -- 0:00:40
Average standard deviation of split frequencies: 0.012530
330500 -- (-605.865) (-605.197) (-604.529) [-608.784] * [-606.977] (-605.037) (-607.613) (-608.279) -- 0:00:40
331000 -- (-607.863) [-606.619] (-604.060) (-614.439) * [-606.639] (-608.005) (-604.616) (-607.197) -- 0:00:40
331500 -- [-607.208] (-607.714) (-605.051) (-605.639) * (-610.692) [-608.177] (-605.492) (-607.482) -- 0:00:40
332000 -- (-605.187) [-606.555] (-604.768) (-605.235) * (-610.012) [-610.131] (-606.505) (-607.370) -- 0:00:40
332500 -- (-605.379) [-608.271] (-604.361) (-604.647) * (-608.646) (-603.909) (-606.775) [-603.930] -- 0:00:40
333000 -- (-606.195) (-609.120) [-606.723] (-606.590) * (-606.263) (-604.024) [-605.369] (-608.983) -- 0:00:40
333500 -- (-606.258) (-606.014) [-606.659] (-606.091) * (-607.393) [-603.567] (-607.099) (-609.321) -- 0:00:39
334000 -- (-607.750) [-605.767] (-603.713) (-604.252) * (-605.723) (-608.881) [-608.504] (-606.796) -- 0:00:39
334500 -- (-608.166) (-605.495) [-604.185] (-603.564) * [-606.553] (-605.968) (-605.014) (-609.038) -- 0:00:39
335000 -- (-605.885) [-604.753] (-605.883) (-605.403) * (-607.236) [-604.201] (-605.259) (-605.281) -- 0:00:41
Average standard deviation of split frequencies: 0.012705
335500 -- (-604.337) [-605.378] (-604.397) (-606.420) * (-607.274) [-605.487] (-607.648) (-608.149) -- 0:00:41
336000 -- (-603.854) (-609.260) [-607.490] (-606.249) * (-605.529) (-605.361) [-612.734] (-606.341) -- 0:00:41
336500 -- [-603.940] (-604.641) (-604.352) (-604.870) * (-606.309) [-605.669] (-607.323) (-604.368) -- 0:00:41
337000 -- (-603.816) (-603.842) [-604.815] (-605.232) * [-606.552] (-605.210) (-610.668) (-604.895) -- 0:00:41
337500 -- (-605.503) (-605.813) (-604.086) [-605.497] * [-604.943] (-604.449) (-607.588) (-606.682) -- 0:00:41
338000 -- (-604.531) (-604.235) (-605.938) [-607.348] * [-605.643] (-608.946) (-606.183) (-607.623) -- 0:00:41
338500 -- (-606.487) (-605.870) [-608.093] (-608.874) * (-605.026) (-608.043) [-604.612] (-607.077) -- 0:00:41
339000 -- (-604.532) (-605.100) (-605.763) [-608.817] * (-607.027) (-610.356) (-606.159) [-607.659] -- 0:00:40
339500 -- (-607.383) [-605.269] (-606.288) (-603.874) * (-604.824) [-604.158] (-604.017) (-611.177) -- 0:00:40
340000 -- (-604.481) [-605.893] (-605.741) (-605.867) * (-605.086) (-605.032) [-605.371] (-606.480) -- 0:00:40
Average standard deviation of split frequencies: 0.012838
340500 -- [-606.268] (-606.247) (-604.461) (-607.622) * [-606.721] (-604.715) (-607.690) (-603.827) -- 0:00:40
341000 -- (-607.349) (-607.580) (-607.206) [-609.803] * (-605.447) [-604.377] (-603.700) (-605.863) -- 0:00:40
341500 -- (-606.456) [-605.984] (-606.793) (-605.318) * [-603.888] (-606.219) (-605.385) (-604.063) -- 0:00:40
342000 -- (-605.582) [-603.998] (-604.490) (-606.757) * (-607.794) (-607.108) (-605.694) [-604.504] -- 0:00:40
342500 -- (-606.693) [-603.481] (-608.254) (-607.363) * (-603.551) (-607.636) [-603.501] (-604.178) -- 0:00:40
343000 -- (-609.070) (-604.515) (-604.925) [-605.238] * [-608.932] (-604.351) (-604.184) (-608.519) -- 0:00:40
343500 -- (-606.334) (-609.232) (-608.534) [-607.178] * [-605.253] (-605.849) (-604.567) (-606.170) -- 0:00:40
344000 -- (-605.902) (-605.649) [-608.147] (-608.583) * (-605.575) (-606.167) (-610.612) [-605.707] -- 0:00:40
344500 -- [-604.782] (-605.630) (-604.904) (-604.981) * [-604.443] (-605.500) (-606.330) (-606.556) -- 0:00:39
345000 -- [-606.488] (-605.271) (-608.466) (-605.111) * (-604.046) (-605.662) (-604.846) [-606.090] -- 0:00:39
Average standard deviation of split frequencies: 0.012186
345500 -- (-608.114) (-605.956) (-608.754) [-604.193] * (-609.896) [-605.398] (-605.692) (-606.874) -- 0:00:39
346000 -- (-604.508) (-604.546) (-608.339) [-607.057] * (-610.520) (-605.477) [-608.299] (-607.078) -- 0:00:39
346500 -- (-604.427) (-606.704) (-607.411) [-604.078] * (-607.344) (-604.188) [-604.898] (-605.986) -- 0:00:39
347000 -- (-606.717) (-605.415) (-612.340) [-603.974] * (-606.483) (-604.702) [-606.486] (-610.882) -- 0:00:39
347500 -- (-605.927) (-605.435) (-610.384) [-603.613] * (-604.001) (-606.514) [-605.096] (-605.865) -- 0:00:39
348000 -- [-604.771] (-605.620) (-612.021) (-606.911) * (-606.035) (-604.467) [-604.568] (-605.318) -- 0:00:39
348500 -- [-605.733] (-609.312) (-608.137) (-608.929) * (-604.877) (-605.269) [-609.099] (-606.937) -- 0:00:39
349000 -- (-605.280) [-604.874] (-610.498) (-607.987) * (-608.016) (-606.143) [-606.027] (-605.885) -- 0:00:39
349500 -- (-606.746) (-604.066) [-609.703] (-608.526) * (-608.407) [-605.108] (-606.426) (-605.154) -- 0:00:39
350000 -- (-603.854) (-606.595) [-606.823] (-606.157) * (-607.638) (-604.794) (-608.554) [-608.501] -- 0:00:39
Average standard deviation of split frequencies: 0.011427
350500 -- (-604.694) [-604.444] (-607.088) (-606.230) * (-606.789) (-604.177) (-607.780) [-605.204] -- 0:00:38
351000 -- (-605.368) (-605.586) (-610.559) [-605.634] * (-605.225) [-603.879] (-607.468) (-604.252) -- 0:00:38
351500 -- (-605.283) (-605.097) [-606.019] (-609.592) * (-606.706) (-605.225) (-606.594) [-603.619] -- 0:00:38
352000 -- (-605.655) [-606.176] (-605.246) (-604.140) * (-607.265) (-604.429) (-608.467) [-605.573] -- 0:00:40
352500 -- [-606.110] (-607.051) (-605.648) (-606.292) * (-604.151) (-605.124) (-608.625) [-604.960] -- 0:00:40
353000 -- (-603.904) (-605.269) [-604.729] (-612.455) * (-606.388) [-606.170] (-611.137) (-604.110) -- 0:00:40
353500 -- [-604.349] (-606.421) (-606.713) (-607.344) * [-604.360] (-610.900) (-605.998) (-604.110) -- 0:00:40
354000 -- (-604.767) (-604.002) (-610.345) [-603.638] * (-604.622) (-608.849) [-604.606] (-604.939) -- 0:00:40
354500 -- (-604.989) (-604.318) (-603.558) [-604.960] * (-608.819) (-612.520) (-608.955) [-604.682] -- 0:00:40
355000 -- (-604.046) (-608.594) [-604.806] (-606.437) * (-606.394) (-609.961) (-607.626) [-606.797] -- 0:00:39
Average standard deviation of split frequencies: 0.010814
355500 -- (-604.168) (-604.602) [-605.632] (-605.334) * (-604.289) [-604.314] (-605.518) (-604.890) -- 0:00:39
356000 -- [-604.240] (-606.125) (-604.855) (-607.206) * [-604.586] (-608.694) (-609.071) (-605.192) -- 0:00:39
356500 -- (-607.548) (-607.937) [-605.619] (-606.872) * (-604.923) (-604.005) (-607.845) [-606.992] -- 0:00:39
357000 -- (-607.959) (-605.154) (-607.929) [-604.968] * (-606.874) [-610.038] (-608.654) (-607.502) -- 0:00:39
357500 -- [-607.852] (-605.129) (-607.989) (-604.697) * [-607.456] (-608.006) (-604.020) (-603.974) -- 0:00:39
358000 -- (-604.903) [-608.275] (-604.867) (-610.136) * (-605.608) [-605.537] (-606.143) (-607.019) -- 0:00:39
358500 -- (-611.016) (-604.489) (-604.563) [-605.185] * (-608.867) [-604.800] (-603.956) (-604.022) -- 0:00:39
359000 -- [-605.608] (-605.559) (-604.427) (-606.232) * (-604.638) (-604.625) [-605.099] (-606.509) -- 0:00:39
359500 -- (-603.691) [-605.017] (-605.551) (-605.083) * [-605.123] (-604.606) (-604.154) (-605.960) -- 0:00:39
360000 -- (-604.438) (-606.180) (-606.206) [-605.601] * (-605.967) [-605.222] (-604.475) (-605.512) -- 0:00:39
Average standard deviation of split frequencies: 0.011400
360500 -- (-607.910) (-610.514) (-607.987) [-608.375] * [-610.359] (-607.588) (-606.492) (-610.998) -- 0:00:39
361000 -- (-607.486) (-605.999) (-610.259) [-606.919] * (-607.274) [-605.955] (-605.461) (-611.845) -- 0:00:38
361500 -- (-608.533) (-604.754) [-608.318] (-604.046) * (-606.031) [-606.307] (-603.542) (-603.599) -- 0:00:38
362000 -- (-606.641) (-604.922) (-609.556) [-604.897] * [-607.767] (-609.981) (-606.886) (-605.199) -- 0:00:38
362500 -- (-606.555) (-604.926) (-612.190) [-603.713] * [-605.569] (-608.890) (-604.841) (-605.536) -- 0:00:38
363000 -- [-608.053] (-608.216) (-610.237) (-605.682) * (-604.721) (-607.960) (-607.898) [-605.133] -- 0:00:38
363500 -- (-612.062) (-606.716) (-604.992) [-604.344] * (-606.796) (-607.063) (-603.761) [-605.281] -- 0:00:38
364000 -- (-605.157) (-604.997) (-603.896) [-607.820] * [-605.156] (-605.950) (-605.661) (-607.021) -- 0:00:38
364500 -- [-605.471] (-605.084) (-603.959) (-605.222) * (-604.508) [-606.024] (-607.274) (-606.199) -- 0:00:38
365000 -- (-605.055) (-604.085) [-607.049] (-605.198) * (-606.306) [-605.758] (-610.431) (-605.095) -- 0:00:38
Average standard deviation of split frequencies: 0.011163
365500 -- (-604.219) (-605.904) [-604.560] (-611.235) * (-605.612) (-605.112) (-605.665) [-605.373] -- 0:00:38
366000 -- (-604.305) [-606.343] (-610.257) (-604.583) * (-605.476) (-603.901) [-605.855] (-606.375) -- 0:00:38
366500 -- (-603.958) (-607.741) (-605.382) [-607.228] * (-604.147) (-604.494) [-605.699] (-603.615) -- 0:00:38
367000 -- [-606.415] (-608.995) (-611.269) (-605.790) * (-604.170) [-604.538] (-606.230) (-604.047) -- 0:00:37
367500 -- (-605.445) (-605.971) [-606.815] (-604.694) * (-605.009) (-604.948) [-605.248] (-605.778) -- 0:00:37
368000 -- [-605.746] (-605.643) (-605.478) (-605.219) * (-605.808) (-604.810) (-605.263) [-606.595] -- 0:00:37
368500 -- [-604.281] (-605.013) (-607.155) (-606.480) * [-609.072] (-608.364) (-604.282) (-605.998) -- 0:00:39
369000 -- (-609.940) [-606.133] (-610.176) (-608.126) * (-609.084) [-604.821] (-604.932) (-606.317) -- 0:00:39
369500 -- (-605.326) [-605.592] (-607.597) (-605.332) * (-604.560) [-603.817] (-604.893) (-610.071) -- 0:00:39
370000 -- (-605.471) (-605.006) [-605.819] (-606.092) * (-606.131) [-604.118] (-604.767) (-607.628) -- 0:00:39
Average standard deviation of split frequencies: 0.012011
370500 -- (-605.819) [-610.037] (-605.382) (-607.262) * (-607.996) (-607.329) (-611.387) [-605.298] -- 0:00:39
371000 -- (-604.496) [-606.465] (-604.544) (-609.120) * [-604.558] (-609.473) (-607.733) (-607.913) -- 0:00:38
371500 -- [-605.999] (-606.094) (-605.409) (-606.693) * (-606.348) (-606.921) (-610.050) [-606.578] -- 0:00:38
372000 -- (-603.849) (-607.340) (-607.452) [-604.631] * (-605.174) [-604.345] (-611.056) (-606.554) -- 0:00:38
372500 -- (-605.542) (-607.064) (-607.434) [-604.511] * [-605.357] (-604.433) (-606.929) (-604.931) -- 0:00:38
373000 -- (-605.402) (-608.834) [-608.281] (-605.162) * (-603.908) [-606.896] (-606.068) (-603.995) -- 0:00:38
373500 -- (-605.972) (-605.887) (-605.905) [-606.508] * (-608.507) (-605.360) (-606.971) [-613.187] -- 0:00:38
374000 -- (-606.419) [-608.010] (-610.505) (-604.347) * (-610.328) (-608.268) [-607.238] (-606.200) -- 0:00:38
374500 -- (-605.535) (-605.135) [-606.283] (-606.643) * [-604.978] (-606.646) (-605.069) (-605.674) -- 0:00:38
375000 -- (-604.274) (-606.389) (-606.518) [-604.272] * (-605.727) (-609.674) (-608.655) [-604.158] -- 0:00:38
Average standard deviation of split frequencies: 0.012390
375500 -- (-605.082) (-604.426) (-607.216) [-604.290] * (-604.979) (-606.195) [-609.374] (-604.000) -- 0:00:38
376000 -- (-605.015) (-605.664) [-605.224] (-606.045) * (-603.793) [-605.201] (-607.456) (-605.582) -- 0:00:38
376500 -- [-605.462] (-605.823) (-605.969) (-604.876) * (-606.394) (-607.416) (-605.268) [-605.022] -- 0:00:38
377000 -- (-604.856) (-605.685) [-604.941] (-607.172) * (-609.250) (-605.564) (-605.984) [-605.365] -- 0:00:38
377500 -- [-606.353] (-605.134) (-604.465) (-604.978) * (-606.810) (-609.515) (-606.093) [-604.631] -- 0:00:37
378000 -- (-605.662) (-607.334) [-605.352] (-604.700) * (-604.522) [-603.505] (-605.365) (-605.878) -- 0:00:37
378500 -- [-605.699] (-606.365) (-604.675) (-604.406) * (-605.138) [-604.371] (-605.932) (-607.832) -- 0:00:37
379000 -- (-607.527) [-604.582] (-606.494) (-608.701) * (-604.808) (-604.851) (-606.701) [-605.892] -- 0:00:37
379500 -- [-605.069] (-604.308) (-610.317) (-606.261) * (-603.876) [-605.178] (-607.490) (-609.754) -- 0:00:37
380000 -- [-603.852] (-604.637) (-608.812) (-605.574) * (-608.546) (-605.008) (-606.239) [-610.176] -- 0:00:37
Average standard deviation of split frequencies: 0.012602
380500 -- (-604.475) (-606.581) (-607.415) [-604.869] * (-603.756) (-608.321) [-608.028] (-606.460) -- 0:00:37
381000 -- (-606.435) (-605.577) (-606.876) [-607.447] * (-604.524) [-606.314] (-606.122) (-604.120) -- 0:00:37
381500 -- (-605.753) [-605.839] (-606.424) (-606.408) * [-604.639] (-605.646) (-608.549) (-606.777) -- 0:00:37
382000 -- (-605.005) [-605.802] (-604.949) (-607.204) * (-606.141) (-608.140) (-606.386) [-604.595] -- 0:00:37
382500 -- (-607.276) [-604.518] (-604.281) (-606.353) * (-604.504) (-608.661) (-606.214) [-604.454] -- 0:00:37
383000 -- [-607.417] (-605.886) (-604.212) (-605.111) * (-604.804) (-604.319) (-612.213) [-604.377] -- 0:00:37
383500 -- (-607.147) (-607.601) (-606.284) [-604.265] * (-604.334) [-608.757] (-607.250) (-606.146) -- 0:00:36
384000 -- [-605.325] (-608.997) (-607.479) (-606.886) * [-605.022] (-606.701) (-607.988) (-608.365) -- 0:00:36
384500 -- (-604.727) [-606.521] (-606.798) (-609.873) * (-606.229) (-607.841) [-606.420] (-607.502) -- 0:00:38
385000 -- [-607.983] (-604.612) (-603.688) (-609.329) * (-606.061) [-607.721] (-607.138) (-604.907) -- 0:00:38
Average standard deviation of split frequencies: 0.013721
385500 -- (-604.101) [-605.224] (-606.819) (-609.165) * (-605.898) (-605.446) (-606.602) [-607.665] -- 0:00:38
386000 -- (-606.844) (-604.586) [-607.213] (-608.856) * (-604.870) (-604.876) [-605.968] (-607.442) -- 0:00:38
386500 -- (-609.474) [-604.510] (-603.799) (-607.605) * (-605.235) (-607.415) (-604.673) [-605.666] -- 0:00:38
387000 -- (-605.624) (-608.534) (-603.720) [-606.200] * (-604.991) (-603.809) (-605.338) [-604.348] -- 0:00:38
387500 -- (-608.083) (-610.319) (-605.996) [-605.063] * (-605.664) (-604.789) (-608.839) [-608.057] -- 0:00:37
388000 -- (-604.861) (-604.047) (-610.867) [-605.934] * (-604.909) [-611.508] (-609.287) (-608.760) -- 0:00:37
388500 -- [-605.888] (-604.209) (-610.338) (-605.049) * (-604.680) [-608.118] (-607.389) (-605.343) -- 0:00:37
389000 -- (-606.422) (-610.000) [-606.591] (-606.826) * (-605.147) (-606.505) (-605.335) [-605.654] -- 0:00:37
389500 -- [-604.609] (-605.545) (-604.560) (-605.693) * (-604.456) [-605.274] (-606.760) (-605.201) -- 0:00:37
390000 -- (-604.523) (-605.748) (-606.990) [-605.628] * [-603.926] (-606.974) (-605.703) (-607.281) -- 0:00:37
Average standard deviation of split frequencies: 0.013202
390500 -- [-605.436] (-605.401) (-605.967) (-605.951) * (-604.959) (-604.155) [-604.519] (-603.497) -- 0:00:37
391000 -- (-607.640) [-603.588] (-606.592) (-605.578) * (-606.502) (-604.991) [-605.971] (-605.528) -- 0:00:37
391500 -- [-607.021] (-604.974) (-603.838) (-607.164) * [-604.472] (-604.727) (-608.580) (-606.806) -- 0:00:37
392000 -- (-605.292) (-605.037) [-605.332] (-608.204) * (-609.202) (-607.002) [-605.938] (-608.446) -- 0:00:37
392500 -- (-611.596) [-605.692] (-607.742) (-605.748) * (-608.110) [-606.406] (-609.659) (-606.271) -- 0:00:37
393000 -- (-608.017) (-606.859) (-606.907) [-606.145] * (-604.741) (-606.967) [-605.754] (-610.363) -- 0:00:37
393500 -- (-610.981) (-609.693) (-605.800) [-605.264] * (-604.177) [-609.289] (-606.244) (-609.134) -- 0:00:36
394000 -- [-605.905] (-606.699) (-610.273) (-605.459) * (-606.551) [-609.196] (-605.835) (-603.847) -- 0:00:36
394500 -- (-604.326) [-605.372] (-606.144) (-604.593) * (-608.115) (-609.253) (-603.757) [-604.935] -- 0:00:36
395000 -- [-604.901] (-606.769) (-606.447) (-604.511) * [-607.204] (-606.249) (-605.231) (-604.826) -- 0:00:36
Average standard deviation of split frequencies: 0.012955
395500 -- (-613.746) (-609.419) (-605.656) [-606.913] * (-606.449) [-604.585] (-605.160) (-605.044) -- 0:00:36
396000 -- (-603.887) [-604.616] (-604.779) (-607.970) * (-606.194) [-605.488] (-605.267) (-605.300) -- 0:00:36
396500 -- (-607.173) [-606.849] (-604.528) (-606.335) * (-604.664) (-604.701) (-609.574) [-606.317] -- 0:00:36
397000 -- [-606.245] (-605.620) (-604.737) (-610.060) * [-604.499] (-608.024) (-606.679) (-606.236) -- 0:00:36
397500 -- (-606.433) (-604.847) [-609.270] (-605.576) * (-605.486) [-605.106] (-605.331) (-608.794) -- 0:00:36
398000 -- [-604.910] (-605.976) (-604.590) (-607.794) * (-605.007) [-606.392] (-604.982) (-607.428) -- 0:00:36
398500 -- (-604.486) [-608.130] (-604.963) (-606.654) * (-604.462) [-605.406] (-606.784) (-608.343) -- 0:00:36
399000 -- (-606.501) (-606.223) [-605.082] (-605.309) * (-604.319) [-605.862] (-606.513) (-606.635) -- 0:00:36
399500 -- [-606.865] (-605.766) (-604.684) (-604.095) * (-603.875) (-608.913) (-604.658) [-604.497] -- 0:00:36
400000 -- (-612.006) (-606.070) [-606.089] (-603.869) * (-605.982) [-605.901] (-605.556) (-604.930) -- 0:00:36
Average standard deviation of split frequencies: 0.012873
400500 -- [-608.450] (-605.075) (-605.996) (-604.894) * (-604.575) (-606.022) (-604.800) [-604.056] -- 0:00:35
401000 -- [-606.480] (-605.469) (-610.538) (-605.297) * (-604.485) (-606.936) [-607.684] (-607.201) -- 0:00:37
401500 -- (-605.638) (-608.121) (-609.713) [-607.082] * (-607.354) (-604.718) [-607.015] (-605.084) -- 0:00:37
402000 -- (-612.361) (-609.084) (-606.243) [-604.216] * [-605.596] (-604.201) (-604.648) (-605.954) -- 0:00:37
402500 -- (-608.388) (-607.620) [-603.933] (-605.714) * (-603.845) (-610.663) [-605.890] (-606.634) -- 0:00:37
403000 -- (-608.313) (-607.304) (-605.226) [-603.791] * (-606.979) (-605.953) (-607.022) [-606.142] -- 0:00:37
403500 -- (-605.296) [-607.215] (-608.699) (-605.101) * (-605.076) (-604.760) (-607.748) [-604.549] -- 0:00:36
404000 -- (-603.779) [-606.088] (-606.300) (-604.169) * (-606.152) (-606.330) (-605.377) [-606.042] -- 0:00:36
404500 -- (-607.783) (-605.769) [-605.496] (-607.978) * (-610.003) (-606.774) [-611.560] (-604.922) -- 0:00:36
405000 -- [-605.122] (-609.124) (-608.858) (-605.125) * [-604.321] (-607.130) (-604.948) (-609.111) -- 0:00:36
Average standard deviation of split frequencies: 0.013114
405500 -- (-605.413) (-607.865) [-607.178] (-610.066) * (-604.878) [-604.366] (-605.110) (-609.228) -- 0:00:36
406000 -- (-613.587) (-605.542) [-605.896] (-607.418) * (-605.764) [-604.881] (-606.196) (-607.357) -- 0:00:36
406500 -- (-607.090) (-604.901) (-604.808) [-609.049] * [-608.977] (-605.349) (-605.373) (-605.497) -- 0:00:36
407000 -- [-604.998] (-604.349) (-605.085) (-606.181) * (-606.290) [-606.236] (-606.442) (-606.134) -- 0:00:36
407500 -- (-604.009) (-604.931) [-604.755] (-603.836) * (-604.660) [-604.252] (-604.874) (-604.334) -- 0:00:36
408000 -- (-605.268) (-608.232) (-606.006) [-609.440] * [-604.937] (-604.911) (-604.533) (-604.446) -- 0:00:36
408500 -- [-604.683] (-607.631) (-605.551) (-607.133) * (-605.617) [-606.099] (-607.145) (-605.527) -- 0:00:36
409000 -- [-605.106] (-605.815) (-606.804) (-605.794) * [-604.567] (-608.371) (-606.158) (-605.325) -- 0:00:36
409500 -- (-605.289) (-605.326) [-609.075] (-616.578) * (-605.537) (-610.028) [-607.772] (-607.031) -- 0:00:36
410000 -- (-608.094) (-603.819) [-606.752] (-604.510) * (-606.621) [-605.565] (-603.666) (-607.420) -- 0:00:35
Average standard deviation of split frequencies: 0.011884
410500 -- (-607.086) [-606.020] (-607.555) (-611.400) * [-604.627] (-607.366) (-608.428) (-605.007) -- 0:00:35
411000 -- (-604.563) (-606.028) (-609.074) [-604.657] * [-605.222] (-604.933) (-606.446) (-606.537) -- 0:00:35
411500 -- (-606.072) [-606.809] (-606.667) (-608.017) * [-604.531] (-604.700) (-606.665) (-605.154) -- 0:00:35
412000 -- (-607.308) (-606.328) [-606.004] (-608.675) * (-604.346) (-606.932) (-607.068) [-603.852] -- 0:00:35
412500 -- [-606.416] (-608.575) (-605.212) (-605.520) * [-604.519] (-606.021) (-605.167) (-611.127) -- 0:00:35
413000 -- (-606.249) (-606.025) (-605.481) [-604.325] * (-604.143) (-604.572) (-607.208) [-605.737] -- 0:00:35
413500 -- (-605.944) (-604.339) (-606.619) [-606.807] * [-606.707] (-607.110) (-609.304) (-607.286) -- 0:00:35
414000 -- [-605.033] (-605.004) (-607.802) (-603.986) * (-605.979) (-609.270) [-604.969] (-605.917) -- 0:00:35
414500 -- (-604.907) (-605.317) (-604.986) [-604.717] * (-605.331) (-604.514) [-604.864] (-604.980) -- 0:00:35
415000 -- (-606.077) (-605.131) [-605.689] (-605.780) * (-606.959) (-605.184) (-606.681) [-608.753] -- 0:00:35
Average standard deviation of split frequencies: 0.012065
415500 -- (-604.146) (-605.532) [-607.349] (-605.836) * (-607.240) (-606.048) [-605.208] (-606.792) -- 0:00:35
416000 -- [-606.828] (-605.257) (-604.410) (-609.745) * (-608.723) (-606.207) (-605.967) [-608.326] -- 0:00:35
416500 -- [-609.161] (-603.839) (-604.204) (-604.274) * [-608.364] (-604.624) (-608.590) (-608.593) -- 0:00:35
417000 -- (-608.570) (-606.764) (-610.925) [-607.525] * (-605.915) (-608.690) [-606.210] (-604.116) -- 0:00:34
417500 -- (-604.809) (-608.621) [-605.193] (-610.628) * [-606.813] (-607.655) (-606.661) (-607.617) -- 0:00:34
418000 -- (-604.286) [-607.970] (-606.368) (-607.284) * (-604.794) [-607.653] (-607.050) (-605.574) -- 0:00:36
418500 -- (-606.064) [-605.641] (-606.958) (-605.032) * [-605.201] (-607.995) (-608.160) (-606.688) -- 0:00:36
419000 -- (-606.252) [-605.300] (-607.083) (-608.181) * (-611.749) (-605.824) [-604.820] (-605.995) -- 0:00:36
419500 -- (-607.850) [-606.863] (-607.447) (-604.457) * (-605.076) (-604.416) (-607.401) [-606.727] -- 0:00:35
420000 -- (-604.887) (-606.264) (-605.844) [-604.148] * [-605.985] (-605.081) (-605.261) (-606.292) -- 0:00:35
Average standard deviation of split frequencies: 0.011668
420500 -- (-604.739) [-606.509] (-606.159) (-607.696) * [-606.606] (-605.226) (-605.512) (-604.028) -- 0:00:35
421000 -- (-606.477) [-604.359] (-604.543) (-609.292) * (-605.019) [-604.551] (-605.794) (-605.451) -- 0:00:35
421500 -- (-604.962) (-607.366) (-604.772) [-604.554] * (-606.848) (-604.458) [-605.796] (-604.591) -- 0:00:35
422000 -- (-605.875) (-607.214) [-604.576] (-605.526) * (-607.065) (-604.313) (-605.080) [-604.453] -- 0:00:35
422500 -- (-607.199) (-605.964) [-604.727] (-606.883) * (-603.807) [-605.426] (-608.415) (-604.926) -- 0:00:35
423000 -- (-606.240) [-604.012] (-604.212) (-605.638) * (-605.015) [-608.525] (-605.627) (-604.627) -- 0:00:35
423500 -- (-608.747) (-605.774) [-604.896] (-604.377) * (-607.822) [-608.564] (-607.962) (-603.949) -- 0:00:35
424000 -- (-604.401) [-603.802] (-605.494) (-605.715) * (-606.961) [-606.072] (-605.802) (-605.369) -- 0:00:35
424500 -- (-605.458) [-603.635] (-606.403) (-606.228) * [-607.643] (-607.497) (-605.586) (-604.705) -- 0:00:35
425000 -- [-605.146] (-605.344) (-608.511) (-605.531) * (-610.042) [-608.565] (-605.800) (-606.520) -- 0:00:35
Average standard deviation of split frequencies: 0.011521
425500 -- (-606.020) (-605.975) [-606.738] (-606.577) * (-606.531) [-607.368] (-606.076) (-607.268) -- 0:00:35
426000 -- (-608.536) [-605.543] (-616.787) (-608.186) * (-607.776) (-607.516) (-606.035) [-604.067] -- 0:00:35
426500 -- [-604.300] (-604.603) (-606.570) (-604.967) * (-609.413) [-603.918] (-607.443) (-604.832) -- 0:00:34
427000 -- (-604.059) (-607.738) (-604.803) [-605.557] * (-607.244) (-608.321) [-609.854] (-605.825) -- 0:00:34
427500 -- [-606.143] (-607.198) (-606.888) (-606.312) * (-605.292) (-607.263) (-606.148) [-605.660] -- 0:00:34
428000 -- (-604.885) [-607.249] (-610.969) (-605.306) * [-604.968] (-608.061) (-606.137) (-609.526) -- 0:00:34
428500 -- (-607.403) (-606.708) (-604.684) [-608.142] * (-605.315) (-609.280) [-605.397] (-607.415) -- 0:00:34
429000 -- (-605.980) (-604.155) [-606.545] (-605.509) * [-606.136] (-607.015) (-607.956) (-605.657) -- 0:00:34
429500 -- (-606.995) (-608.709) [-604.984] (-605.102) * (-606.739) (-605.175) (-606.119) [-605.513] -- 0:00:34
430000 -- (-605.649) (-608.276) [-610.470] (-610.407) * (-608.451) [-605.946] (-603.707) (-605.497) -- 0:00:34
Average standard deviation of split frequencies: 0.012556
430500 -- (-609.998) (-605.055) (-605.314) [-607.006] * [-606.580] (-608.297) (-604.131) (-607.769) -- 0:00:34
431000 -- (-610.186) (-604.945) (-605.655) [-605.256] * [-604.515] (-604.061) (-607.550) (-606.949) -- 0:00:34
431500 -- (-607.337) [-605.920] (-605.393) (-605.759) * (-604.589) (-606.291) (-605.347) [-605.087] -- 0:00:34
432000 -- (-607.867) [-604.229] (-605.735) (-607.418) * [-604.888] (-608.281) (-605.252) (-604.031) -- 0:00:34
432500 -- (-604.610) (-606.518) [-606.204] (-604.186) * (-604.553) (-610.195) [-607.592] (-604.718) -- 0:00:34
433000 -- [-605.075] (-604.337) (-606.826) (-603.993) * (-604.419) (-606.918) [-605.357] (-605.481) -- 0:00:34
433500 -- [-604.293] (-604.503) (-605.726) (-605.601) * (-606.297) [-606.447] (-605.665) (-604.578) -- 0:00:33
434000 -- (-604.105) (-606.708) [-609.088] (-608.244) * (-606.214) [-604.240] (-605.244) (-603.871) -- 0:00:33
434500 -- (-603.461) [-607.255] (-607.725) (-606.085) * (-606.895) (-605.296) (-607.211) [-604.532] -- 0:00:35
435000 -- (-603.582) (-608.376) [-605.993] (-606.091) * [-605.919] (-605.331) (-607.154) (-604.553) -- 0:00:35
Average standard deviation of split frequencies: 0.012434
435500 -- (-606.625) [-607.326] (-605.996) (-607.157) * (-605.507) (-606.680) [-604.645] (-604.182) -- 0:00:34
436000 -- (-605.027) (-605.874) [-606.759] (-607.953) * [-606.202] (-607.485) (-605.735) (-609.521) -- 0:00:34
436500 -- [-605.242] (-605.738) (-609.189) (-605.952) * (-608.202) [-604.722] (-606.442) (-605.351) -- 0:00:34
437000 -- (-608.240) [-608.276] (-608.372) (-605.852) * [-604.497] (-606.514) (-610.874) (-606.325) -- 0:00:34
437500 -- (-609.038) (-606.607) (-608.058) [-605.373] * [-607.945] (-609.820) (-604.887) (-607.648) -- 0:00:34
438000 -- (-606.755) (-603.681) [-607.610] (-604.726) * (-607.149) (-606.922) (-607.472) [-607.735] -- 0:00:34
438500 -- [-607.807] (-605.047) (-611.808) (-608.879) * [-604.094] (-607.245) (-607.510) (-604.577) -- 0:00:34
439000 -- (-605.981) (-604.407) (-606.793) [-614.913] * [-603.954] (-604.537) (-607.526) (-606.056) -- 0:00:34
439500 -- (-608.508) [-607.270] (-609.206) (-611.639) * (-607.758) [-605.067] (-605.850) (-607.746) -- 0:00:34
440000 -- (-611.159) (-605.434) [-604.959] (-606.924) * (-607.613) [-605.077] (-607.303) (-605.218) -- 0:00:34
Average standard deviation of split frequencies: 0.012770
440500 -- [-609.212] (-607.931) (-607.081) (-607.467) * (-606.804) (-604.521) [-605.300] (-605.462) -- 0:00:34
441000 -- (-606.574) [-607.287] (-606.075) (-606.388) * (-606.998) (-606.269) (-609.074) [-605.193] -- 0:00:34
441500 -- [-605.779] (-607.776) (-604.719) (-610.269) * (-605.834) (-607.501) (-605.912) [-604.687] -- 0:00:34
442000 -- [-605.203] (-605.284) (-604.182) (-608.033) * (-603.944) [-608.714] (-604.272) (-603.909) -- 0:00:34
442500 -- [-605.523] (-606.101) (-604.056) (-605.587) * (-609.130) [-605.943] (-606.169) (-603.949) -- 0:00:34
443000 -- [-606.136] (-605.701) (-605.552) (-606.840) * (-606.578) (-607.430) (-606.579) [-604.127] -- 0:00:33
443500 -- (-603.952) (-604.916) [-605.445] (-606.139) * (-606.388) (-606.197) (-606.094) [-604.445] -- 0:00:33
444000 -- (-606.618) (-609.058) [-605.750] (-604.969) * [-605.487] (-607.225) (-605.098) (-604.109) -- 0:00:33
444500 -- (-606.069) (-612.372) [-608.699] (-607.793) * (-604.531) [-604.362] (-605.748) (-605.041) -- 0:00:33
445000 -- (-606.019) (-608.798) [-607.993] (-606.408) * (-604.661) [-605.399] (-607.777) (-606.478) -- 0:00:33
Average standard deviation of split frequencies: 0.013057
445500 -- (-605.037) (-606.100) (-605.933) [-607.212] * (-606.912) (-605.444) [-606.258] (-611.109) -- 0:00:33
446000 -- (-606.712) (-604.895) (-609.337) [-607.127] * (-605.430) (-605.194) [-608.843] (-606.611) -- 0:00:33
446500 -- [-606.104] (-604.451) (-604.865) (-605.378) * [-603.922] (-604.450) (-609.728) (-608.592) -- 0:00:33
447000 -- (-606.336) (-605.988) (-606.738) [-604.099] * [-605.094] (-605.982) (-605.588) (-605.900) -- 0:00:33
447500 -- (-606.433) (-605.231) [-606.179] (-605.979) * (-604.063) (-604.725) [-605.423] (-605.103) -- 0:00:33
448000 -- (-604.602) (-605.269) [-606.674] (-605.732) * [-605.234] (-604.241) (-608.793) (-607.775) -- 0:00:33
448500 -- (-609.564) (-605.369) [-606.457] (-605.530) * (-605.684) (-605.867) (-607.363) [-605.077] -- 0:00:33
449000 -- (-609.492) [-605.014] (-607.720) (-608.562) * (-609.771) (-605.364) [-605.541] (-605.272) -- 0:00:33
449500 -- [-605.344] (-604.106) (-604.497) (-604.777) * (-611.457) (-606.548) (-604.725) [-605.503] -- 0:00:34
450000 -- (-609.076) (-604.356) (-605.651) [-604.897] * (-607.940) (-609.060) (-607.510) [-605.947] -- 0:00:34
Average standard deviation of split frequencies: 0.013291
450500 -- (-604.982) [-604.623] (-606.553) (-606.965) * (-604.179) [-604.611] (-606.505) (-607.144) -- 0:00:34
451000 -- (-603.465) (-605.353) [-611.338] (-612.190) * (-607.507) (-604.558) [-605.731] (-605.541) -- 0:00:34
451500 -- (-607.858) [-606.636] (-606.816) (-607.651) * (-606.887) (-606.242) [-606.040] (-607.841) -- 0:00:34
452000 -- (-605.203) [-603.647] (-608.211) (-606.910) * (-606.359) (-604.833) (-609.251) [-605.419] -- 0:00:33
452500 -- (-605.213) (-606.870) [-608.237] (-607.136) * (-608.048) (-606.031) (-605.022) [-603.689] -- 0:00:33
453000 -- [-604.812] (-604.251) (-606.581) (-610.200) * (-608.092) [-606.235] (-608.515) (-603.709) -- 0:00:33
453500 -- (-605.636) [-604.507] (-606.518) (-609.295) * [-605.482] (-604.877) (-605.911) (-608.701) -- 0:00:33
454000 -- [-604.645] (-604.100) (-606.051) (-603.933) * (-603.637) [-604.168] (-604.391) (-604.835) -- 0:00:33
454500 -- (-606.426) (-605.279) (-609.479) [-606.774] * (-606.305) [-605.354] (-605.240) (-607.163) -- 0:00:33
455000 -- [-605.452] (-607.233) (-606.873) (-604.483) * [-606.146] (-605.766) (-604.707) (-607.281) -- 0:00:33
Average standard deviation of split frequencies: 0.013135
455500 -- (-605.948) [-604.777] (-606.434) (-605.600) * [-604.310] (-608.531) (-604.658) (-606.395) -- 0:00:33
456000 -- (-605.227) (-605.804) (-606.681) [-604.452] * (-603.945) [-606.287] (-606.545) (-604.284) -- 0:00:33
456500 -- (-609.654) (-606.470) [-605.581] (-604.463) * (-605.031) (-605.820) [-606.600] (-610.798) -- 0:00:33
457000 -- [-605.084] (-607.843) (-605.446) (-604.582) * (-604.816) [-604.803] (-607.978) (-606.740) -- 0:00:33
457500 -- [-606.197] (-606.039) (-605.445) (-604.895) * (-605.909) (-605.862) (-605.232) [-606.135] -- 0:00:33
458000 -- (-604.697) (-605.237) (-608.241) [-607.093] * (-607.759) [-609.701] (-606.486) (-608.598) -- 0:00:33
458500 -- [-605.139] (-604.807) (-605.216) (-605.518) * (-605.043) (-608.521) (-606.382) [-605.371] -- 0:00:33
459000 -- (-605.926) [-606.486] (-605.334) (-603.982) * [-604.594] (-604.431) (-606.402) (-605.387) -- 0:00:33
459500 -- [-604.997] (-604.748) (-604.951) (-604.908) * [-604.794] (-607.613) (-605.888) (-605.702) -- 0:00:32
460000 -- [-604.519] (-606.028) (-606.261) (-606.661) * (-603.963) (-608.054) (-604.976) [-606.774] -- 0:00:32
Average standard deviation of split frequencies: 0.012663
460500 -- (-604.876) (-605.355) [-606.319] (-605.059) * [-603.896] (-606.675) (-610.004) (-606.863) -- 0:00:32
461000 -- (-608.249) (-605.776) (-605.479) [-604.879] * (-604.090) [-604.261] (-606.141) (-607.920) -- 0:00:32
461500 -- (-606.180) [-607.755] (-607.170) (-605.809) * (-606.278) (-605.657) [-605.827] (-604.273) -- 0:00:32
462000 -- (-612.231) [-604.782] (-606.210) (-615.143) * (-608.278) (-607.702) [-604.878] (-608.529) -- 0:00:32
462500 -- [-604.488] (-605.043) (-605.820) (-605.229) * (-607.343) (-608.027) [-605.534] (-607.067) -- 0:00:32
463000 -- (-608.042) [-604.644] (-606.762) (-607.652) * (-605.659) (-607.257) (-604.867) [-607.737] -- 0:00:32
463500 -- (-607.745) (-607.245) [-605.398] (-604.566) * (-605.206) [-606.156] (-605.763) (-608.793) -- 0:00:32
464000 -- (-603.566) (-604.620) [-606.826] (-605.410) * [-605.505] (-606.112) (-605.101) (-606.079) -- 0:00:32
464500 -- (-606.646) (-607.153) [-603.631] (-604.206) * (-609.598) (-610.620) [-607.207] (-603.933) -- 0:00:32
465000 -- (-604.565) (-607.254) [-605.407] (-604.606) * (-603.945) (-607.501) [-605.545] (-604.102) -- 0:00:32
Average standard deviation of split frequencies: 0.012675
465500 -- (-604.514) [-603.969] (-604.196) (-606.236) * [-604.185] (-605.609) (-608.130) (-606.037) -- 0:00:33
466000 -- (-612.676) [-604.185] (-605.320) (-610.146) * (-607.332) (-606.842) [-607.831] (-604.423) -- 0:00:33
466500 -- (-614.713) (-606.745) [-608.913] (-605.152) * (-607.491) (-606.027) [-605.256] (-607.721) -- 0:00:33
467000 -- (-605.151) (-607.621) [-607.067] (-605.957) * (-610.925) (-605.575) (-604.522) [-605.610] -- 0:00:33
467500 -- [-607.535] (-610.310) (-604.445) (-606.001) * [-606.334] (-606.491) (-604.229) (-604.324) -- 0:00:33
468000 -- (-605.103) (-608.220) [-605.787] (-604.292) * [-603.945] (-608.665) (-606.343) (-604.378) -- 0:00:32
468500 -- (-603.534) [-607.573] (-604.964) (-605.282) * [-605.450] (-610.256) (-606.627) (-605.440) -- 0:00:32
469000 -- [-606.317] (-604.798) (-604.823) (-606.747) * (-608.448) (-605.263) [-607.176] (-605.016) -- 0:00:32
469500 -- [-608.059] (-607.832) (-606.735) (-608.071) * (-606.962) [-605.084] (-608.160) (-608.258) -- 0:00:32
470000 -- [-605.686] (-607.905) (-606.020) (-608.303) * (-604.840) (-607.894) (-608.670) [-604.750] -- 0:00:32
Average standard deviation of split frequencies: 0.013020
470500 -- (-607.601) [-603.796] (-606.150) (-606.500) * [-605.556] (-605.201) (-606.212) (-607.581) -- 0:00:32
471000 -- (-607.566) [-605.803] (-604.578) (-606.610) * (-605.073) (-608.088) (-605.730) [-605.498] -- 0:00:32
471500 -- (-605.054) (-607.332) (-607.088) [-607.546] * (-605.019) (-612.442) (-603.891) [-604.240] -- 0:00:32
472000 -- (-605.003) (-606.633) (-605.583) [-603.888] * [-605.393] (-610.247) (-607.925) (-605.819) -- 0:00:32
472500 -- (-605.515) (-604.214) [-605.452] (-614.573) * (-605.653) (-610.020) [-605.419] (-611.578) -- 0:00:32
473000 -- (-606.463) [-604.461] (-606.280) (-606.424) * [-603.689] (-606.065) (-607.712) (-604.622) -- 0:00:32
473500 -- (-608.515) (-604.383) [-607.915] (-607.983) * (-605.280) (-605.823) (-607.654) [-607.041] -- 0:00:32
474000 -- [-605.086] (-604.922) (-605.708) (-607.125) * [-607.984] (-605.934) (-604.627) (-606.591) -- 0:00:32
474500 -- (-606.446) (-604.863) (-611.436) [-607.208] * [-605.395] (-606.488) (-605.335) (-605.128) -- 0:00:32
475000 -- (-605.662) [-604.208] (-604.273) (-607.224) * [-605.990] (-611.689) (-607.174) (-606.215) -- 0:00:32
Average standard deviation of split frequencies: 0.013060
475500 -- (-605.163) (-607.638) [-605.171] (-605.613) * (-605.286) [-605.215] (-608.887) (-605.943) -- 0:00:31
476000 -- (-612.053) [-605.344] (-607.592) (-604.927) * (-605.722) [-604.910] (-606.714) (-605.841) -- 0:00:31
476500 -- [-605.476] (-605.710) (-605.477) (-603.919) * (-610.534) (-604.077) [-606.486] (-608.027) -- 0:00:31
477000 -- (-610.619) (-604.695) [-604.883] (-604.851) * (-606.600) (-609.962) (-605.299) [-606.309] -- 0:00:31
477500 -- (-612.087) [-605.420] (-605.168) (-611.110) * (-606.282) [-603.550] (-606.221) (-605.249) -- 0:00:31
478000 -- (-605.240) [-604.415] (-606.853) (-606.440) * (-605.749) (-604.658) (-607.534) [-605.123] -- 0:00:31
478500 -- (-609.223) (-604.538) [-605.482] (-610.949) * (-605.308) (-606.355) [-606.075] (-603.887) -- 0:00:31
479000 -- (-606.173) (-608.567) [-606.110] (-609.905) * (-607.763) (-611.618) (-604.854) [-603.682] -- 0:00:31
479500 -- [-604.333] (-606.603) (-604.827) (-605.704) * (-610.666) [-609.362] (-604.608) (-605.819) -- 0:00:31
480000 -- [-604.132] (-605.778) (-605.233) (-603.984) * (-610.825) (-606.365) [-606.905] (-605.373) -- 0:00:31
Average standard deviation of split frequencies: 0.012688
480500 -- (-604.285) (-607.725) (-605.265) [-604.347] * (-605.065) (-604.936) (-607.024) [-608.245] -- 0:00:31
481000 -- (-606.059) [-604.313] (-609.149) (-606.292) * (-604.298) (-604.055) (-604.700) [-608.515] -- 0:00:31
481500 -- (-606.853) [-604.101] (-604.969) (-605.103) * (-605.824) [-605.384] (-605.176) (-606.410) -- 0:00:31
482000 -- (-607.273) [-607.161] (-604.881) (-604.482) * (-605.558) (-603.933) [-607.443] (-609.022) -- 0:00:31
482500 -- (-608.030) (-607.901) (-603.675) [-605.604] * (-605.082) [-606.901] (-606.828) (-604.022) -- 0:00:32
483000 -- (-619.232) (-614.148) (-607.298) [-603.786] * (-607.507) [-607.625] (-604.775) (-607.554) -- 0:00:32
483500 -- [-604.890] (-608.741) (-609.509) (-604.467) * (-605.242) (-607.346) [-604.027] (-606.862) -- 0:00:32
484000 -- (-608.025) (-605.128) (-610.281) [-604.085] * [-603.964] (-605.747) (-605.595) (-608.022) -- 0:00:31
484500 -- (-604.488) (-607.175) [-604.216] (-606.433) * (-606.225) (-605.620) [-607.655] (-607.170) -- 0:00:31
485000 -- (-606.945) (-605.261) (-604.538) [-605.520] * (-608.197) (-605.178) [-605.378] (-608.488) -- 0:00:31
Average standard deviation of split frequencies: 0.012185
485500 -- (-604.056) (-606.164) [-606.068] (-606.936) * (-604.252) (-608.066) (-605.875) [-604.509] -- 0:00:31
486000 -- (-604.690) [-610.630] (-604.353) (-608.036) * (-605.001) (-604.615) [-604.689] (-606.663) -- 0:00:31
486500 -- (-605.371) (-606.699) (-604.543) [-606.855] * (-605.968) [-605.785] (-603.634) (-605.976) -- 0:00:31
487000 -- (-605.516) (-606.518) [-604.658] (-606.602) * (-606.092) (-607.135) (-606.531) [-608.890] -- 0:00:31
487500 -- (-604.364) (-604.088) (-605.776) [-605.755] * (-610.042) [-605.887] (-603.783) (-608.925) -- 0:00:31
488000 -- [-605.847] (-607.785) (-606.443) (-608.571) * (-604.937) (-603.973) [-607.477] (-604.139) -- 0:00:31
488500 -- (-605.992) [-607.394] (-606.860) (-607.288) * [-604.611] (-604.055) (-608.254) (-605.068) -- 0:00:31
489000 -- (-604.884) [-605.894] (-605.218) (-607.010) * (-604.734) (-605.094) [-606.192] (-603.794) -- 0:00:31
489500 -- (-605.505) [-604.582] (-604.772) (-605.042) * (-607.963) (-604.762) [-604.100] (-609.048) -- 0:00:31
490000 -- [-604.672] (-605.140) (-605.209) (-607.927) * [-605.031] (-604.011) (-605.746) (-606.440) -- 0:00:31
Average standard deviation of split frequencies: 0.012249
490500 -- (-605.828) (-605.265) [-605.890] (-605.345) * [-605.642] (-604.378) (-606.289) (-609.509) -- 0:00:31
491000 -- (-608.195) (-604.277) (-605.718) [-608.236] * (-607.554) [-603.996] (-606.534) (-608.978) -- 0:00:31
491500 -- (-606.507) (-603.767) (-604.375) [-604.141] * [-608.975] (-608.565) (-603.998) (-604.406) -- 0:00:31
492000 -- [-604.535] (-604.768) (-605.224) (-606.560) * (-607.027) (-606.493) (-608.440) [-605.869] -- 0:00:30
492500 -- [-604.419] (-605.616) (-604.846) (-606.151) * (-606.208) (-605.753) [-607.586] (-604.712) -- 0:00:30
493000 -- (-604.867) (-604.703) (-606.512) [-605.391] * (-605.302) (-607.347) (-607.229) [-605.575] -- 0:00:30
493500 -- (-609.360) (-604.968) (-607.057) [-606.707] * (-605.488) (-606.396) [-604.883] (-603.988) -- 0:00:30
494000 -- [-609.061] (-608.675) (-606.568) (-603.902) * (-605.352) (-609.660) (-605.532) [-605.657] -- 0:00:30
494500 -- [-606.514] (-609.732) (-606.759) (-605.429) * (-605.675) (-610.550) [-604.923] (-605.345) -- 0:00:30
495000 -- [-604.844] (-606.513) (-605.570) (-604.825) * (-607.746) (-606.181) (-611.165) [-607.592] -- 0:00:30
Average standard deviation of split frequencies: 0.011405
495500 -- (-610.380) (-605.015) [-604.121] (-607.891) * [-608.826] (-606.403) (-608.657) (-610.461) -- 0:00:30
496000 -- (-605.810) (-608.759) (-604.634) [-606.882] * (-607.150) [-606.884] (-606.160) (-607.366) -- 0:00:30
496500 -- [-604.358] (-605.519) (-604.467) (-604.669) * (-604.433) [-610.988] (-605.833) (-604.474) -- 0:00:30
497000 -- (-605.222) (-606.496) (-606.015) [-604.628] * (-604.630) [-605.422] (-606.611) (-605.973) -- 0:00:30
497500 -- (-608.522) (-604.408) [-604.102] (-605.716) * [-606.478] (-607.112) (-610.347) (-606.599) -- 0:00:31
498000 -- [-605.854] (-605.249) (-604.276) (-604.773) * [-609.837] (-607.336) (-611.662) (-604.107) -- 0:00:31
498500 -- (-605.539) (-607.238) [-607.968] (-605.362) * [-608.693] (-609.479) (-607.217) (-607.430) -- 0:00:31
499000 -- (-609.540) [-604.256] (-604.280) (-606.287) * (-606.262) (-609.195) (-605.725) [-606.615] -- 0:00:31
499500 -- [-608.649] (-605.169) (-603.919) (-607.127) * (-609.943) (-605.104) (-606.243) [-607.917] -- 0:00:31
500000 -- [-605.754] (-606.281) (-607.731) (-604.547) * [-606.651] (-609.652) (-606.683) (-605.388) -- 0:00:31
Average standard deviation of split frequencies: 0.011769
500500 -- (-607.181) (-607.255) [-605.650] (-606.543) * (-605.638) (-605.917) [-605.365] (-604.684) -- 0:00:30
501000 -- [-604.745] (-606.799) (-606.939) (-606.625) * (-608.014) (-605.569) (-607.518) [-605.459] -- 0:00:30
501500 -- [-604.328] (-605.997) (-606.752) (-604.559) * [-607.812] (-605.474) (-606.456) (-604.856) -- 0:00:30
502000 -- [-605.435] (-605.044) (-606.255) (-603.656) * [-606.769] (-610.995) (-606.729) (-608.846) -- 0:00:30
502500 -- (-605.090) (-607.764) (-608.845) [-604.497] * (-608.094) (-607.815) [-604.289] (-604.598) -- 0:00:30
503000 -- (-604.211) (-606.717) (-605.256) [-605.648] * (-604.793) (-608.991) [-606.444] (-606.043) -- 0:00:30
503500 -- (-606.636) (-610.938) (-606.014) [-607.244] * (-605.999) [-608.113] (-604.260) (-604.671) -- 0:00:30
504000 -- [-606.392] (-615.577) (-606.045) (-605.498) * (-605.589) [-607.026] (-605.187) (-605.065) -- 0:00:30
504500 -- (-604.269) [-606.610] (-605.293) (-606.187) * (-607.822) (-607.558) (-606.177) [-606.675] -- 0:00:30
505000 -- [-604.350] (-612.410) (-605.847) (-610.023) * (-606.471) (-611.071) [-604.619] (-605.983) -- 0:00:30
Average standard deviation of split frequencies: 0.011412
505500 -- [-605.707] (-605.814) (-608.440) (-606.837) * (-604.237) (-611.005) (-609.727) [-605.529] -- 0:00:30
506000 -- [-608.562] (-605.034) (-606.388) (-607.246) * (-604.630) (-607.110) [-605.449] (-605.678) -- 0:00:30
506500 -- (-606.260) (-605.790) [-605.818] (-605.791) * [-603.815] (-605.515) (-606.967) (-608.587) -- 0:00:30
507000 -- [-605.899] (-605.282) (-609.014) (-609.930) * (-607.505) (-604.442) (-604.556) [-605.483] -- 0:00:30
507500 -- (-606.318) (-606.041) (-604.766) [-607.726] * (-604.841) (-605.621) (-605.391) [-604.387] -- 0:00:30
508000 -- (-608.187) (-608.350) (-604.973) [-607.846] * (-611.334) (-605.840) [-607.279] (-607.259) -- 0:00:30
508500 -- (-605.412) (-606.404) [-604.354] (-608.482) * (-605.323) (-609.059) (-607.287) [-604.985] -- 0:00:29
509000 -- (-606.576) (-607.439) [-607.437] (-608.771) * (-605.316) [-605.418] (-606.470) (-603.643) -- 0:00:29
509500 -- [-604.201] (-605.879) (-603.979) (-605.935) * (-607.364) [-606.371] (-605.765) (-603.609) -- 0:00:29
510000 -- (-605.271) (-604.116) (-610.222) [-604.842] * (-609.767) (-605.000) [-603.880] (-605.976) -- 0:00:29
Average standard deviation of split frequencies: 0.011943
510500 -- (-607.029) [-606.307] (-608.458) (-604.445) * (-609.549) [-605.858] (-606.635) (-605.725) -- 0:00:29
511000 -- (-610.172) [-605.003] (-604.925) (-603.880) * (-604.616) [-604.955] (-604.168) (-607.294) -- 0:00:29
511500 -- [-606.895] (-606.916) (-606.764) (-603.787) * [-604.685] (-603.631) (-605.282) (-606.206) -- 0:00:29
512000 -- (-608.723) (-609.093) (-607.929) [-603.856] * (-607.044) (-604.619) [-606.211] (-607.995) -- 0:00:29
512500 -- (-606.336) (-607.117) (-608.443) [-604.260] * [-603.831] (-607.701) (-606.104) (-608.083) -- 0:00:29
513000 -- [-606.201] (-604.702) (-607.120) (-605.880) * (-605.539) (-605.757) [-607.334] (-607.401) -- 0:00:29
513500 -- (-603.925) [-604.539] (-605.056) (-605.701) * (-606.934) (-606.660) (-606.142) [-604.699] -- 0:00:29
514000 -- (-603.598) (-605.831) (-606.105) [-604.850] * (-608.223) [-607.353] (-604.761) (-605.361) -- 0:00:30
514500 -- (-604.269) (-606.916) [-605.996] (-609.800) * (-609.827) (-604.958) (-603.804) [-604.875] -- 0:00:30
515000 -- (-605.223) [-606.918] (-604.342) (-611.607) * (-607.644) (-603.760) (-607.512) [-606.616] -- 0:00:30
Average standard deviation of split frequencies: 0.012619
515500 -- (-604.869) [-605.307] (-605.936) (-606.268) * (-604.500) (-604.472) (-608.463) [-604.870] -- 0:00:30
516000 -- (-604.198) (-605.058) [-604.448] (-604.915) * (-604.822) [-605.252] (-605.916) (-605.907) -- 0:00:30
516500 -- (-604.435) [-603.476] (-604.445) (-605.518) * [-605.571] (-604.156) (-606.926) (-606.681) -- 0:00:29
517000 -- (-605.364) [-609.973] (-607.954) (-606.352) * (-605.287) (-604.946) [-604.198] (-606.467) -- 0:00:29
517500 -- (-606.096) (-607.146) [-605.795] (-605.640) * (-613.288) [-603.829] (-605.346) (-610.209) -- 0:00:29
518000 -- (-606.919) (-606.087) [-607.198] (-607.031) * [-604.065] (-605.830) (-604.964) (-613.635) -- 0:00:29
518500 -- [-604.091] (-605.041) (-604.256) (-606.589) * (-606.110) (-613.021) (-603.926) [-609.490] -- 0:00:29
519000 -- (-607.210) [-607.674] (-604.840) (-605.723) * (-605.369) (-603.942) [-608.204] (-606.079) -- 0:00:29
519500 -- (-604.954) (-605.223) (-605.372) [-607.253] * [-604.394] (-604.616) (-605.405) (-604.667) -- 0:00:29
520000 -- (-610.785) (-605.350) [-605.837] (-609.694) * (-603.769) (-604.957) (-603.989) [-605.444] -- 0:00:29
Average standard deviation of split frequencies: 0.011996
520500 -- (-605.024) (-604.890) [-605.437] (-604.101) * (-604.208) [-607.841] (-605.796) (-606.090) -- 0:00:29
521000 -- (-606.736) (-606.956) (-606.569) [-604.786] * (-604.581) (-609.563) (-605.160) [-604.152] -- 0:00:29
521500 -- (-605.548) (-609.003) [-606.788] (-604.274) * (-606.358) [-605.172] (-607.018) (-605.095) -- 0:00:29
522000 -- (-605.134) (-604.823) [-607.246] (-605.315) * (-604.548) (-604.425) (-605.719) [-606.045] -- 0:00:29
522500 -- (-606.470) [-604.843] (-605.204) (-605.340) * [-607.375] (-604.509) (-613.056) (-604.199) -- 0:00:29
523000 -- (-605.123) (-606.128) (-605.007) [-606.646] * (-604.167) [-604.822] (-609.325) (-611.277) -- 0:00:29
523500 -- (-608.253) [-604.565] (-604.287) (-604.110) * (-605.794) (-609.957) (-607.658) [-606.431] -- 0:00:29
524000 -- (-610.852) (-606.004) (-605.459) [-603.988] * (-607.041) (-610.898) (-605.564) [-606.688] -- 0:00:29
524500 -- (-604.360) [-606.667] (-605.168) (-605.005) * [-605.776] (-606.507) (-605.734) (-605.876) -- 0:00:29
525000 -- (-606.942) [-604.184] (-605.147) (-605.744) * (-606.564) (-606.018) (-606.497) [-605.331] -- 0:00:28
Average standard deviation of split frequencies: 0.011427
525500 -- (-604.118) (-604.670) [-604.504] (-604.756) * [-606.764] (-605.285) (-606.324) (-607.773) -- 0:00:28
526000 -- [-604.110] (-606.442) (-604.094) (-603.500) * (-606.204) [-605.071] (-608.322) (-605.787) -- 0:00:28
526500 -- (-606.994) (-608.843) (-604.032) [-605.144] * (-604.948) (-604.036) [-607.052] (-610.876) -- 0:00:28
527000 -- (-609.272) (-608.632) [-604.815] (-604.397) * [-608.800] (-604.386) (-607.308) (-604.558) -- 0:00:28
527500 -- (-604.391) [-604.794] (-603.844) (-606.109) * (-606.177) (-605.697) (-607.347) [-604.101] -- 0:00:28
528000 -- (-607.256) [-605.855] (-605.200) (-605.076) * (-608.674) (-607.222) (-608.722) [-606.861] -- 0:00:28
528500 -- (-605.256) [-606.452] (-607.018) (-605.758) * (-603.857) (-607.882) (-608.922) [-609.219] -- 0:00:28
529000 -- [-606.272] (-606.528) (-606.475) (-604.997) * (-604.957) (-606.877) [-607.788] (-609.271) -- 0:00:28
529500 -- [-605.621] (-608.844) (-605.853) (-605.542) * [-604.575] (-611.432) (-607.114) (-608.699) -- 0:00:28
530000 -- (-610.521) (-608.033) (-607.914) [-606.483] * [-606.396] (-610.225) (-605.752) (-605.254) -- 0:00:28
Average standard deviation of split frequencies: 0.011604
530500 -- [-605.014] (-605.110) (-607.203) (-608.107) * (-606.224) (-604.462) (-608.401) [-604.702] -- 0:00:29
531000 -- [-605.379] (-604.995) (-606.461) (-604.876) * (-606.552) (-607.322) (-606.702) [-605.729] -- 0:00:29
531500 -- (-608.921) [-612.505] (-606.963) (-604.777) * (-606.794) (-606.499) [-604.732] (-607.597) -- 0:00:29
532000 -- (-608.243) (-605.898) [-604.843] (-607.979) * (-607.457) [-604.896] (-606.280) (-604.994) -- 0:00:29
532500 -- (-611.837) (-605.529) (-603.932) [-606.415] * [-605.219] (-607.325) (-607.569) (-605.618) -- 0:00:28
533000 -- (-609.430) (-604.134) (-605.037) [-606.598] * (-605.638) (-611.775) (-605.912) [-608.866] -- 0:00:28
533500 -- (-605.852) (-606.186) [-608.918] (-606.363) * (-607.775) (-609.415) [-607.058] (-611.184) -- 0:00:28
534000 -- [-604.099] (-606.149) (-608.054) (-608.898) * (-606.923) [-605.227] (-606.435) (-607.985) -- 0:00:28
534500 -- [-604.130] (-607.212) (-604.359) (-605.282) * (-604.384) [-605.676] (-606.574) (-607.082) -- 0:00:28
535000 -- (-605.982) [-605.616] (-607.451) (-604.061) * (-605.522) (-607.872) (-606.763) [-605.057] -- 0:00:28
Average standard deviation of split frequencies: 0.011378
535500 -- [-603.457] (-606.504) (-606.279) (-604.184) * (-605.489) (-607.066) (-606.655) [-605.271] -- 0:00:28
536000 -- (-606.084) (-606.877) (-604.702) [-609.339] * (-607.615) [-605.741] (-605.290) (-605.506) -- 0:00:28
536500 -- (-606.329) (-607.768) [-604.244] (-607.123) * [-604.751] (-604.944) (-604.886) (-604.628) -- 0:00:28
537000 -- [-604.913] (-605.959) (-604.956) (-605.321) * (-604.708) (-604.482) [-605.386] (-606.558) -- 0:00:28
537500 -- [-604.781] (-609.781) (-610.021) (-607.346) * [-609.433] (-605.373) (-605.039) (-606.275) -- 0:00:28
538000 -- (-603.753) (-608.330) [-607.016] (-604.467) * (-605.919) (-605.520) [-605.124] (-606.900) -- 0:00:28
538500 -- (-608.275) (-605.353) [-606.108] (-604.662) * [-607.194] (-606.019) (-606.418) (-605.672) -- 0:00:28
539000 -- (-607.835) [-605.077] (-607.070) (-604.032) * (-604.390) (-606.623) [-606.612] (-607.163) -- 0:00:28
539500 -- (-607.190) (-605.132) [-606.293] (-605.690) * (-604.690) (-605.994) (-603.615) [-604.781] -- 0:00:28
540000 -- [-606.378] (-604.221) (-605.360) (-608.020) * (-613.582) (-604.560) [-606.374] (-605.942) -- 0:00:28
Average standard deviation of split frequencies: 0.011226
540500 -- (-607.233) (-604.464) (-606.557) [-604.438] * (-614.867) [-606.408] (-604.302) (-605.141) -- 0:00:28
541000 -- (-606.976) (-604.240) [-605.435] (-607.373) * (-610.313) (-606.959) [-605.308] (-608.158) -- 0:00:27
541500 -- (-606.641) (-607.736) (-604.865) [-605.231] * (-605.635) (-604.550) [-605.442] (-606.570) -- 0:00:27
542000 -- (-607.789) (-605.259) [-605.738] (-604.423) * (-605.656) (-603.901) (-607.719) [-606.871] -- 0:00:27
542500 -- (-606.531) [-604.520] (-606.943) (-605.966) * (-607.703) [-610.803] (-606.102) (-605.301) -- 0:00:27
543000 -- (-606.481) (-611.319) (-603.882) [-606.890] * (-606.185) (-605.400) (-604.008) [-607.200] -- 0:00:27
543500 -- (-607.293) (-606.588) (-608.597) [-605.136] * (-605.843) (-609.178) (-604.932) [-607.439] -- 0:00:27
544000 -- [-607.182] (-604.659) (-605.776) (-606.406) * (-603.996) (-606.006) [-606.212] (-607.183) -- 0:00:27
544500 -- (-605.012) (-606.667) (-606.138) [-604.246] * (-603.625) (-605.019) [-605.082] (-609.811) -- 0:00:27
545000 -- (-604.697) (-606.063) [-605.356] (-606.525) * [-603.967] (-606.053) (-608.547) (-604.398) -- 0:00:27
Average standard deviation of split frequencies: 0.011386
545500 -- (-605.452) (-605.437) (-604.351) [-609.899] * (-605.284) [-604.509] (-607.043) (-604.165) -- 0:00:27
546000 -- (-605.216) [-604.661] (-603.964) (-605.262) * (-607.582) [-606.458] (-606.831) (-606.895) -- 0:00:28
546500 -- (-604.362) (-604.643) [-603.894] (-604.075) * (-604.954) [-604.616] (-606.722) (-604.979) -- 0:00:28
547000 -- (-612.396) [-604.268] (-604.469) (-604.167) * [-604.375] (-606.817) (-607.431) (-607.275) -- 0:00:28
547500 -- [-608.024] (-604.601) (-604.381) (-609.058) * (-604.194) [-605.083] (-606.738) (-604.301) -- 0:00:28
548000 -- (-606.459) [-604.200] (-604.978) (-606.701) * (-604.526) (-604.612) (-604.373) [-604.764] -- 0:00:28
548500 -- (-605.057) (-604.578) (-607.507) [-605.217] * [-605.997] (-605.821) (-604.668) (-609.943) -- 0:00:27
549000 -- (-604.490) (-604.643) [-605.531] (-605.885) * (-609.855) (-604.605) [-604.876] (-606.425) -- 0:00:27
549500 -- (-606.344) (-607.037) [-605.363] (-605.335) * (-606.428) (-604.409) (-604.807) [-604.951] -- 0:00:27
550000 -- (-604.363) (-604.848) (-606.740) [-604.179] * (-608.381) (-608.273) (-608.357) [-605.428] -- 0:00:27
Average standard deviation of split frequencies: 0.011557
550500 -- (-604.872) (-607.141) (-606.579) [-604.054] * [-609.844] (-605.750) (-605.855) (-610.912) -- 0:00:27
551000 -- [-603.650] (-607.212) (-605.713) (-604.200) * (-607.650) (-604.866) (-606.348) [-611.378] -- 0:00:27
551500 -- (-604.873) [-608.388] (-606.696) (-603.729) * [-606.787] (-607.356) (-607.008) (-604.497) -- 0:00:27
552000 -- (-605.234) (-605.618) [-606.031] (-605.519) * (-603.587) (-605.493) (-604.558) [-604.584] -- 0:00:27
552500 -- [-605.788] (-603.921) (-608.049) (-604.043) * [-604.901] (-604.949) (-606.736) (-605.521) -- 0:00:27
553000 -- (-607.517) [-608.069] (-606.416) (-605.792) * (-604.129) [-606.105] (-604.273) (-603.656) -- 0:00:27
553500 -- (-606.983) (-608.437) (-606.049) [-606.005] * [-603.802] (-606.272) (-610.215) (-604.374) -- 0:00:27
554000 -- [-606.460] (-616.120) (-607.134) (-609.907) * [-605.917] (-612.313) (-607.442) (-604.432) -- 0:00:27
554500 -- (-604.468) (-607.852) (-607.051) [-603.974] * (-605.489) [-606.489] (-606.038) (-606.872) -- 0:00:27
555000 -- (-606.203) (-605.248) [-607.837] (-603.716) * [-606.313] (-606.480) (-607.509) (-607.004) -- 0:00:27
Average standard deviation of split frequencies: 0.011552
555500 -- (-607.347) [-605.751] (-604.515) (-605.089) * (-605.403) [-605.405] (-610.815) (-612.489) -- 0:00:27
556000 -- (-609.701) (-606.070) [-605.646] (-607.324) * (-608.805) [-604.949] (-610.713) (-608.313) -- 0:00:27
556500 -- (-606.222) (-606.527) [-604.798] (-610.984) * (-604.391) [-607.627] (-607.980) (-604.697) -- 0:00:27
557000 -- (-605.480) (-609.478) [-603.724] (-608.556) * (-607.486) (-606.247) (-604.936) [-604.192] -- 0:00:27
557500 -- (-607.286) (-605.966) [-605.611] (-604.809) * (-608.625) [-606.289] (-605.248) (-605.761) -- 0:00:26
558000 -- (-605.643) (-604.796) [-606.089] (-607.977) * [-606.057] (-608.200) (-604.859) (-604.457) -- 0:00:26
558500 -- [-605.944] (-605.386) (-607.350) (-609.582) * [-605.262] (-607.423) (-605.136) (-609.311) -- 0:00:26
559000 -- (-606.970) [-605.354] (-605.971) (-607.403) * (-609.304) (-604.538) (-604.742) [-604.897] -- 0:00:26
559500 -- (-605.086) (-606.107) (-605.512) [-604.553] * (-605.893) [-604.481] (-608.295) (-611.612) -- 0:00:26
560000 -- (-604.739) (-604.532) [-604.284] (-604.971) * [-609.511] (-607.498) (-608.912) (-611.159) -- 0:00:26
Average standard deviation of split frequencies: 0.011246
560500 -- (-604.788) (-605.308) [-603.827] (-604.681) * [-604.180] (-606.969) (-608.239) (-611.017) -- 0:00:26
561000 -- (-605.972) (-610.733) [-606.329] (-603.823) * (-603.529) (-606.446) (-605.699) [-604.782] -- 0:00:26
561500 -- [-604.386] (-609.367) (-605.786) (-608.955) * [-605.222] (-606.150) (-604.356) (-608.302) -- 0:00:26
562000 -- [-605.416] (-605.428) (-606.136) (-605.978) * (-603.611) (-607.224) (-604.254) [-605.019] -- 0:00:26
562500 -- [-609.787] (-605.944) (-605.619) (-608.963) * [-607.219] (-604.599) (-604.825) (-605.767) -- 0:00:27
563000 -- (-605.474) (-604.120) (-605.773) [-611.920] * (-606.371) (-603.614) (-604.764) [-604.818] -- 0:00:27
563500 -- (-606.130) (-604.873) [-604.564] (-606.653) * (-606.165) [-606.984] (-608.053) (-605.672) -- 0:00:27
564000 -- (-606.160) (-604.711) [-604.029] (-606.941) * (-606.958) (-607.327) (-608.419) [-605.822] -- 0:00:27
564500 -- [-605.311] (-607.994) (-603.942) (-605.685) * (-605.250) (-605.437) (-609.081) [-605.596] -- 0:00:27
565000 -- [-604.381] (-605.301) (-603.720) (-605.505) * (-604.364) (-611.998) (-604.724) [-607.197] -- 0:00:26
Average standard deviation of split frequencies: 0.011504
565500 -- [-607.436] (-606.523) (-605.200) (-608.173) * (-605.011) (-605.141) (-609.515) [-608.094] -- 0:00:26
566000 -- (-604.228) [-605.415] (-603.781) (-606.454) * (-609.988) (-606.703) [-604.600] (-610.686) -- 0:00:26
566500 -- [-604.046] (-604.956) (-605.736) (-605.328) * (-608.689) (-603.715) [-603.791] (-606.629) -- 0:00:26
567000 -- (-604.012) (-609.473) (-603.830) [-607.823] * (-604.789) [-603.662] (-604.912) (-605.199) -- 0:00:26
567500 -- [-607.152] (-605.321) (-604.249) (-604.925) * [-605.211] (-604.910) (-604.035) (-607.882) -- 0:00:26
568000 -- [-608.644] (-604.487) (-604.658) (-605.453) * (-609.582) [-609.390] (-607.608) (-605.845) -- 0:00:26
568500 -- (-604.862) (-603.805) [-607.272] (-609.861) * (-606.952) (-607.077) (-612.457) [-605.592] -- 0:00:26
569000 -- (-604.747) (-605.072) (-605.847) [-604.303] * [-605.523] (-605.146) (-609.697) (-604.580) -- 0:00:26
569500 -- (-606.438) (-604.961) (-610.477) [-604.882] * (-605.969) [-605.755] (-609.064) (-604.142) -- 0:00:26
570000 -- (-606.482) (-606.161) (-614.570) [-607.911] * (-607.336) (-608.610) (-605.364) [-605.062] -- 0:00:26
Average standard deviation of split frequencies: 0.011203
570500 -- (-607.184) (-606.396) [-606.819] (-606.385) * [-604.865] (-607.697) (-605.799) (-607.025) -- 0:00:26
571000 -- (-605.584) (-606.200) (-604.376) [-603.605] * [-606.747] (-604.725) (-606.524) (-605.494) -- 0:00:26
571500 -- (-605.513) (-603.765) (-606.604) [-604.829] * [-606.600] (-604.812) (-605.001) (-604.596) -- 0:00:26
572000 -- (-605.018) [-604.821] (-604.320) (-604.626) * [-607.614] (-607.015) (-605.928) (-605.707) -- 0:00:26
572500 -- (-606.276) (-607.171) [-605.004] (-605.801) * (-604.897) [-606.526] (-605.861) (-606.777) -- 0:00:26
573000 -- (-605.903) (-604.724) (-605.298) [-604.854] * [-606.217] (-605.888) (-605.904) (-607.089) -- 0:00:26
573500 -- (-605.532) [-605.240] (-605.963) (-603.932) * (-611.039) (-607.354) (-607.081) [-604.810] -- 0:00:26
574000 -- (-605.647) [-604.445] (-605.997) (-606.163) * (-611.242) (-606.641) (-606.430) [-604.003] -- 0:00:25
574500 -- (-605.872) [-603.890] (-606.204) (-607.960) * (-607.413) (-604.556) (-606.049) [-604.125] -- 0:00:25
575000 -- [-604.302] (-606.621) (-607.174) (-605.568) * (-608.803) (-604.286) (-606.566) [-607.424] -- 0:00:25
Average standard deviation of split frequencies: 0.011151
575500 -- (-605.305) (-603.983) (-605.132) [-605.128] * (-610.307) (-610.610) (-606.331) [-605.454] -- 0:00:25
576000 -- (-605.368) (-603.917) (-607.354) [-603.984] * [-611.383] (-605.637) (-609.773) (-607.384) -- 0:00:25
576500 -- (-606.080) (-606.398) [-606.499] (-604.589) * (-608.647) (-606.573) (-608.369) [-605.055] -- 0:00:25
577000 -- (-604.558) (-606.196) [-607.059] (-605.100) * (-609.306) (-604.182) [-607.978] (-607.080) -- 0:00:25
577500 -- (-606.606) (-606.262) (-607.224) [-604.263] * [-607.974] (-604.606) (-604.494) (-605.268) -- 0:00:25
578000 -- (-606.872) [-604.848] (-605.896) (-605.044) * (-604.681) (-604.550) (-609.187) [-604.606] -- 0:00:25
578500 -- (-605.312) (-611.136) [-605.200] (-605.803) * [-607.993] (-604.558) (-608.132) (-604.338) -- 0:00:25
579000 -- [-605.060] (-608.087) (-606.289) (-605.882) * (-607.829) [-604.526] (-606.504) (-611.008) -- 0:00:26
579500 -- (-605.381) (-607.861) [-606.301] (-606.783) * (-605.656) (-605.049) [-606.896] (-610.970) -- 0:00:26
580000 -- [-604.875] (-608.855) (-608.767) (-604.677) * (-606.316) [-605.356] (-607.999) (-608.250) -- 0:00:26
Average standard deviation of split frequencies: 0.011315
580500 -- (-607.775) (-605.357) (-608.219) [-605.108] * (-607.467) [-604.925] (-604.679) (-609.508) -- 0:00:26
581000 -- (-606.679) [-605.442] (-607.267) (-605.126) * (-605.611) (-605.306) [-608.832] (-604.261) -- 0:00:25
581500 -- (-605.511) [-609.591] (-605.115) (-605.009) * (-606.613) (-606.464) [-606.053] (-607.580) -- 0:00:25
582000 -- (-607.180) (-610.699) [-605.688] (-606.537) * (-604.420) [-604.698] (-608.478) (-607.315) -- 0:00:25
582500 -- (-607.771) (-608.862) [-606.475] (-606.988) * (-605.181) [-606.079] (-608.864) (-605.299) -- 0:00:25
583000 -- (-606.559) (-604.804) (-607.457) [-606.259] * (-607.730) (-610.825) (-606.353) [-607.065] -- 0:00:25
583500 -- (-604.500) (-604.494) [-605.759] (-604.370) * (-608.502) (-604.231) (-606.189) [-607.036] -- 0:00:25
584000 -- [-604.866] (-603.934) (-608.410) (-604.721) * [-606.728] (-604.289) (-607.812) (-605.545) -- 0:00:25
584500 -- (-609.594) [-604.767] (-605.105) (-605.149) * (-604.259) (-605.299) (-605.178) [-605.570] -- 0:00:25
585000 -- (-605.172) (-604.831) (-604.738) [-607.443] * (-604.259) [-604.380] (-605.867) (-604.955) -- 0:00:25
Average standard deviation of split frequencies: 0.011664
585500 -- [-608.028] (-606.066) (-610.104) (-607.841) * [-604.447] (-604.677) (-606.680) (-607.346) -- 0:00:25
586000 -- [-606.433] (-604.260) (-608.507) (-606.197) * (-605.828) (-605.426) [-607.420] (-605.919) -- 0:00:25
586500 -- [-605.694] (-608.974) (-606.051) (-604.819) * (-604.400) [-607.729] (-609.441) (-608.214) -- 0:00:25
587000 -- (-604.745) (-605.144) [-604.717] (-607.483) * (-605.587) (-607.644) [-606.478] (-609.031) -- 0:00:25
587500 -- (-604.715) [-605.814] (-605.143) (-607.483) * (-606.865) [-607.470] (-612.759) (-608.637) -- 0:00:25
588000 -- (-604.809) (-605.395) (-604.761) [-604.809] * (-605.952) (-607.485) [-606.831] (-607.019) -- 0:00:25
588500 -- [-606.427] (-604.534) (-605.474) (-608.485) * (-604.344) (-609.684) [-605.122] (-609.489) -- 0:00:25
589000 -- (-614.492) (-607.837) [-604.707] (-606.612) * (-605.754) [-604.601] (-605.404) (-608.795) -- 0:00:25
589500 -- (-606.385) (-605.472) (-605.449) [-604.077] * (-607.983) [-607.810] (-604.195) (-607.182) -- 0:00:25
590000 -- (-605.052) (-607.782) (-605.084) [-605.874] * (-605.636) [-605.602] (-604.210) (-606.464) -- 0:00:25
Average standard deviation of split frequencies: 0.010475
590500 -- (-604.180) (-607.239) [-607.652] (-605.669) * [-609.258] (-604.949) (-604.211) (-607.171) -- 0:00:24
591000 -- (-605.937) [-606.138] (-607.342) (-606.642) * (-609.505) (-604.300) (-604.532) [-607.721] -- 0:00:24
591500 -- [-603.894] (-606.277) (-606.806) (-608.751) * (-605.073) (-604.925) [-603.736] (-609.806) -- 0:00:24
592000 -- (-606.010) [-604.284] (-609.076) (-604.328) * [-604.149] (-606.769) (-604.844) (-613.963) -- 0:00:24
592500 -- (-605.903) [-605.291] (-603.974) (-606.458) * (-610.703) (-606.047) [-605.581] (-605.642) -- 0:00:24
593000 -- (-606.538) [-611.536] (-604.809) (-604.791) * (-607.017) [-605.889] (-607.720) (-604.673) -- 0:00:24
593500 -- (-606.145) (-606.466) (-608.172) [-607.203] * (-605.282) (-606.633) (-609.518) [-604.833] -- 0:00:24
594000 -- (-609.015) (-609.359) [-608.974] (-607.077) * (-606.298) (-604.803) [-605.442] (-605.135) -- 0:00:24
594500 -- (-604.589) [-610.973] (-608.202) (-605.206) * (-607.726) (-606.073) (-605.616) [-604.552] -- 0:00:24
595000 -- (-606.435) (-607.554) [-608.301] (-605.882) * [-605.356] (-604.180) (-604.040) (-605.571) -- 0:00:24
Average standard deviation of split frequencies: 0.010332
595500 -- [-605.489] (-605.488) (-604.734) (-607.672) * [-605.827] (-607.934) (-604.429) (-605.666) -- 0:00:25
596000 -- (-604.509) (-604.539) (-604.832) [-605.935] * (-605.720) (-604.764) (-607.855) [-606.054] -- 0:00:25
596500 -- [-604.384] (-604.888) (-604.936) (-604.726) * [-605.930] (-604.173) (-605.590) (-605.691) -- 0:00:25
597000 -- (-605.701) (-604.652) [-606.814] (-604.059) * (-604.835) [-608.361] (-608.541) (-611.588) -- 0:00:24
597500 -- [-604.123] (-604.618) (-607.161) (-604.552) * (-604.519) (-607.694) [-606.965] (-611.819) -- 0:00:24
598000 -- (-603.764) [-605.308] (-607.032) (-607.084) * [-604.292] (-605.300) (-606.362) (-608.516) -- 0:00:24
598500 -- [-604.969] (-608.412) (-606.418) (-604.088) * (-607.066) (-607.078) (-605.451) [-607.162] -- 0:00:24
599000 -- [-604.088] (-606.047) (-610.831) (-608.294) * [-606.119] (-605.524) (-605.182) (-606.266) -- 0:00:24
599500 -- (-607.129) (-603.513) [-606.583] (-608.195) * (-605.597) (-604.856) [-605.148] (-604.425) -- 0:00:24
600000 -- (-606.390) (-606.592) (-604.725) [-606.679] * (-607.810) (-609.440) [-606.876] (-608.112) -- 0:00:24
Average standard deviation of split frequencies: 0.009510
600500 -- (-605.336) (-605.473) [-605.565] (-607.541) * (-605.611) (-606.525) (-603.899) [-604.903] -- 0:00:24
601000 -- (-604.659) [-603.956] (-607.163) (-604.267) * (-603.947) [-604.541] (-609.899) (-606.446) -- 0:00:24
601500 -- (-605.397) (-604.796) [-606.255] (-604.210) * [-608.244] (-608.690) (-607.068) (-606.372) -- 0:00:24
602000 -- (-604.475) (-606.487) (-607.372) [-603.624] * (-604.372) (-605.574) [-603.801] (-606.164) -- 0:00:24
602500 -- (-607.157) (-609.587) [-605.332] (-603.493) * [-605.699] (-604.271) (-609.423) (-605.289) -- 0:00:24
603000 -- [-604.436] (-606.332) (-606.554) (-606.873) * [-605.650] (-604.171) (-603.619) (-604.969) -- 0:00:24
603500 -- (-608.329) (-609.486) (-604.357) [-604.994] * (-608.917) (-604.545) [-605.423] (-608.072) -- 0:00:24
604000 -- (-606.747) (-608.493) [-604.287] (-605.146) * [-610.560] (-605.754) (-605.230) (-605.371) -- 0:00:24
604500 -- (-608.185) (-610.478) (-604.222) [-605.197] * [-605.359] (-604.417) (-608.377) (-603.816) -- 0:00:24
605000 -- [-606.026] (-607.246) (-605.712) (-606.462) * (-606.953) [-606.077] (-604.884) (-605.365) -- 0:00:24
Average standard deviation of split frequencies: 0.009243
605500 -- (-606.904) (-604.605) (-604.347) [-607.630] * [-607.125] (-605.748) (-607.846) (-605.777) -- 0:00:24
606000 -- [-604.707] (-603.967) (-608.498) (-604.989) * (-612.488) [-604.050] (-606.533) (-605.565) -- 0:00:24
606500 -- (-604.664) (-606.466) [-605.017] (-605.155) * (-606.097) (-608.701) [-605.104] (-606.316) -- 0:00:24
607000 -- (-605.399) [-604.066] (-608.345) (-605.208) * (-603.842) (-606.724) [-606.096] (-608.359) -- 0:00:23
607500 -- (-604.457) (-604.146) [-606.875] (-606.350) * (-606.192) (-605.123) [-605.583] (-605.239) -- 0:00:23
608000 -- (-604.209) [-605.088] (-605.234) (-608.998) * (-604.853) (-604.868) [-604.136] (-604.357) -- 0:00:23
608500 -- [-605.468] (-605.272) (-606.906) (-605.485) * (-605.645) (-604.216) [-607.535] (-605.761) -- 0:00:23
609000 -- [-605.812] (-606.983) (-607.103) (-605.750) * (-605.043) (-604.848) (-606.509) [-604.219] -- 0:00:23
609500 -- [-607.228] (-605.336) (-604.184) (-614.092) * (-604.289) [-604.685] (-608.977) (-607.410) -- 0:00:23
610000 -- (-607.567) [-604.516] (-607.557) (-605.691) * (-603.789) (-604.984) [-605.365] (-603.915) -- 0:00:23
Average standard deviation of split frequencies: 0.009173
610500 -- (-608.714) (-604.867) (-604.341) [-608.362] * [-603.627] (-607.767) (-604.976) (-606.015) -- 0:00:23
611000 -- [-607.326] (-611.465) (-606.157) (-608.143) * [-607.082] (-605.323) (-605.195) (-603.769) -- 0:00:23
611500 -- (-607.087) (-606.554) (-607.031) [-606.002] * (-608.314) (-605.545) [-604.226] (-605.325) -- 0:00:23
612000 -- (-603.625) (-607.305) [-605.328] (-607.152) * [-605.297] (-607.939) (-604.487) (-606.152) -- 0:00:23
612500 -- (-604.408) [-604.343] (-605.799) (-610.341) * (-605.147) (-605.630) [-604.871] (-604.633) -- 0:00:24
613000 -- (-604.064) (-608.772) [-603.827] (-609.240) * (-606.424) (-612.281) (-606.321) [-604.032] -- 0:00:23
613500 -- [-606.648] (-615.997) (-604.279) (-605.447) * (-606.712) (-610.830) (-606.210) [-604.816] -- 0:00:23
614000 -- (-608.188) (-604.994) [-603.965] (-606.715) * (-608.743) (-606.674) [-605.001] (-605.860) -- 0:00:23
614500 -- (-605.703) (-604.497) (-604.009) [-605.334] * (-604.072) (-607.305) [-606.036] (-606.638) -- 0:00:23
615000 -- (-604.889) (-605.126) [-611.060] (-609.321) * [-604.418] (-606.086) (-604.727) (-606.123) -- 0:00:23
Average standard deviation of split frequencies: 0.009279
615500 -- (-604.882) (-605.977) [-605.103] (-606.031) * (-604.471) (-605.900) (-605.587) [-605.262] -- 0:00:23
616000 -- (-606.844) [-606.131] (-607.175) (-605.281) * (-604.312) (-606.737) (-607.089) [-605.944] -- 0:00:23
616500 -- (-608.415) [-605.947] (-606.345) (-605.927) * (-603.760) (-607.354) (-606.273) [-607.532] -- 0:00:23
617000 -- (-607.272) (-605.117) [-604.266] (-609.141) * (-606.591) (-605.695) [-605.780] (-605.922) -- 0:00:23
617500 -- (-606.678) (-607.187) (-611.362) [-604.162] * (-605.255) [-604.783] (-606.507) (-607.995) -- 0:00:23
618000 -- (-609.833) (-608.402) (-605.405) [-605.214] * (-607.244) (-606.139) [-604.759] (-607.561) -- 0:00:23
618500 -- (-611.548) (-605.325) (-608.960) [-605.278] * (-608.742) (-607.573) (-605.273) [-607.308] -- 0:00:23
619000 -- (-607.147) (-606.086) [-604.619] (-604.170) * (-611.499) [-604.558] (-606.571) (-603.700) -- 0:00:23
619500 -- (-607.713) (-606.919) [-604.550] (-612.478) * (-607.588) (-606.647) [-603.999] (-604.962) -- 0:00:23
620000 -- [-604.505] (-604.606) (-604.254) (-604.911) * (-605.162) [-605.421] (-604.796) (-607.779) -- 0:00:23
Average standard deviation of split frequencies: 0.009067
620500 -- (-608.273) (-608.188) [-604.229] (-610.395) * [-607.370] (-606.492) (-605.728) (-606.961) -- 0:00:23
621000 -- (-604.594) (-607.795) [-608.854] (-605.602) * (-605.901) [-606.382] (-607.271) (-609.611) -- 0:00:23
621500 -- [-609.288] (-605.585) (-604.866) (-609.818) * (-604.752) [-604.934] (-608.620) (-605.377) -- 0:00:23
622000 -- (-608.520) (-604.807) [-604.850] (-604.495) * (-605.404) [-608.447] (-609.979) (-604.882) -- 0:00:23
622500 -- (-611.025) (-604.245) (-608.724) [-603.546] * (-608.688) (-606.529) [-609.598] (-604.333) -- 0:00:23
623000 -- (-608.557) (-605.043) [-605.458] (-604.794) * (-609.947) [-606.181] (-606.108) (-603.577) -- 0:00:22
623500 -- [-605.106] (-603.771) (-610.183) (-604.824) * [-612.002] (-605.229) (-607.240) (-605.021) -- 0:00:22
624000 -- (-605.345) (-605.917) (-607.563) [-607.818] * (-609.020) [-604.723] (-606.474) (-605.359) -- 0:00:22
624500 -- (-603.867) [-608.968] (-607.884) (-604.090) * (-611.798) (-604.431) [-605.528] (-605.304) -- 0:00:22
625000 -- (-605.173) [-605.911] (-609.495) (-609.429) * (-607.250) [-606.047] (-605.869) (-605.063) -- 0:00:22
Average standard deviation of split frequencies: 0.009460
625500 -- [-605.703] (-603.862) (-609.059) (-608.376) * (-605.387) (-611.816) [-604.819] (-603.726) -- 0:00:22
626000 -- (-609.609) (-604.076) [-604.550] (-607.012) * (-604.108) (-607.043) [-606.218] (-606.062) -- 0:00:22
626500 -- (-605.093) (-605.567) [-607.004] (-607.826) * (-606.928) (-605.627) (-605.884) [-605.928] -- 0:00:22
627000 -- [-605.369] (-610.189) (-605.307) (-606.218) * (-605.811) (-610.538) [-605.502] (-605.145) -- 0:00:22
627500 -- (-605.418) (-604.852) [-608.126] (-609.241) * (-606.766) [-605.931] (-605.260) (-606.597) -- 0:00:22
628000 -- [-604.524] (-604.710) (-610.639) (-605.539) * (-612.191) (-606.381) (-607.446) [-605.905] -- 0:00:22
628500 -- (-604.640) (-605.007) (-606.175) [-605.230] * (-609.096) (-605.360) [-608.149] (-604.283) -- 0:00:22
629000 -- [-606.765] (-604.740) (-605.681) (-604.053) * (-605.260) [-605.193] (-605.952) (-607.554) -- 0:00:23
629500 -- (-606.185) (-605.881) [-604.287] (-607.559) * [-607.967] (-605.477) (-606.043) (-605.397) -- 0:00:22
630000 -- (-603.985) (-604.995) [-604.290] (-609.596) * [-606.531] (-605.752) (-606.541) (-604.796) -- 0:00:22
Average standard deviation of split frequencies: 0.009670
630500 -- (-607.303) (-605.337) (-607.245) [-607.153] * (-605.202) (-604.352) [-605.822] (-604.807) -- 0:00:22
631000 -- [-605.982] (-609.896) (-605.373) (-607.329) * [-607.280] (-605.236) (-608.899) (-607.652) -- 0:00:22
631500 -- (-604.385) (-607.043) [-604.982] (-604.413) * (-605.256) (-606.411) (-603.826) [-605.490] -- 0:00:22
632000 -- (-605.376) [-607.323] (-608.583) (-604.596) * [-605.366] (-604.958) (-604.090) (-604.736) -- 0:00:22
632500 -- [-606.413] (-604.280) (-605.609) (-603.996) * (-606.795) (-606.612) (-604.168) [-606.006] -- 0:00:22
633000 -- (-605.747) (-609.241) (-605.416) [-606.346] * (-604.851) [-607.237] (-607.954) (-605.282) -- 0:00:22
633500 -- (-603.638) (-607.185) [-608.028] (-606.209) * [-604.091] (-608.893) (-604.626) (-605.037) -- 0:00:22
634000 -- (-606.791) (-607.866) [-607.797] (-610.486) * (-604.077) (-607.871) (-605.722) [-606.579] -- 0:00:22
634500 -- (-603.896) (-605.676) [-607.436] (-606.286) * (-604.095) (-609.144) [-604.369] (-605.174) -- 0:00:22
635000 -- [-603.885] (-607.030) (-605.185) (-604.168) * (-605.021) (-614.328) (-605.613) [-604.245] -- 0:00:22
Average standard deviation of split frequencies: 0.009589
635500 -- (-606.257) (-604.131) [-605.829] (-604.173) * (-606.409) [-605.679] (-606.627) (-607.149) -- 0:00:22
636000 -- [-606.204] (-605.154) (-606.163) (-605.174) * (-607.423) (-604.566) (-604.944) [-607.625] -- 0:00:22
636500 -- (-605.207) [-605.917] (-604.362) (-605.346) * (-605.066) (-605.455) (-603.799) [-604.097] -- 0:00:22
637000 -- (-606.693) [-605.174] (-604.321) (-605.460) * [-605.235] (-608.061) (-604.008) (-604.321) -- 0:00:22
637500 -- (-605.163) [-607.460] (-606.455) (-607.313) * [-606.141] (-604.537) (-607.798) (-604.835) -- 0:00:22
638000 -- [-605.978] (-605.356) (-606.880) (-607.556) * (-604.325) (-607.191) [-604.203] (-607.716) -- 0:00:22
638500 -- (-605.362) [-604.981] (-605.159) (-608.419) * (-607.957) [-605.119] (-605.283) (-606.488) -- 0:00:22
639000 -- (-604.750) (-604.323) [-606.205] (-606.554) * (-605.357) [-606.340] (-605.759) (-606.356) -- 0:00:22
639500 -- [-604.927] (-611.953) (-611.517) (-608.045) * [-607.339] (-606.131) (-604.260) (-606.649) -- 0:00:21
640000 -- (-608.064) (-608.435) (-606.310) [-606.130] * [-607.125] (-605.612) (-605.859) (-605.429) -- 0:00:21
Average standard deviation of split frequencies: 0.009565
640500 -- (-605.526) [-606.802] (-611.751) (-605.157) * [-609.644] (-604.110) (-605.054) (-609.383) -- 0:00:21
641000 -- (-605.525) [-604.816] (-612.756) (-605.322) * (-607.396) (-604.371) [-605.425] (-606.726) -- 0:00:21
641500 -- [-605.252] (-606.550) (-605.090) (-607.843) * (-607.307) (-605.212) [-604.230] (-609.144) -- 0:00:21
642000 -- (-605.196) [-607.099] (-605.591) (-605.346) * (-609.891) (-604.663) [-606.645] (-607.898) -- 0:00:21
642500 -- (-604.905) (-604.423) [-607.513] (-606.597) * (-609.341) (-605.452) [-604.863] (-604.924) -- 0:00:21
643000 -- (-604.492) (-606.198) [-609.428] (-606.307) * [-604.740] (-603.912) (-605.495) (-606.982) -- 0:00:21
643500 -- (-606.455) (-605.568) [-606.123] (-605.388) * (-606.591) (-605.048) [-609.903] (-606.481) -- 0:00:21
644000 -- (-606.385) (-605.516) [-610.640] (-605.858) * (-606.666) (-605.294) (-606.826) [-605.557] -- 0:00:21
644500 -- (-608.659) (-605.018) [-607.880] (-605.387) * [-605.099] (-606.393) (-603.613) (-604.967) -- 0:00:21
645000 -- (-607.300) (-606.271) [-606.463] (-606.297) * (-606.762) (-605.051) [-604.528] (-605.159) -- 0:00:21
Average standard deviation of split frequencies: 0.009395
645500 -- (-605.814) [-603.991] (-606.038) (-609.116) * [-607.800] (-606.870) (-605.145) (-606.897) -- 0:00:21
646000 -- (-605.322) [-606.135] (-606.693) (-608.345) * [-605.437] (-606.096) (-606.900) (-605.808) -- 0:00:21
646500 -- (-607.075) [-605.671] (-605.754) (-605.290) * (-604.467) (-611.977) (-605.227) [-604.762] -- 0:00:21
647000 -- (-603.780) (-606.233) [-605.685] (-604.614) * (-606.258) [-607.346] (-603.827) (-605.295) -- 0:00:21
647500 -- (-605.505) (-603.718) (-607.035) [-605.743] * (-608.959) (-605.484) (-604.402) [-606.956] -- 0:00:21
648000 -- [-606.309] (-605.122) (-603.880) (-607.142) * (-609.558) (-606.177) [-605.344] (-608.421) -- 0:00:21
648500 -- (-603.820) (-605.058) (-606.583) [-603.847] * [-605.114] (-607.334) (-605.266) (-606.865) -- 0:00:21
649000 -- (-606.195) (-606.217) (-607.228) [-605.204] * (-606.028) (-610.476) (-604.339) [-607.726] -- 0:00:21
649500 -- [-604.076] (-605.817) (-604.797) (-606.412) * (-605.059) [-604.265] (-603.816) (-604.727) -- 0:00:21
650000 -- [-606.947] (-604.850) (-606.199) (-608.733) * (-604.562) (-605.057) [-605.117] (-605.495) -- 0:00:21
Average standard deviation of split frequencies: 0.009101
650500 -- (-604.490) (-607.146) (-606.482) [-604.431] * (-604.716) (-608.789) [-605.410] (-605.468) -- 0:00:21
651000 -- [-605.853] (-604.864) (-605.196) (-611.017) * (-605.030) [-608.287] (-605.305) (-609.877) -- 0:00:21
651500 -- [-607.117] (-606.909) (-605.385) (-604.541) * (-610.817) (-604.166) (-605.399) [-608.954] -- 0:00:21
652000 -- (-609.641) [-605.317] (-605.295) (-604.494) * [-606.848] (-605.422) (-605.653) (-607.161) -- 0:00:21
652500 -- (-610.249) [-606.392] (-604.701) (-605.208) * (-606.878) (-609.984) (-606.147) [-608.231] -- 0:00:21
653000 -- (-607.772) [-609.595] (-606.423) (-604.623) * (-606.155) [-605.823] (-606.844) (-604.272) -- 0:00:21
653500 -- (-605.769) [-607.461] (-606.991) (-604.873) * (-604.792) (-605.803) (-604.713) [-605.590] -- 0:00:21
654000 -- (-606.180) (-608.543) [-607.099] (-604.518) * (-604.157) (-604.179) (-605.859) [-607.862] -- 0:00:21
654500 -- (-606.898) (-604.920) (-607.360) [-608.007] * (-604.080) [-604.450] (-604.693) (-606.481) -- 0:00:21
655000 -- (-606.997) (-608.902) [-606.919] (-604.706) * (-604.444) (-606.432) [-606.739] (-606.988) -- 0:00:21
Average standard deviation of split frequencies: 0.009387
655500 -- (-605.197) [-610.462] (-611.077) (-605.345) * [-604.659] (-605.334) (-603.851) (-605.080) -- 0:00:21
656000 -- (-607.612) (-609.910) (-605.971) [-606.232] * (-606.339) (-612.589) (-604.902) [-604.216] -- 0:00:20
656500 -- (-607.499) [-609.228] (-608.878) (-604.037) * [-609.916] (-608.075) (-607.482) (-605.311) -- 0:00:20
657000 -- (-609.287) (-605.983) (-606.931) [-605.091] * [-606.435] (-605.899) (-604.287) (-605.284) -- 0:00:20
657500 -- [-605.514] (-607.437) (-604.256) (-606.905) * [-605.459] (-606.133) (-604.383) (-606.747) -- 0:00:20
658000 -- (-608.209) (-608.093) [-605.070] (-605.021) * (-607.494) (-609.466) (-605.252) [-608.820] -- 0:00:20
658500 -- (-607.340) [-607.267] (-606.559) (-604.999) * (-608.996) (-609.204) [-604.956] (-605.657) -- 0:00:20
659000 -- (-607.899) [-605.243] (-607.288) (-605.562) * (-606.313) [-609.663] (-604.129) (-604.341) -- 0:00:20
659500 -- (-607.036) [-604.530] (-607.073) (-606.904) * (-605.731) (-605.821) (-604.354) [-604.202] -- 0:00:20
660000 -- [-606.192] (-604.535) (-605.027) (-603.630) * (-608.759) (-605.594) [-605.686] (-605.347) -- 0:00:20
Average standard deviation of split frequencies: 0.009454
660500 -- (-605.001) [-605.105] (-610.888) (-604.185) * (-604.791) (-605.409) [-605.343] (-604.370) -- 0:00:20
661000 -- (-607.295) (-604.288) [-607.741] (-604.868) * (-608.579) (-604.519) [-607.619] (-611.238) -- 0:00:20
661500 -- (-604.246) (-603.817) [-607.186] (-606.174) * (-606.325) [-604.642] (-604.848) (-605.151) -- 0:00:20
662000 -- (-603.772) (-604.922) (-607.669) [-603.831] * [-609.523] (-608.308) (-605.616) (-604.413) -- 0:00:20
662500 -- (-604.267) (-607.028) [-606.264] (-606.313) * (-608.862) (-604.601) [-604.306] (-605.150) -- 0:00:20
663000 -- (-604.802) [-606.875] (-609.777) (-605.072) * (-606.089) (-604.040) (-605.192) [-608.434] -- 0:00:20
663500 -- (-606.064) (-607.475) [-604.562] (-607.161) * (-604.966) [-605.604] (-607.873) (-610.427) -- 0:00:20
664000 -- (-610.840) [-607.577] (-605.589) (-606.895) * (-606.114) (-605.825) [-605.219] (-609.834) -- 0:00:20
664500 -- (-607.231) (-605.157) (-605.949) [-605.467] * (-605.335) [-606.059] (-607.360) (-608.703) -- 0:00:20
665000 -- [-606.524] (-604.330) (-612.534) (-608.818) * [-606.836] (-604.822) (-607.346) (-607.934) -- 0:00:20
Average standard deviation of split frequencies: 0.009600
665500 -- (-608.108) [-605.979] (-614.132) (-603.990) * (-604.370) (-609.442) (-610.116) [-606.116] -- 0:00:20
666000 -- (-605.598) (-604.939) [-609.458] (-604.448) * (-606.706) (-607.519) (-606.785) [-604.379] -- 0:00:20
666500 -- (-606.592) (-605.471) [-609.414] (-605.055) * (-613.421) (-607.622) (-606.936) [-605.925] -- 0:00:20
667000 -- (-603.616) (-607.110) (-604.427) [-606.002] * (-608.873) (-606.607) [-605.875] (-604.759) -- 0:00:20
667500 -- (-606.063) (-605.863) (-604.968) [-604.423] * (-603.563) (-606.223) (-604.285) [-603.934] -- 0:00:20
668000 -- (-606.309) (-605.452) [-604.482] (-606.933) * [-604.669] (-605.162) (-604.644) (-607.809) -- 0:00:20
668500 -- [-605.143] (-605.571) (-615.984) (-607.002) * [-604.927] (-604.720) (-607.548) (-604.599) -- 0:00:20
669000 -- [-611.027] (-604.197) (-605.554) (-604.230) * (-609.223) (-607.870) (-605.383) [-604.949] -- 0:00:20
669500 -- (-606.310) (-604.565) (-603.997) [-605.589] * (-604.986) [-610.868] (-604.739) (-607.510) -- 0:00:20
670000 -- (-605.507) (-605.520) (-609.200) [-605.127] * (-606.446) [-604.424] (-607.231) (-607.708) -- 0:00:20
Average standard deviation of split frequencies: 0.009138
670500 -- (-607.579) (-606.892) [-604.842] (-605.287) * [-604.453] (-605.032) (-605.905) (-611.262) -- 0:00:20
671000 -- (-609.869) (-604.408) (-604.869) [-608.108] * (-604.698) (-604.952) (-604.647) [-604.255] -- 0:00:20
671500 -- (-610.405) (-608.221) (-604.370) [-606.984] * [-604.660] (-603.944) (-605.666) (-605.173) -- 0:00:20
672000 -- (-605.921) [-605.858] (-604.300) (-611.514) * (-605.488) [-604.577] (-606.569) (-604.063) -- 0:00:20
672500 -- [-606.529] (-604.458) (-606.121) (-608.427) * (-606.245) (-606.157) (-606.022) [-606.214] -- 0:00:19
673000 -- (-606.990) (-605.667) [-605.166] (-604.156) * (-606.321) (-604.354) (-608.893) [-605.248] -- 0:00:19
673500 -- (-604.383) [-608.637] (-606.054) (-603.807) * [-609.051] (-603.963) (-606.980) (-604.781) -- 0:00:19
674000 -- (-605.247) [-606.473] (-609.705) (-604.754) * (-617.245) [-604.469] (-606.570) (-609.953) -- 0:00:19
674500 -- (-611.552) [-604.561] (-609.476) (-604.392) * (-608.809) [-604.370] (-604.482) (-608.678) -- 0:00:19
675000 -- (-604.369) (-606.094) [-605.472] (-605.144) * [-605.717] (-605.462) (-605.329) (-609.394) -- 0:00:19
Average standard deviation of split frequencies: 0.009437
675500 -- (-604.298) [-606.762] (-606.372) (-604.067) * (-608.812) [-606.116] (-606.076) (-604.558) -- 0:00:19
676000 -- [-604.493] (-607.420) (-605.274) (-606.125) * (-609.738) (-609.446) [-604.829] (-605.795) -- 0:00:19
676500 -- [-605.662] (-608.673) (-606.984) (-608.993) * (-605.264) (-606.363) (-605.046) [-606.429] -- 0:00:19
677000 -- [-604.562] (-607.171) (-608.745) (-609.219) * (-608.166) (-604.968) (-606.586) [-605.868] -- 0:00:19
677500 -- (-608.469) (-607.007) (-607.105) [-604.291] * (-604.762) [-603.853] (-610.203) (-611.237) -- 0:00:19
678000 -- (-606.434) (-605.077) [-606.192] (-605.779) * (-605.256) [-604.951] (-606.837) (-611.967) -- 0:00:19
678500 -- (-605.225) [-607.458] (-607.827) (-605.764) * (-606.352) [-604.601] (-605.328) (-605.962) -- 0:00:19
679000 -- [-605.309] (-605.095) (-607.431) (-605.366) * (-607.047) [-607.675] (-605.019) (-605.259) -- 0:00:19
679500 -- (-608.396) [-612.441] (-606.560) (-610.784) * (-608.984) (-606.059) [-610.175] (-604.443) -- 0:00:19
680000 -- (-607.416) (-605.785) [-609.090] (-606.728) * (-606.217) (-609.137) [-608.557] (-606.742) -- 0:00:19
Average standard deviation of split frequencies: 0.009049
680500 -- (-609.818) [-604.399] (-604.306) (-605.707) * (-606.439) (-605.493) [-606.858] (-612.090) -- 0:00:19
681000 -- (-606.848) (-607.149) (-609.920) [-606.540] * (-605.813) [-604.852] (-605.770) (-610.579) -- 0:00:19
681500 -- [-607.419] (-605.111) (-611.758) (-605.755) * [-605.585] (-604.617) (-608.700) (-604.842) -- 0:00:19
682000 -- (-604.295) [-604.652] (-608.781) (-603.921) * (-606.616) (-604.173) [-604.445] (-603.600) -- 0:00:19
682500 -- [-604.600] (-606.827) (-608.504) (-604.187) * (-604.558) [-604.163] (-604.184) (-604.370) -- 0:00:19
683000 -- (-604.276) [-604.739] (-605.300) (-609.058) * (-605.695) (-604.517) (-606.254) [-606.498] -- 0:00:19
683500 -- (-603.935) (-605.889) [-606.874] (-604.353) * [-604.154] (-609.795) (-609.977) (-610.114) -- 0:00:19
684000 -- [-605.125] (-608.443) (-604.453) (-606.198) * (-604.810) [-608.492] (-607.734) (-606.820) -- 0:00:19
684500 -- (-606.079) (-608.907) (-604.616) [-605.845] * [-605.147] (-603.522) (-605.590) (-607.771) -- 0:00:19
685000 -- (-607.093) (-605.159) (-603.807) [-607.246] * (-605.484) [-606.159] (-606.266) (-606.874) -- 0:00:19
Average standard deviation of split frequencies: 0.009071
685500 -- [-605.320] (-610.112) (-604.012) (-609.977) * [-605.865] (-604.210) (-604.604) (-603.905) -- 0:00:19
686000 -- (-604.747) (-605.172) (-603.884) [-607.158] * (-605.746) [-604.161] (-606.546) (-607.102) -- 0:00:19
686500 -- (-604.587) (-605.696) (-606.920) [-605.201] * (-609.880) [-605.991] (-604.207) (-606.467) -- 0:00:19
687000 -- (-607.613) (-606.227) [-609.051] (-604.477) * [-605.145] (-604.191) (-604.772) (-608.329) -- 0:00:19
687500 -- (-608.621) (-608.108) [-607.259] (-605.330) * (-605.782) [-605.212] (-606.859) (-605.597) -- 0:00:19
688000 -- (-610.496) (-606.802) [-604.953] (-605.050) * [-605.683] (-604.812) (-609.176) (-604.652) -- 0:00:19
688500 -- (-604.911) [-606.416] (-605.990) (-608.160) * [-605.020] (-607.367) (-605.589) (-608.951) -- 0:00:19
689000 -- (-604.510) [-604.269] (-604.561) (-605.029) * (-606.352) (-608.805) (-604.966) [-604.679] -- 0:00:18
689500 -- (-604.431) (-607.270) [-605.413] (-606.842) * (-603.887) [-605.350] (-606.300) (-604.252) -- 0:00:18
690000 -- (-604.945) (-607.935) (-604.267) [-604.318] * (-605.465) (-608.252) (-606.571) [-606.456] -- 0:00:18
Average standard deviation of split frequencies: 0.009191
690500 -- (-605.380) [-606.772] (-605.258) (-606.472) * (-604.219) (-607.499) [-605.995] (-606.695) -- 0:00:18
691000 -- [-606.867] (-607.255) (-604.463) (-605.659) * [-604.065] (-605.214) (-608.079) (-604.726) -- 0:00:18
691500 -- (-607.084) [-605.942] (-605.413) (-609.342) * (-605.753) (-604.211) (-610.752) [-605.924] -- 0:00:18
692000 -- [-605.984] (-607.987) (-605.504) (-605.163) * (-605.034) [-603.661] (-606.364) (-606.485) -- 0:00:18
692500 -- (-606.430) [-605.400] (-605.811) (-608.707) * (-605.169) [-603.654] (-609.523) (-604.079) -- 0:00:18
693000 -- (-608.129) (-606.638) (-606.161) [-604.916] * (-604.364) (-607.137) (-606.213) [-604.516] -- 0:00:18
693500 -- [-606.259] (-607.590) (-607.933) (-605.421) * (-604.759) [-604.632] (-610.146) (-604.597) -- 0:00:18
694000 -- (-607.732) (-609.490) [-606.298] (-606.143) * [-606.586] (-605.461) (-604.790) (-606.042) -- 0:00:18
694500 -- [-605.049] (-611.272) (-608.898) (-608.064) * [-604.802] (-603.849) (-603.718) (-606.901) -- 0:00:18
695000 -- [-604.777] (-610.242) (-606.555) (-607.894) * (-605.190) (-607.646) [-603.725] (-607.400) -- 0:00:18
Average standard deviation of split frequencies: 0.010114
695500 -- [-604.297] (-605.877) (-606.113) (-606.873) * (-604.080) [-605.003] (-605.120) (-603.852) -- 0:00:18
696000 -- (-608.100) [-604.559] (-603.600) (-606.421) * (-604.557) (-605.596) [-604.496] (-604.702) -- 0:00:18
696500 -- [-605.753] (-607.207) (-606.228) (-607.488) * (-606.761) [-604.427] (-604.685) (-604.541) -- 0:00:18
697000 -- (-608.977) [-608.042] (-604.572) (-607.996) * (-607.216) [-603.800] (-607.176) (-604.863) -- 0:00:18
697500 -- [-604.825] (-605.833) (-605.281) (-607.487) * [-604.463] (-607.650) (-604.622) (-605.840) -- 0:00:18
698000 -- (-603.795) [-608.989] (-605.340) (-606.649) * (-606.785) (-605.647) [-605.811] (-604.650) -- 0:00:18
698500 -- (-605.601) (-606.372) [-606.412] (-605.833) * (-610.112) (-604.401) (-604.339) [-605.968] -- 0:00:18
699000 -- (-604.877) [-605.052] (-606.716) (-606.486) * (-603.888) (-604.232) (-606.640) [-605.071] -- 0:00:18
699500 -- (-604.808) (-607.902) [-604.016] (-606.471) * (-604.284) (-605.201) (-608.082) [-604.810] -- 0:00:18
700000 -- (-604.112) (-605.041) [-604.396] (-611.265) * [-604.624] (-604.792) (-610.426) (-605.522) -- 0:00:18
Average standard deviation of split frequencies: 0.010137
700500 -- (-606.414) (-605.664) [-605.274] (-604.336) * (-607.648) (-606.576) (-607.420) [-606.944] -- 0:00:18
701000 -- [-604.832] (-605.157) (-604.338) (-605.308) * [-606.018] (-605.717) (-605.762) (-610.248) -- 0:00:18
701500 -- (-605.857) [-606.957] (-607.922) (-606.603) * (-605.307) [-605.958] (-605.866) (-606.149) -- 0:00:18
702000 -- (-603.672) (-607.628) [-605.929] (-603.996) * (-604.667) (-608.249) (-611.234) [-604.419] -- 0:00:18
702500 -- (-604.567) [-612.564] (-608.093) (-604.981) * (-606.676) (-605.501) [-605.249] (-606.489) -- 0:00:18
703000 -- (-605.558) (-606.016) (-607.138) [-604.327] * (-607.165) [-605.257] (-606.067) (-604.653) -- 0:00:18
703500 -- [-604.693] (-607.640) (-611.417) (-603.704) * (-608.620) (-604.534) (-607.916) [-608.953] -- 0:00:18
704000 -- (-604.561) [-604.849] (-607.082) (-605.663) * (-606.803) (-609.997) (-607.479) [-606.225] -- 0:00:18
704500 -- [-605.363] (-604.409) (-605.817) (-604.660) * [-607.518] (-605.279) (-609.494) (-607.405) -- 0:00:18
705000 -- [-611.064] (-606.059) (-606.775) (-610.076) * [-607.282] (-606.270) (-605.934) (-605.849) -- 0:00:17
Average standard deviation of split frequencies: 0.010772
705500 -- (-606.138) (-605.428) [-605.373] (-605.666) * (-604.746) (-605.974) (-607.532) [-606.517] -- 0:00:17
706000 -- (-605.643) (-605.688) (-607.187) [-606.442] * (-604.627) (-605.721) (-606.716) [-608.043] -- 0:00:17
706500 -- [-605.460] (-604.929) (-605.152) (-605.130) * (-604.922) (-604.107) [-603.991] (-604.168) -- 0:00:17
707000 -- (-605.990) (-604.522) (-606.036) [-605.839] * (-605.420) [-604.684] (-607.434) (-606.932) -- 0:00:17
707500 -- (-607.375) (-605.105) (-608.817) [-604.209] * [-605.577] (-605.107) (-609.972) (-606.447) -- 0:00:17
708000 -- (-610.402) [-604.479] (-606.509) (-604.634) * (-604.002) [-606.055] (-605.369) (-603.861) -- 0:00:17
708500 -- (-604.728) [-605.647] (-606.575) (-604.665) * (-604.366) (-608.369) (-607.054) [-603.807] -- 0:00:17
709000 -- (-605.224) (-604.564) (-603.908) [-605.179] * (-608.551) (-606.550) [-606.593] (-605.716) -- 0:00:17
709500 -- [-606.738] (-606.066) (-605.121) (-608.331) * (-606.810) (-604.107) (-603.829) [-605.400] -- 0:00:17
710000 -- (-604.624) (-608.567) [-604.364] (-605.460) * (-604.824) [-604.474] (-606.226) (-610.185) -- 0:00:17
Average standard deviation of split frequencies: 0.010171
710500 -- (-605.851) (-604.024) [-604.485] (-604.103) * (-605.958) (-605.106) [-606.239] (-604.901) -- 0:00:17
711000 -- [-604.814] (-605.061) (-604.275) (-606.204) * (-603.908) (-604.520) [-607.435] (-604.696) -- 0:00:17
711500 -- (-604.315) (-605.397) (-605.952) [-604.203] * (-603.931) (-606.065) [-605.377] (-606.100) -- 0:00:17
712000 -- (-612.617) [-606.559] (-604.626) (-605.242) * (-604.505) [-604.759] (-607.955) (-605.476) -- 0:00:17
712500 -- (-607.162) (-606.067) (-607.178) [-604.791] * [-605.704] (-605.861) (-604.564) (-606.652) -- 0:00:17
713000 -- [-607.387] (-608.343) (-605.221) (-606.534) * (-607.227) (-607.312) [-604.574] (-606.442) -- 0:00:17
713500 -- (-604.609) (-605.470) [-609.582] (-605.272) * (-605.285) (-607.402) (-603.791) [-609.928] -- 0:00:17
714000 -- [-605.270] (-605.015) (-607.524) (-603.995) * [-607.805] (-605.424) (-609.994) (-611.207) -- 0:00:17
714500 -- [-605.741] (-607.216) (-603.676) (-604.337) * (-604.693) [-604.322] (-610.494) (-607.008) -- 0:00:17
715000 -- [-605.469] (-605.300) (-604.696) (-604.643) * (-604.713) [-605.178] (-606.360) (-603.463) -- 0:00:17
Average standard deviation of split frequencies: 0.010622
715500 -- (-608.128) (-605.881) (-605.609) [-606.416] * (-604.333) [-607.203] (-605.389) (-606.581) -- 0:00:17
716000 -- (-606.416) (-604.977) [-604.978] (-604.543) * (-604.465) [-605.266] (-603.888) (-606.333) -- 0:00:17
716500 -- (-605.650) (-606.210) [-604.655] (-605.789) * (-607.970) (-605.672) (-603.849) [-604.945] -- 0:00:17
717000 -- (-606.201) (-605.532) [-606.709] (-608.591) * [-606.521] (-605.116) (-607.339) (-604.891) -- 0:00:17
717500 -- (-610.551) (-605.642) [-604.215] (-605.757) * [-605.220] (-605.651) (-604.178) (-603.885) -- 0:00:17
718000 -- (-608.256) (-606.462) (-603.989) [-607.020] * (-607.736) (-605.386) (-606.738) [-603.936] -- 0:00:17
718500 -- [-606.720] (-605.659) (-603.521) (-607.221) * (-609.481) (-605.283) [-607.413] (-608.449) -- 0:00:17
719000 -- (-606.709) (-604.445) (-610.491) [-604.466] * (-611.189) (-605.334) (-609.218) [-605.271] -- 0:00:17
719500 -- (-604.820) (-605.031) (-604.992) [-613.330] * (-604.371) [-605.981] (-604.723) (-606.821) -- 0:00:17
720000 -- [-608.134] (-606.465) (-607.893) (-606.739) * [-606.796] (-605.403) (-606.836) (-605.915) -- 0:00:17
Average standard deviation of split frequencies: 0.010793
720500 -- (-606.798) (-606.196) (-604.867) [-608.938] * (-605.740) (-604.276) [-606.281] (-605.547) -- 0:00:17
721000 -- [-607.562] (-604.210) (-605.108) (-604.398) * (-606.184) [-604.139] (-605.425) (-605.597) -- 0:00:17
721500 -- [-605.445] (-605.832) (-606.482) (-604.545) * (-609.633) (-605.737) (-607.921) [-607.287] -- 0:00:16
722000 -- [-604.833] (-610.382) (-606.838) (-608.469) * (-607.866) (-606.579) (-611.840) [-603.899] -- 0:00:16
722500 -- (-604.637) [-605.400] (-604.887) (-607.007) * [-611.614] (-604.849) (-605.652) (-603.703) -- 0:00:16
723000 -- [-603.927] (-606.418) (-605.107) (-607.647) * (-604.914) (-607.086) [-605.899] (-604.179) -- 0:00:16
723500 -- (-611.252) (-607.467) (-605.461) [-604.600] * [-605.177] (-605.072) (-606.244) (-605.605) -- 0:00:16
724000 -- [-605.825] (-611.205) (-605.282) (-608.134) * (-608.713) (-608.200) [-604.311] (-606.525) -- 0:00:16
724500 -- [-605.873] (-605.925) (-608.874) (-604.327) * (-608.266) (-609.493) [-605.169] (-604.558) -- 0:00:16
725000 -- (-603.817) (-606.984) [-604.629] (-604.327) * (-610.932) [-606.860] (-604.051) (-607.087) -- 0:00:16
Average standard deviation of split frequencies: 0.011255
725500 -- [-604.552] (-604.804) (-604.229) (-605.538) * (-607.382) (-607.388) [-604.200] (-607.526) -- 0:00:16
726000 -- (-606.122) [-605.864] (-604.270) (-608.636) * (-607.416) (-605.914) [-605.233] (-607.356) -- 0:00:16
726500 -- [-607.268] (-604.645) (-605.477) (-605.743) * (-606.542) [-606.065] (-607.192) (-607.072) -- 0:00:16
727000 -- (-604.246) [-607.129] (-604.423) (-606.587) * [-606.070] (-608.381) (-604.025) (-605.286) -- 0:00:16
727500 -- [-604.945] (-607.864) (-603.886) (-605.650) * [-605.987] (-609.557) (-603.490) (-608.840) -- 0:00:16
728000 -- [-606.097] (-604.407) (-604.359) (-606.404) * (-604.870) [-605.273] (-604.694) (-607.125) -- 0:00:16
728500 -- (-606.903) (-606.774) [-604.121] (-606.093) * (-605.121) [-606.896] (-604.834) (-603.973) -- 0:00:16
729000 -- (-605.264) (-607.907) (-605.954) [-606.908] * (-605.743) (-606.326) [-604.247] (-605.021) -- 0:00:16
729500 -- (-609.839) [-605.878] (-605.183) (-606.659) * (-606.235) (-604.373) [-604.224] (-605.858) -- 0:00:16
730000 -- (-606.770) (-605.675) (-605.824) [-604.562] * (-607.056) (-605.145) [-603.912] (-605.191) -- 0:00:16
Average standard deviation of split frequencies: 0.010645
730500 -- (-604.759) [-607.833] (-605.843) (-605.869) * (-605.768) (-611.786) [-605.205] (-609.358) -- 0:00:16
731000 -- (-605.980) [-605.353] (-604.697) (-604.522) * [-604.526] (-606.823) (-609.898) (-605.434) -- 0:00:16
731500 -- [-606.745] (-607.511) (-605.253) (-605.583) * [-605.011] (-607.176) (-605.874) (-605.333) -- 0:00:16
732000 -- [-606.755] (-605.652) (-604.892) (-604.109) * [-604.173] (-604.700) (-605.354) (-604.203) -- 0:00:16
732500 -- (-609.693) (-607.088) [-604.969] (-604.474) * [-605.937] (-605.122) (-607.850) (-606.359) -- 0:00:16
733000 -- [-608.337] (-606.484) (-607.348) (-605.502) * [-606.274] (-604.326) (-609.113) (-607.584) -- 0:00:16
733500 -- [-607.047] (-604.030) (-604.039) (-606.079) * (-604.652) [-604.784] (-605.671) (-604.047) -- 0:00:16
734000 -- (-606.164) [-607.885] (-605.758) (-605.325) * [-606.129] (-606.845) (-609.541) (-605.058) -- 0:00:16
734500 -- (-606.745) (-607.240) (-605.398) [-605.183] * (-610.604) [-604.314] (-604.354) (-606.175) -- 0:00:16
735000 -- (-608.551) (-605.972) [-606.106] (-605.235) * (-605.483) (-605.605) (-606.595) [-608.114] -- 0:00:16
Average standard deviation of split frequencies: 0.010408
735500 -- (-605.275) (-605.339) (-606.106) [-606.511] * (-607.102) [-604.594] (-609.869) (-604.316) -- 0:00:16
736000 -- [-607.344] (-604.824) (-608.611) (-605.315) * (-609.120) [-605.227] (-605.989) (-604.122) -- 0:00:16
736500 -- (-606.636) (-605.011) [-606.501] (-604.363) * [-606.477] (-604.952) (-605.373) (-606.288) -- 0:00:16
737000 -- [-605.103] (-604.748) (-606.013) (-607.183) * (-607.521) (-605.236) [-605.562] (-606.031) -- 0:00:16
737500 -- [-607.622] (-606.258) (-604.484) (-608.109) * (-606.465) [-605.044] (-607.410) (-605.463) -- 0:00:16
738000 -- (-608.131) (-609.169) (-604.857) [-606.088] * [-606.388] (-605.416) (-604.557) (-604.283) -- 0:00:15
738500 -- (-603.940) (-604.317) [-605.548] (-605.630) * [-610.313] (-605.719) (-606.434) (-609.640) -- 0:00:15
739000 -- (-603.769) (-604.688) [-610.868] (-609.699) * (-610.634) [-606.235] (-604.474) (-604.308) -- 0:00:15
739500 -- (-604.353) (-607.908) [-605.577] (-612.766) * (-606.438) [-605.979] (-605.189) (-605.645) -- 0:00:15
740000 -- [-605.283] (-608.174) (-609.185) (-605.859) * (-606.000) (-606.246) (-607.491) [-604.247] -- 0:00:15
Average standard deviation of split frequencies: 0.010064
740500 -- (-605.019) [-605.339] (-605.481) (-607.285) * [-604.934] (-605.256) (-604.002) (-606.308) -- 0:00:15
741000 -- (-605.794) (-605.600) [-605.869] (-604.666) * (-607.010) (-605.685) [-605.645] (-604.038) -- 0:00:15
741500 -- (-610.318) [-605.879] (-607.275) (-605.522) * [-609.322] (-605.836) (-604.855) (-607.357) -- 0:00:15
742000 -- (-603.896) [-603.984] (-605.121) (-608.915) * (-608.269) (-607.424) [-605.267] (-605.771) -- 0:00:15
742500 -- [-606.057] (-607.329) (-603.877) (-606.274) * [-607.320] (-604.644) (-606.968) (-608.869) -- 0:00:15
743000 -- (-607.011) [-605.826] (-604.996) (-605.310) * (-605.099) (-604.939) [-605.900] (-606.792) -- 0:00:15
743500 -- [-606.480] (-605.694) (-605.261) (-608.030) * (-607.630) [-606.168] (-604.679) (-609.976) -- 0:00:15
744000 -- (-612.496) (-607.001) [-606.157] (-604.234) * [-605.079] (-603.650) (-607.505) (-603.836) -- 0:00:15
744500 -- (-606.217) (-607.382) (-604.817) [-608.040] * [-604.494] (-603.793) (-606.064) (-603.894) -- 0:00:15
745000 -- (-607.506) (-606.034) [-607.071] (-607.450) * (-605.322) (-606.169) (-605.900) [-605.295] -- 0:00:15
Average standard deviation of split frequencies: 0.010150
745500 -- (-604.451) (-605.422) [-605.469] (-605.612) * [-605.928] (-604.463) (-604.736) (-606.750) -- 0:00:15
746000 -- (-605.133) (-604.580) [-606.289] (-604.640) * (-605.660) (-605.031) [-605.869] (-605.551) -- 0:00:15
746500 -- (-606.440) [-606.373] (-614.391) (-604.759) * (-609.222) (-609.102) [-604.474] (-605.717) -- 0:00:15
747000 -- (-611.189) (-606.068) (-610.227) [-610.473] * (-606.955) (-605.856) (-609.714) [-607.254] -- 0:00:15
747500 -- (-612.939) (-608.742) (-608.118) [-610.480] * (-606.958) [-608.203] (-604.530) (-614.163) -- 0:00:15
748000 -- (-616.195) (-606.061) [-606.866] (-606.541) * (-607.175) (-604.083) [-605.828] (-606.185) -- 0:00:15
748500 -- (-604.844) (-604.804) [-605.022] (-608.694) * (-607.263) (-604.494) [-609.194] (-606.608) -- 0:00:15
749000 -- (-605.706) (-605.344) [-607.378] (-609.278) * (-606.769) [-604.454] (-607.864) (-607.919) -- 0:00:15
749500 -- [-604.653] (-607.097) (-610.743) (-604.121) * [-609.262] (-604.646) (-605.816) (-605.318) -- 0:00:15
750000 -- (-603.916) (-604.201) (-605.324) [-605.099] * (-606.735) (-605.526) (-605.137) [-604.503] -- 0:00:15
Average standard deviation of split frequencies: 0.009891
750500 -- (-608.467) (-606.659) [-604.924] (-606.362) * [-605.204] (-605.227) (-605.296) (-608.316) -- 0:00:15
751000 -- (-607.206) [-607.942] (-603.841) (-604.510) * (-606.257) (-604.745) [-605.175] (-604.017) -- 0:00:15
751500 -- (-605.806) (-611.716) (-604.183) [-604.506] * [-605.867] (-604.130) (-606.025) (-605.183) -- 0:00:15
752000 -- (-604.719) [-604.736] (-607.174) (-606.655) * (-604.196) [-610.570] (-604.898) (-604.964) -- 0:00:15
752500 -- (-604.325) [-606.111] (-605.211) (-604.393) * (-605.808) [-607.312] (-607.315) (-607.289) -- 0:00:15
753000 -- (-604.703) [-605.229] (-606.406) (-607.461) * (-604.612) [-604.807] (-608.345) (-607.200) -- 0:00:15
753500 -- [-604.689] (-603.727) (-606.531) (-610.658) * [-604.401] (-604.910) (-606.597) (-604.512) -- 0:00:15
754000 -- (-609.203) [-606.877] (-609.517) (-610.074) * (-607.063) (-605.019) (-607.320) [-604.928] -- 0:00:15
754500 -- (-609.115) (-607.861) (-604.649) [-604.577] * [-606.947] (-604.665) (-606.438) (-606.559) -- 0:00:14
755000 -- [-606.340] (-605.895) (-605.391) (-604.829) * [-607.605] (-604.728) (-605.106) (-608.594) -- 0:00:14
Average standard deviation of split frequencies: 0.009626
755500 -- [-606.051] (-606.051) (-605.665) (-607.335) * (-606.861) (-604.407) (-604.192) [-607.606] -- 0:00:14
756000 -- (-604.965) (-605.583) [-604.528] (-606.702) * (-609.786) (-606.677) (-603.735) [-604.950] -- 0:00:14
756500 -- (-605.891) (-605.421) (-603.935) [-606.216] * [-605.434] (-608.179) (-604.292) (-605.900) -- 0:00:14
757000 -- [-604.958] (-604.141) (-606.049) (-613.505) * (-605.532) (-604.524) [-604.882] (-607.016) -- 0:00:14
757500 -- (-608.945) (-609.739) [-604.401] (-606.010) * (-605.318) (-607.591) (-604.372) [-606.840] -- 0:00:14
758000 -- (-607.268) [-605.688] (-605.204) (-607.653) * (-608.091) (-606.515) [-603.888] (-606.407) -- 0:00:14
758500 -- [-604.113] (-609.344) (-605.858) (-603.942) * [-606.690] (-603.949) (-605.881) (-605.720) -- 0:00:14
759000 -- (-609.041) (-607.635) [-605.937] (-605.461) * (-607.218) (-605.614) [-606.798] (-606.854) -- 0:00:14
759500 -- (-604.700) (-605.911) [-604.991] (-604.962) * (-606.474) (-609.088) [-606.101] (-606.971) -- 0:00:14
760000 -- (-605.746) (-604.809) [-604.680] (-607.510) * (-605.378) [-611.063] (-607.099) (-605.127) -- 0:00:14
Average standard deviation of split frequencies: 0.009644
760500 -- (-604.509) (-606.347) (-605.594) [-604.392] * [-604.020] (-603.873) (-605.153) (-605.266) -- 0:00:14
761000 -- [-604.269] (-606.944) (-608.600) (-606.614) * (-603.654) (-606.184) (-606.360) [-605.715] -- 0:00:14
761500 -- (-606.284) [-607.477] (-606.052) (-605.720) * (-604.149) (-607.102) [-606.507] (-607.148) -- 0:00:14
762000 -- (-611.179) (-608.891) (-607.864) [-605.141] * [-604.490] (-604.342) (-608.227) (-607.064) -- 0:00:14
762500 -- (-604.549) [-606.099] (-604.728) (-608.758) * [-606.340] (-604.882) (-606.330) (-606.820) -- 0:00:14
763000 -- (-605.974) [-605.765] (-605.492) (-611.432) * (-608.424) (-605.186) [-603.679] (-607.143) -- 0:00:14
763500 -- (-609.209) (-604.431) (-606.228) [-606.514] * (-609.410) [-603.825] (-606.295) (-605.157) -- 0:00:14
764000 -- [-605.036] (-604.982) (-604.703) (-608.248) * (-606.788) (-605.111) [-606.667] (-608.107) -- 0:00:14
764500 -- (-604.284) [-608.710] (-604.119) (-604.424) * (-607.246) [-606.022] (-606.591) (-605.390) -- 0:00:14
765000 -- (-606.287) [-606.532] (-604.134) (-604.582) * (-607.073) [-604.355] (-607.170) (-606.300) -- 0:00:14
Average standard deviation of split frequencies: 0.009270
765500 -- (-606.110) [-604.480] (-605.020) (-606.925) * (-605.907) (-607.006) (-608.167) [-603.984] -- 0:00:14
766000 -- (-606.029) (-609.843) (-605.255) [-605.672] * (-605.557) [-605.647] (-609.744) (-605.256) -- 0:00:14
766500 -- (-605.582) [-605.963] (-606.204) (-605.316) * (-604.864) [-607.472] (-607.105) (-605.620) -- 0:00:14
767000 -- (-604.991) [-603.769] (-608.563) (-603.850) * [-605.629] (-605.869) (-607.481) (-606.187) -- 0:00:14
767500 -- (-606.560) (-604.451) (-605.175) [-608.529] * (-604.187) (-605.060) [-609.860] (-605.638) -- 0:00:14
768000 -- (-608.089) (-607.272) (-606.000) [-607.544] * (-609.599) [-604.848] (-605.169) (-609.557) -- 0:00:14
768500 -- (-604.494) (-607.464) [-607.419] (-609.808) * (-604.163) (-604.083) [-606.675] (-605.819) -- 0:00:14
769000 -- (-604.916) (-606.192) [-607.285] (-604.515) * [-604.388] (-604.345) (-606.115) (-604.363) -- 0:00:14
769500 -- (-607.142) (-609.879) (-607.206) [-603.963] * [-604.744] (-604.597) (-609.732) (-604.626) -- 0:00:14
770000 -- (-603.855) [-606.113] (-607.870) (-604.533) * (-609.461) [-604.241] (-604.993) (-608.622) -- 0:00:14
Average standard deviation of split frequencies: 0.009213
770500 -- [-604.543] (-608.956) (-606.093) (-605.893) * (-605.825) (-605.832) [-606.213] (-612.733) -- 0:00:13
771000 -- (-604.568) [-605.507] (-612.254) (-606.650) * (-605.830) (-604.368) (-604.353) [-608.702] -- 0:00:13
771500 -- (-605.134) [-604.458] (-606.352) (-607.524) * [-604.670] (-606.392) (-606.225) (-605.562) -- 0:00:13
772000 -- (-604.841) (-606.017) [-605.251] (-605.192) * (-604.137) [-604.639] (-604.195) (-605.228) -- 0:00:13
772500 -- (-606.669) (-606.824) (-606.238) [-605.414] * [-603.619] (-606.611) (-605.104) (-604.323) -- 0:00:13
773000 -- [-605.505] (-605.614) (-605.307) (-604.980) * [-604.000] (-605.011) (-605.151) (-606.588) -- 0:00:13
773500 -- (-605.907) (-608.219) [-604.038] (-607.451) * [-605.187] (-613.718) (-608.556) (-608.483) -- 0:00:13
774000 -- (-606.696) (-606.222) [-604.001] (-607.522) * (-604.102) (-606.377) [-605.249] (-606.212) -- 0:00:13
774500 -- (-606.487) [-605.787] (-605.821) (-607.653) * (-604.857) (-607.042) (-605.790) [-603.838] -- 0:00:13
775000 -- (-604.951) (-607.212) [-604.668] (-607.822) * [-605.023] (-604.974) (-608.307) (-604.297) -- 0:00:13
Average standard deviation of split frequencies: 0.009264
775500 -- [-605.827] (-603.983) (-605.129) (-608.350) * [-604.323] (-604.202) (-606.628) (-603.643) -- 0:00:13
776000 -- (-609.265) (-605.028) [-604.551] (-610.431) * (-605.102) (-606.088) (-609.782) [-604.577] -- 0:00:13
776500 -- (-606.684) (-604.917) [-605.003] (-607.253) * [-604.555] (-608.554) (-608.807) (-604.655) -- 0:00:13
777000 -- (-604.787) (-606.252) [-605.885] (-607.655) * (-606.542) (-605.791) (-607.803) [-604.639] -- 0:00:13
777500 -- (-605.188) (-604.811) (-605.573) [-608.408] * (-610.538) [-604.950] (-608.179) (-606.132) -- 0:00:13
778000 -- (-605.984) [-605.780] (-606.296) (-605.858) * (-610.772) (-606.671) [-607.297] (-604.443) -- 0:00:13
778500 -- (-605.071) (-607.794) (-604.871) [-605.479] * (-605.289) (-606.788) [-605.481] (-607.455) -- 0:00:13
779000 -- (-604.953) (-606.153) (-608.382) [-607.404] * [-605.469] (-607.041) (-604.571) (-606.115) -- 0:00:13
779500 -- [-603.770] (-605.991) (-605.992) (-609.079) * (-605.473) [-604.081] (-604.917) (-606.847) -- 0:00:13
780000 -- (-608.315) (-607.517) [-605.740] (-610.777) * [-608.040] (-605.244) (-610.271) (-606.315) -- 0:00:13
Average standard deviation of split frequencies: 0.009259
780500 -- [-607.775] (-607.371) (-608.298) (-608.904) * (-613.633) (-606.277) [-604.469] (-606.079) -- 0:00:13
781000 -- (-605.546) (-605.433) (-604.031) [-604.678] * (-605.545) (-604.273) (-604.174) [-604.601] -- 0:00:13
781500 -- [-610.183] (-606.562) (-606.765) (-604.624) * (-610.604) [-605.554] (-608.023) (-605.382) -- 0:00:13
782000 -- (-611.310) (-606.735) (-604.833) [-607.400] * (-604.380) (-608.419) [-607.703] (-603.869) -- 0:00:13
782500 -- (-611.026) (-606.223) [-604.890] (-609.762) * (-605.818) (-609.462) [-608.560] (-609.110) -- 0:00:13
783000 -- [-605.351] (-605.305) (-604.657) (-607.674) * (-605.867) [-604.702] (-609.263) (-604.918) -- 0:00:13
783500 -- (-606.254) (-605.932) [-605.685] (-605.472) * (-606.490) [-608.821] (-613.237) (-604.834) -- 0:00:13
784000 -- [-607.006] (-605.494) (-606.639) (-606.122) * [-604.137] (-606.914) (-609.092) (-605.346) -- 0:00:13
784500 -- (-610.320) [-606.599] (-608.225) (-605.160) * [-606.430] (-608.070) (-609.611) (-604.836) -- 0:00:13
785000 -- [-606.285] (-606.007) (-607.115) (-608.369) * (-606.603) (-605.534) (-607.382) [-604.754] -- 0:00:13
Average standard deviation of split frequencies: 0.009446
785500 -- (-605.253) (-604.696) [-608.493] (-607.476) * (-605.342) [-603.781] (-605.333) (-604.400) -- 0:00:13
786000 -- [-607.004] (-604.521) (-604.843) (-604.763) * (-606.282) [-604.771] (-606.129) (-606.961) -- 0:00:13
786500 -- (-607.016) [-604.487] (-608.410) (-607.251) * (-604.048) (-605.316) (-605.291) [-605.811] -- 0:00:13
787000 -- (-603.793) (-604.843) (-607.022) [-606.640] * (-606.064) (-604.894) [-604.641] (-606.000) -- 0:00:12
787500 -- [-603.814] (-605.510) (-605.998) (-605.855) * (-606.075) (-606.922) [-606.345] (-604.372) -- 0:00:12
788000 -- (-605.163) (-609.525) [-605.667] (-607.069) * (-604.464) [-608.299] (-605.405) (-604.386) -- 0:00:12
788500 -- (-604.399) (-612.309) [-606.991] (-605.423) * (-604.748) [-608.731] (-606.503) (-604.891) -- 0:00:12
789000 -- (-604.382) (-604.457) (-605.055) [-604.452] * (-606.766) (-609.572) [-604.908] (-606.257) -- 0:00:12
789500 -- (-606.761) (-603.787) (-604.917) [-606.517] * (-604.394) (-605.524) [-605.879] (-606.660) -- 0:00:12
790000 -- (-605.655) [-604.672] (-604.307) (-610.837) * [-604.187] (-608.982) (-607.143) (-607.717) -- 0:00:12
Average standard deviation of split frequencies: 0.009502
790500 -- (-605.203) (-605.633) [-604.237] (-604.902) * (-609.930) (-607.607) (-604.532) [-605.004] -- 0:00:12
791000 -- (-606.204) [-604.814] (-605.182) (-604.452) * (-609.332) (-608.026) [-607.198] (-604.955) -- 0:00:12
791500 -- (-606.525) (-607.150) (-606.882) [-607.372] * (-606.744) (-606.966) [-606.097] (-608.497) -- 0:00:12
792000 -- (-604.408) (-609.307) (-604.107) [-603.520] * [-607.835] (-606.519) (-605.321) (-606.093) -- 0:00:12
792500 -- (-609.125) (-609.428) [-603.533] (-604.874) * (-606.039) [-604.971] (-605.137) (-605.086) -- 0:00:12
793000 -- (-609.790) [-607.011] (-607.121) (-607.983) * (-606.178) [-605.168] (-605.939) (-606.659) -- 0:00:12
793500 -- (-606.535) (-608.749) [-607.274] (-607.088) * (-608.409) (-605.706) (-605.380) [-606.792] -- 0:00:12
794000 -- (-609.729) [-605.059] (-606.535) (-612.343) * [-608.608] (-605.588) (-603.489) (-607.701) -- 0:00:12
794500 -- (-606.762) (-604.833) (-607.135) [-608.415] * (-604.025) (-607.488) [-603.933] (-612.329) -- 0:00:12
795000 -- (-607.352) (-603.826) [-606.283] (-606.442) * [-604.882] (-605.787) (-604.625) (-604.531) -- 0:00:12
Average standard deviation of split frequencies: 0.009587
795500 -- (-604.320) [-604.360] (-607.385) (-604.674) * [-604.184] (-607.255) (-610.688) (-606.504) -- 0:00:12
796000 -- (-606.947) (-604.360) (-606.682) [-603.459] * (-604.704) [-607.492] (-605.793) (-609.963) -- 0:00:12
796500 -- (-603.522) (-604.764) [-605.329] (-604.216) * (-604.081) (-607.219) [-604.294] (-610.762) -- 0:00:12
797000 -- [-604.587] (-605.737) (-606.699) (-605.339) * (-604.244) (-606.729) (-604.961) [-605.461] -- 0:00:12
797500 -- (-605.465) (-607.358) (-608.144) [-603.771] * [-605.115] (-606.293) (-604.328) (-604.695) -- 0:00:12
798000 -- (-604.940) (-610.555) [-607.147] (-604.208) * (-604.795) (-605.145) [-604.743] (-604.751) -- 0:00:12
798500 -- [-606.203] (-607.871) (-606.537) (-609.629) * (-604.802) (-603.901) [-605.485] (-609.013) -- 0:00:12
799000 -- (-606.153) (-606.034) (-605.940) [-605.105] * (-604.856) (-607.363) [-605.055] (-606.020) -- 0:00:12
799500 -- (-607.355) (-604.337) (-604.752) [-604.305] * [-608.450] (-610.578) (-605.621) (-606.150) -- 0:00:12
800000 -- [-607.540] (-603.796) (-606.895) (-606.627) * (-604.008) (-603.893) [-606.568] (-605.428) -- 0:00:12
Average standard deviation of split frequencies: 0.009310
800500 -- (-605.748) (-612.228) (-604.793) [-609.503] * [-605.506] (-606.041) (-606.912) (-605.764) -- 0:00:12
801000 -- (-611.283) (-604.103) [-605.984] (-605.382) * (-610.361) (-607.023) [-611.862] (-606.023) -- 0:00:12
801500 -- (-605.103) (-607.298) [-607.936] (-607.117) * (-605.343) [-605.557] (-606.076) (-606.040) -- 0:00:12
802000 -- [-606.939] (-609.778) (-605.180) (-612.745) * [-605.413] (-604.010) (-606.154) (-607.387) -- 0:00:12
802500 -- [-606.961] (-607.701) (-608.820) (-611.636) * (-605.447) [-606.148] (-603.927) (-606.673) -- 0:00:12
803000 -- [-604.011] (-605.318) (-606.264) (-609.682) * (-605.806) (-606.965) [-605.180] (-607.779) -- 0:00:12
803500 -- [-604.213] (-604.355) (-606.373) (-607.056) * (-606.084) (-605.391) [-606.326] (-605.123) -- 0:00:11
804000 -- (-604.044) [-604.638] (-614.846) (-604.812) * [-604.870] (-609.785) (-604.656) (-605.374) -- 0:00:11
804500 -- (-604.345) (-605.113) [-605.848] (-607.067) * (-603.855) (-610.577) (-606.837) [-606.823] -- 0:00:11
805000 -- (-604.277) (-608.035) (-605.770) [-606.287] * (-605.218) [-609.576] (-603.782) (-604.784) -- 0:00:11
Average standard deviation of split frequencies: 0.009431
805500 -- [-604.046] (-605.544) (-605.505) (-605.718) * (-606.803) (-606.185) (-603.782) [-606.950] -- 0:00:11
806000 -- [-606.215] (-604.348) (-604.699) (-606.074) * (-606.133) (-608.201) [-603.829] (-605.464) -- 0:00:11
806500 -- [-604.709] (-608.843) (-604.292) (-606.459) * [-604.951] (-606.392) (-604.691) (-604.291) -- 0:00:11
807000 -- (-603.781) [-604.527] (-605.828) (-605.292) * [-605.567] (-604.703) (-612.359) (-605.952) -- 0:00:11
807500 -- (-606.609) (-605.193) [-604.502] (-604.663) * (-607.268) [-605.777] (-605.873) (-607.149) -- 0:00:11
808000 -- (-606.995) (-604.909) (-607.094) [-609.723] * (-606.603) (-603.454) [-604.354] (-604.812) -- 0:00:11
808500 -- (-605.271) [-606.832] (-605.862) (-606.511) * (-609.421) (-603.449) [-604.387] (-605.857) -- 0:00:11
809000 -- [-607.628] (-605.984) (-603.881) (-606.193) * (-605.215) [-603.449] (-604.286) (-606.132) -- 0:00:11
809500 -- (-605.277) (-608.286) [-603.777] (-605.226) * (-605.908) (-603.670) [-603.941] (-607.844) -- 0:00:11
810000 -- (-605.156) (-607.133) (-603.924) [-607.809] * [-606.939] (-605.551) (-604.487) (-612.176) -- 0:00:11
Average standard deviation of split frequencies: 0.009159
810500 -- (-607.718) (-604.915) [-604.182] (-603.847) * (-604.847) [-605.427] (-606.733) (-607.789) -- 0:00:11
811000 -- (-605.232) (-604.692) (-604.132) [-604.498] * (-608.079) (-604.933) (-604.731) [-604.299] -- 0:00:11
811500 -- (-603.919) [-605.275] (-606.739) (-603.822) * (-607.222) [-605.242] (-605.421) (-605.637) -- 0:00:11
812000 -- [-604.639] (-603.608) (-609.334) (-603.658) * (-610.352) (-606.230) [-605.867] (-604.658) -- 0:00:11
812500 -- [-604.442] (-606.090) (-606.776) (-605.341) * (-604.029) [-603.635] (-605.177) (-607.733) -- 0:00:11
813000 -- (-608.968) (-606.538) (-606.353) [-603.942] * (-604.808) [-603.839] (-604.514) (-605.830) -- 0:00:11
813500 -- (-608.224) [-605.440] (-606.675) (-607.044) * (-605.009) (-604.468) [-603.875] (-604.764) -- 0:00:11
814000 -- (-607.495) (-605.283) [-610.001] (-606.422) * (-604.583) (-604.317) [-609.081] (-605.446) -- 0:00:11
814500 -- [-606.420] (-606.552) (-608.396) (-605.633) * (-604.880) (-606.325) [-604.985] (-605.744) -- 0:00:11
815000 -- (-606.455) (-603.926) [-609.022] (-607.276) * (-604.547) (-607.498) [-605.256] (-609.298) -- 0:00:11
Average standard deviation of split frequencies: 0.009099
815500 -- (-605.756) (-604.974) (-607.222) [-604.475] * (-607.198) (-604.917) [-604.882] (-611.817) -- 0:00:11
816000 -- (-611.083) [-605.887] (-609.480) (-604.200) * (-607.925) (-606.155) [-604.728] (-605.947) -- 0:00:11
816500 -- (-607.705) [-604.217] (-605.603) (-604.634) * [-604.984] (-607.448) (-609.416) (-605.400) -- 0:00:11
817000 -- (-606.553) (-605.154) (-608.848) [-605.342] * (-607.519) (-604.193) (-610.011) [-605.394] -- 0:00:11
817500 -- (-609.275) (-608.291) [-604.756] (-605.956) * (-607.434) (-604.072) (-606.041) [-606.876] -- 0:00:11
818000 -- (-606.605) (-606.137) [-605.172] (-605.783) * [-604.814] (-604.329) (-605.403) (-608.358) -- 0:00:11
818500 -- (-605.090) [-604.715] (-606.577) (-608.010) * [-604.394] (-605.593) (-609.104) (-604.843) -- 0:00:11
819000 -- [-605.481] (-605.077) (-604.201) (-608.336) * (-606.403) [-604.927] (-608.457) (-608.956) -- 0:00:11
819500 -- [-605.026] (-606.883) (-604.951) (-607.797) * (-606.632) (-605.477) [-605.056] (-608.744) -- 0:00:11
820000 -- (-606.962) [-604.800] (-607.478) (-606.588) * [-604.623] (-604.081) (-604.151) (-607.099) -- 0:00:10
Average standard deviation of split frequencies: 0.008832
820500 -- (-608.123) (-604.919) [-604.710] (-604.784) * (-604.288) (-604.174) [-605.727] (-613.870) -- 0:00:10
821000 -- (-605.418) (-611.511) [-605.187] (-603.710) * (-605.902) (-604.021) (-604.866) [-607.973] -- 0:00:10
821500 -- [-606.074] (-606.464) (-604.624) (-608.220) * [-604.428] (-606.804) (-606.371) (-605.857) -- 0:00:10
822000 -- (-606.266) (-604.544) [-604.137] (-609.290) * (-605.032) (-605.773) (-605.112) [-605.101] -- 0:00:10
822500 -- (-607.333) (-606.105) (-604.751) [-605.090] * (-604.822) (-603.656) [-606.861] (-607.277) -- 0:00:10
823000 -- (-605.632) (-606.122) (-605.786) [-604.887] * (-604.796) (-607.352) (-605.300) [-606.223] -- 0:00:10
823500 -- [-605.647] (-605.378) (-605.772) (-607.099) * (-608.376) (-606.504) (-606.325) [-606.369] -- 0:00:10
824000 -- (-604.629) [-604.738] (-604.964) (-605.898) * (-607.491) [-605.859] (-608.815) (-604.673) -- 0:00:10
824500 -- (-608.033) (-607.633) (-605.648) [-606.144] * (-606.794) (-605.478) (-610.957) [-604.017] -- 0:00:10
825000 -- (-606.033) [-604.119] (-605.275) (-607.538) * [-606.540] (-606.169) (-609.476) (-603.957) -- 0:00:10
Average standard deviation of split frequencies: 0.009167
825500 -- (-606.191) [-604.235] (-604.648) (-603.950) * [-606.031] (-605.313) (-610.222) (-605.641) -- 0:00:10
826000 -- [-605.594] (-604.342) (-606.807) (-605.121) * (-607.069) (-604.205) [-605.059] (-604.568) -- 0:00:10
826500 -- [-606.042] (-604.554) (-608.953) (-604.848) * (-605.511) (-608.035) (-607.371) [-604.861] -- 0:00:10
827000 -- (-604.331) [-607.018] (-608.090) (-605.060) * [-604.416] (-605.834) (-606.244) (-603.906) -- 0:00:10
827500 -- (-604.964) [-606.050] (-604.021) (-604.339) * (-607.091) [-607.278] (-604.962) (-606.819) -- 0:00:10
828000 -- (-607.455) [-605.594] (-605.338) (-605.386) * (-611.035) (-610.230) (-605.746) [-603.920] -- 0:00:10
828500 -- (-606.826) (-605.922) (-604.512) [-605.099] * (-608.951) (-609.770) (-606.386) [-604.285] -- 0:00:10
829000 -- (-605.947) (-604.572) (-604.634) [-605.409] * (-608.523) [-606.199] (-608.239) (-606.166) -- 0:00:10
829500 -- (-606.760) (-604.328) [-605.492] (-606.964) * (-606.220) [-605.966] (-604.283) (-607.730) -- 0:00:10
830000 -- (-605.396) (-604.628) [-604.995] (-606.328) * (-604.008) (-606.440) [-606.313] (-606.139) -- 0:00:10
Average standard deviation of split frequencies: 0.008725
830500 -- (-605.842) (-605.065) (-607.815) [-606.788] * (-605.044) [-605.065] (-609.395) (-606.312) -- 0:00:10
831000 -- [-604.378] (-607.326) (-604.895) (-606.338) * (-606.609) [-605.606] (-604.726) (-606.359) -- 0:00:10
831500 -- (-604.662) (-609.563) [-605.130] (-607.013) * [-607.703] (-603.829) (-607.417) (-606.300) -- 0:00:10
832000 -- [-607.543] (-605.795) (-605.821) (-606.515) * (-604.464) (-604.303) [-608.555] (-606.750) -- 0:00:10
832500 -- (-608.232) (-608.889) (-606.722) [-605.786] * (-608.669) (-604.875) [-605.527] (-605.846) -- 0:00:10
833000 -- (-608.286) [-603.954] (-606.431) (-604.841) * (-604.999) (-607.128) [-603.410] (-606.009) -- 0:00:10
833500 -- (-604.540) (-605.665) (-609.101) [-607.061] * [-604.820] (-604.024) (-609.166) (-611.607) -- 0:00:10
834000 -- (-606.106) (-604.903) [-617.255] (-604.799) * [-606.414] (-608.839) (-603.541) (-609.372) -- 0:00:10
834500 -- (-606.511) [-605.760] (-606.312) (-607.101) * (-607.748) (-606.435) [-604.952] (-606.419) -- 0:00:10
835000 -- (-607.687) (-603.494) (-605.252) [-604.417] * (-608.491) (-609.999) (-604.683) [-609.603] -- 0:00:10
Average standard deviation of split frequencies: 0.008811
835500 -- (-607.045) (-604.128) (-604.126) [-605.462] * [-605.313] (-610.817) (-604.215) (-605.139) -- 0:00:10
836000 -- (-609.432) (-605.002) (-603.953) [-608.232] * [-605.613] (-605.752) (-605.163) (-605.252) -- 0:00:10
836500 -- (-607.751) (-604.782) [-606.378] (-606.031) * [-605.557] (-605.978) (-605.665) (-610.213) -- 0:00:09
837000 -- (-607.811) (-606.453) [-605.507] (-605.457) * [-604.933] (-603.634) (-606.560) (-604.795) -- 0:00:09
837500 -- (-604.095) (-605.679) [-607.599] (-604.666) * (-604.397) (-604.624) (-604.397) [-608.586] -- 0:00:09
838000 -- (-604.594) [-604.986] (-605.268) (-606.624) * (-607.760) [-604.705] (-605.294) (-606.943) -- 0:00:09
838500 -- (-605.204) (-605.536) [-604.319] (-605.107) * (-606.429) [-608.394] (-607.159) (-604.988) -- 0:00:09
839000 -- (-604.688) (-605.803) (-605.020) [-607.762] * (-605.558) [-608.430] (-607.363) (-609.725) -- 0:00:09
839500 -- (-608.543) [-605.040] (-607.865) (-605.212) * (-605.073) (-609.622) (-604.744) [-604.486] -- 0:00:09
840000 -- [-606.616] (-608.749) (-606.250) (-608.038) * (-604.712) (-612.916) [-605.773] (-603.973) -- 0:00:09
Average standard deviation of split frequencies: 0.008937
840500 -- (-604.544) (-605.686) [-610.799] (-605.365) * (-606.163) (-606.231) [-604.559] (-603.980) -- 0:00:09
841000 -- (-605.213) [-605.819] (-608.491) (-604.978) * (-604.654) (-605.942) [-604.943] (-605.435) -- 0:00:09
841500 -- (-604.375) (-606.766) (-607.899) [-604.891] * (-606.897) [-604.214] (-604.719) (-604.061) -- 0:00:09
842000 -- (-604.070) [-605.831] (-607.556) (-605.280) * (-604.957) (-603.756) (-604.090) [-605.880] -- 0:00:09
842500 -- (-605.340) (-605.812) [-604.067] (-606.742) * (-605.095) (-606.089) [-605.498] (-606.545) -- 0:00:09
843000 -- [-605.291] (-609.290) (-605.321) (-604.230) * [-608.657] (-609.138) (-603.966) (-604.384) -- 0:00:09
843500 -- (-605.727) [-605.537] (-604.797) (-604.485) * [-603.908] (-606.358) (-605.781) (-603.814) -- 0:00:09
844000 -- (-608.583) (-605.079) (-605.268) [-604.413] * [-604.716] (-605.005) (-604.013) (-604.087) -- 0:00:09
844500 -- (-610.153) (-604.880) (-605.171) [-606.399] * [-608.018] (-604.592) (-604.386) (-608.504) -- 0:00:09
845000 -- (-603.815) (-605.134) [-604.859] (-611.180) * (-606.264) [-606.925] (-605.769) (-607.309) -- 0:00:09
Average standard deviation of split frequencies: 0.009229
845500 -- [-605.080] (-605.751) (-610.647) (-606.144) * (-607.112) [-606.124] (-606.935) (-608.529) -- 0:00:09
846000 -- (-608.673) [-607.025] (-606.807) (-605.516) * [-608.342] (-604.701) (-608.058) (-610.012) -- 0:00:09
846500 -- (-606.597) [-606.534] (-604.843) (-605.262) * (-604.318) (-606.608) [-611.322] (-605.467) -- 0:00:09
847000 -- (-607.927) (-607.361) (-605.262) [-605.425] * (-605.310) (-609.073) [-607.888] (-610.550) -- 0:00:09
847500 -- (-605.439) [-605.554] (-607.721) (-604.789) * [-608.035] (-611.146) (-605.968) (-604.499) -- 0:00:09
848000 -- [-606.102] (-607.302) (-604.058) (-604.524) * [-608.594] (-606.441) (-605.547) (-605.552) -- 0:00:09
848500 -- [-604.334] (-604.202) (-607.327) (-604.616) * (-605.744) (-607.376) [-609.908] (-605.766) -- 0:00:09
849000 -- [-603.895] (-606.738) (-608.523) (-604.742) * (-605.751) (-604.782) (-605.130) [-605.752] -- 0:00:09
849500 -- [-605.148] (-605.676) (-606.449) (-607.121) * (-606.916) [-608.513] (-605.578) (-605.945) -- 0:00:09
850000 -- (-610.160) (-605.459) (-604.354) [-604.846] * [-608.759] (-605.495) (-607.998) (-604.760) -- 0:00:09
Average standard deviation of split frequencies: 0.008867
850500 -- [-606.279] (-606.904) (-608.534) (-608.264) * (-605.039) (-605.081) (-607.403) [-606.321] -- 0:00:09
851000 -- [-605.195] (-610.200) (-606.922) (-603.755) * (-605.752) [-607.140] (-606.578) (-604.544) -- 0:00:09
851500 -- (-613.833) (-607.329) [-607.197] (-606.305) * [-603.961] (-607.731) (-604.622) (-604.543) -- 0:00:09
852000 -- (-605.358) (-606.769) [-604.050] (-609.589) * (-607.424) (-610.165) (-607.599) [-605.123] -- 0:00:09
852500 -- (-603.673) (-605.050) (-606.045) [-607.034] * (-605.344) [-606.375] (-606.588) (-605.104) -- 0:00:08
853000 -- (-608.652) (-606.808) (-605.519) [-605.434] * (-606.039) (-606.637) [-604.556] (-604.932) -- 0:00:08
853500 -- (-613.095) [-606.524] (-608.860) (-604.837) * (-605.105) (-607.061) (-606.944) [-604.631] -- 0:00:08
854000 -- (-607.208) (-604.177) [-604.996] (-605.748) * (-605.231) (-606.008) [-605.516] (-605.439) -- 0:00:08
854500 -- (-611.978) (-605.595) [-604.123] (-604.573) * (-606.953) [-609.839] (-606.367) (-606.192) -- 0:00:08
855000 -- [-606.459] (-606.862) (-604.271) (-605.900) * (-607.343) (-605.225) [-605.181] (-605.363) -- 0:00:08
Average standard deviation of split frequencies: 0.008949
855500 -- (-604.374) [-607.838] (-603.913) (-606.216) * (-605.325) (-606.784) (-606.682) [-606.631] -- 0:00:08
856000 -- [-603.897] (-605.994) (-604.743) (-606.424) * (-607.114) (-605.492) [-605.736] (-607.190) -- 0:00:08
856500 -- (-606.117) (-605.727) [-604.017] (-606.367) * (-608.750) (-606.521) (-604.560) [-607.157] -- 0:00:08
857000 -- [-606.039] (-604.355) (-605.351) (-604.407) * (-608.576) (-604.842) [-604.518] (-604.999) -- 0:00:08
857500 -- (-607.420) (-604.834) [-604.121] (-605.821) * (-605.383) (-608.082) [-604.924] (-604.310) -- 0:00:08
858000 -- [-607.962] (-605.386) (-604.053) (-606.158) * (-605.426) (-605.235) (-604.878) [-604.861] -- 0:00:08
858500 -- (-609.563) (-605.183) [-604.535] (-607.009) * (-610.411) (-606.783) (-609.004) [-605.391] -- 0:00:08
859000 -- (-607.034) [-605.023] (-607.178) (-608.502) * [-607.157] (-608.309) (-608.382) (-607.448) -- 0:00:08
859500 -- (-604.888) (-605.205) (-609.518) [-606.331] * (-605.500) [-607.613] (-606.729) (-606.126) -- 0:00:08
860000 -- (-610.139) (-604.405) (-610.375) [-604.603] * (-605.358) (-606.217) (-603.969) [-604.997] -- 0:00:08
Average standard deviation of split frequencies: 0.009165
860500 -- (-606.906) (-604.280) (-609.984) [-606.109] * (-605.357) (-605.855) (-611.502) [-604.574] -- 0:00:08
861000 -- (-607.921) (-605.130) (-605.186) [-605.633] * (-604.417) (-608.564) (-607.606) [-605.058] -- 0:00:08
861500 -- (-605.497) (-608.629) [-604.944] (-610.974) * (-604.991) [-606.647] (-607.047) (-608.210) -- 0:00:08
862000 -- (-606.751) (-607.007) (-604.335) [-605.487] * (-607.194) (-610.321) [-605.173] (-605.819) -- 0:00:08
862500 -- (-605.462) (-610.653) (-608.611) [-607.113] * (-605.802) (-606.206) (-605.681) [-605.956] -- 0:00:08
863000 -- (-605.271) (-609.152) (-605.200) [-607.199] * (-604.778) (-603.674) [-605.256] (-606.445) -- 0:00:08
863500 -- [-603.730] (-604.866) (-606.487) (-607.885) * (-605.691) (-605.385) [-605.924] (-611.518) -- 0:00:08
864000 -- (-606.123) [-606.338] (-604.804) (-605.939) * [-604.529] (-603.641) (-603.768) (-606.056) -- 0:00:08
864500 -- (-604.546) (-611.916) (-608.552) [-606.454] * (-607.657) [-604.219] (-605.668) (-605.647) -- 0:00:08
865000 -- [-605.950] (-606.151) (-612.908) (-606.725) * (-607.019) (-609.485) [-606.195] (-605.760) -- 0:00:08
Average standard deviation of split frequencies: 0.008778
865500 -- (-605.714) (-605.961) (-604.261) [-606.297] * (-607.415) (-609.700) [-610.788] (-606.607) -- 0:00:08
866000 -- [-604.878] (-607.139) (-605.416) (-605.283) * [-607.786] (-609.336) (-607.040) (-605.945) -- 0:00:08
866500 -- [-605.772] (-605.782) (-610.425) (-604.649) * (-604.985) (-606.094) (-605.207) [-605.156] -- 0:00:08
867000 -- (-604.813) (-605.789) [-607.155] (-605.785) * (-605.415) (-606.641) (-605.599) [-606.101] -- 0:00:08
867500 -- (-604.283) (-604.503) (-605.978) [-607.525] * (-610.880) (-609.048) (-605.851) [-606.676] -- 0:00:08
868000 -- (-605.319) [-604.763] (-605.779) (-606.600) * (-608.258) (-609.598) (-604.677) [-604.794] -- 0:00:08
868500 -- (-605.755) (-606.282) [-604.042] (-606.846) * (-608.546) (-606.137) [-604.162] (-605.419) -- 0:00:08
869000 -- (-607.334) (-606.237) [-605.954] (-605.688) * (-610.357) (-609.449) [-605.071] (-606.219) -- 0:00:07
869500 -- [-607.910] (-604.859) (-605.903) (-604.043) * (-607.135) (-611.014) (-605.357) [-610.315] -- 0:00:07
870000 -- (-604.917) [-606.020] (-608.829) (-606.111) * (-606.644) (-603.816) (-604.069) [-606.611] -- 0:00:07
Average standard deviation of split frequencies: 0.008518
870500 -- [-605.575] (-606.657) (-605.415) (-604.259) * [-603.931] (-605.671) (-604.758) (-605.725) -- 0:00:07
871000 -- (-607.163) [-606.039] (-604.847) (-604.691) * (-604.608) (-606.203) [-606.443] (-606.806) -- 0:00:07
871500 -- [-604.638] (-605.423) (-604.177) (-607.734) * [-604.075] (-604.953) (-607.367) (-605.094) -- 0:00:07
872000 -- [-608.254] (-604.773) (-603.832) (-608.565) * [-604.852] (-603.978) (-606.500) (-606.314) -- 0:00:07
872500 -- (-604.233) [-604.017] (-607.757) (-609.559) * (-604.903) [-606.924] (-607.798) (-606.221) -- 0:00:07
873000 -- (-604.063) [-605.250] (-609.726) (-606.306) * (-605.750) (-607.375) (-612.179) [-610.570] -- 0:00:07
873500 -- (-609.139) (-604.479) (-605.611) [-604.290] * (-604.887) (-611.655) [-604.584] (-605.764) -- 0:00:07
874000 -- (-604.673) (-605.551) (-607.181) [-604.507] * (-608.935) [-605.279] (-605.295) (-605.323) -- 0:00:07
874500 -- (-610.509) [-606.703] (-606.964) (-606.560) * [-604.651] (-605.662) (-610.340) (-606.089) -- 0:00:07
875000 -- (-611.700) (-610.040) (-604.296) [-608.173] * (-606.564) (-606.807) [-607.982] (-606.719) -- 0:00:07
Average standard deviation of split frequencies: 0.008359
875500 -- (-606.084) [-605.004] (-605.425) (-604.870) * (-604.407) (-605.664) [-606.181] (-604.791) -- 0:00:07
876000 -- [-605.503] (-604.973) (-604.225) (-605.105) * (-606.653) (-606.325) (-606.052) [-604.787] -- 0:00:07
876500 -- (-604.276) (-605.043) (-604.861) [-606.520] * (-610.431) [-604.815] (-607.645) (-608.904) -- 0:00:07
877000 -- (-605.706) [-605.623] (-605.560) (-607.047) * (-603.962) (-604.312) [-605.626] (-606.577) -- 0:00:07
877500 -- (-605.773) (-605.443) (-604.612) [-606.286] * (-606.030) [-604.767] (-606.403) (-606.004) -- 0:00:07
878000 -- [-607.620] (-607.901) (-605.307) (-606.846) * (-607.411) (-605.633) (-605.190) [-605.694] -- 0:00:07
878500 -- (-603.734) [-604.788] (-604.187) (-605.405) * (-605.231) [-605.027] (-606.283) (-606.217) -- 0:00:07
879000 -- (-603.967) [-606.067] (-608.305) (-604.840) * (-605.083) (-605.100) [-605.531] (-607.768) -- 0:00:07
879500 -- [-605.251] (-604.106) (-605.576) (-612.918) * (-608.861) (-604.316) [-604.156] (-609.247) -- 0:00:07
880000 -- (-606.040) (-604.974) [-607.229] (-610.819) * (-608.398) (-606.280) [-605.870] (-603.658) -- 0:00:07
Average standard deviation of split frequencies: 0.008386
880500 -- (-606.246) (-605.270) [-604.749] (-609.472) * (-606.075) (-607.113) (-605.523) [-605.295] -- 0:00:07
881000 -- (-608.646) [-604.006] (-605.793) (-603.762) * (-608.145) [-606.016] (-606.457) (-605.491) -- 0:00:07
881500 -- (-605.720) (-610.272) (-605.470) [-604.610] * (-609.341) [-605.060] (-609.316) (-607.598) -- 0:00:07
882000 -- (-607.680) (-606.317) [-605.934] (-606.912) * (-606.176) (-605.665) (-607.227) [-607.114] -- 0:00:07
882500 -- (-607.640) (-607.139) [-605.109] (-606.994) * (-607.531) (-604.867) (-606.090) [-604.953] -- 0:00:07
883000 -- (-607.170) (-605.643) (-604.873) [-604.568] * (-603.988) (-605.881) [-605.132] (-605.853) -- 0:00:07
883500 -- [-606.466] (-604.469) (-606.110) (-604.370) * (-607.647) (-606.859) [-605.102] (-613.936) -- 0:00:07
884000 -- (-610.249) [-609.082] (-604.359) (-605.238) * [-608.518] (-606.543) (-605.642) (-606.054) -- 0:00:07
884500 -- (-609.723) (-604.410) [-607.679] (-604.555) * (-604.775) (-605.846) (-604.664) [-604.954] -- 0:00:07
885000 -- (-604.615) (-605.547) [-606.168] (-604.518) * (-608.210) (-605.535) (-604.642) [-605.924] -- 0:00:07
Average standard deviation of split frequencies: 0.008247
885500 -- (-611.050) (-604.782) [-605.534] (-605.153) * (-603.807) (-605.216) (-606.380) [-606.547] -- 0:00:06
886000 -- (-604.446) (-608.723) (-604.975) [-606.998] * (-605.040) (-604.468) [-606.866] (-604.810) -- 0:00:06
886500 -- (-605.960) [-605.485] (-605.711) (-604.321) * (-605.890) (-606.434) (-610.431) [-606.280] -- 0:00:06
887000 -- (-604.942) [-605.245] (-606.416) (-604.569) * [-604.578] (-609.888) (-604.144) (-606.907) -- 0:00:06
887500 -- (-606.648) (-605.538) (-604.121) [-607.331] * [-605.710] (-607.626) (-607.199) (-605.158) -- 0:00:06
888000 -- (-603.958) [-606.645] (-606.782) (-609.478) * [-605.577] (-604.073) (-604.608) (-606.671) -- 0:00:06
888500 -- (-605.964) (-606.455) [-608.139] (-608.899) * (-606.347) (-607.296) (-607.199) [-605.953] -- 0:00:06
889000 -- (-606.128) (-612.779) (-607.171) [-605.607] * (-606.362) (-608.589) [-607.035] (-605.111) -- 0:00:06
889500 -- (-605.005) (-606.763) [-609.758] (-603.832) * (-604.991) [-609.387] (-606.328) (-606.726) -- 0:00:06
890000 -- [-605.104] (-606.601) (-604.114) (-604.864) * [-604.642] (-604.281) (-607.515) (-609.180) -- 0:00:06
Average standard deviation of split frequencies: 0.008204
890500 -- (-604.767) (-606.927) (-606.514) [-604.520] * (-608.342) [-603.756] (-606.063) (-605.603) -- 0:00:06
891000 -- (-605.049) (-606.285) [-605.587] (-604.845) * (-606.126) (-604.660) [-608.033] (-607.760) -- 0:00:06
891500 -- (-605.905) [-604.534] (-609.650) (-605.417) * (-605.514) (-604.895) [-604.850] (-604.715) -- 0:00:06
892000 -- (-606.585) (-611.039) [-603.823] (-605.244) * [-610.237] (-605.668) (-605.918) (-604.736) -- 0:00:06
892500 -- (-604.388) (-610.488) [-606.735] (-606.466) * (-607.077) (-604.545) [-609.669] (-606.922) -- 0:00:06
893000 -- [-606.759] (-611.884) (-604.282) (-603.968) * (-606.930) (-608.752) (-608.042) [-605.535] -- 0:00:06
893500 -- [-604.545] (-604.276) (-607.030) (-604.289) * [-603.841] (-609.339) (-605.126) (-607.724) -- 0:00:06
894000 -- [-604.578] (-605.728) (-603.848) (-604.515) * (-605.455) (-607.603) (-604.996) [-604.379] -- 0:00:06
894500 -- [-603.755] (-607.688) (-604.897) (-607.605) * (-609.787) (-605.623) [-606.246] (-604.356) -- 0:00:06
895000 -- (-607.487) (-605.579) (-604.682) [-604.664] * (-610.048) (-605.445) (-605.535) [-603.673] -- 0:00:06
Average standard deviation of split frequencies: 0.008418
895500 -- [-607.165] (-608.181) (-604.797) (-604.709) * (-608.495) (-604.909) [-606.155] (-603.985) -- 0:00:06
896000 -- (-604.255) [-607.417] (-604.359) (-613.422) * [-605.294] (-606.873) (-605.995) (-604.275) -- 0:00:06
896500 -- (-606.528) (-609.781) (-604.448) [-604.177] * [-604.294] (-604.535) (-606.961) (-611.431) -- 0:00:06
897000 -- (-609.699) (-607.608) [-604.815] (-604.265) * [-607.285] (-607.661) (-611.794) (-605.004) -- 0:00:06
897500 -- [-604.831] (-604.877) (-605.160) (-603.351) * [-606.067] (-606.067) (-605.823) (-606.802) -- 0:00:06
898000 -- [-605.733] (-605.443) (-606.389) (-603.689) * (-607.472) (-604.092) (-607.631) [-603.684] -- 0:00:06
898500 -- (-606.056) (-607.027) [-606.245] (-608.624) * [-606.229] (-604.252) (-606.311) (-605.643) -- 0:00:06
899000 -- (-606.183) [-606.188] (-609.508) (-610.271) * [-607.593] (-606.438) (-605.098) (-608.114) -- 0:00:06
899500 -- [-607.434] (-606.170) (-608.289) (-607.795) * (-606.668) (-609.976) [-604.863] (-607.614) -- 0:00:06
900000 -- (-605.661) (-605.138) (-605.775) [-604.262] * (-606.007) (-605.921) [-605.499] (-610.806) -- 0:00:06
Average standard deviation of split frequencies: 0.008723
900500 -- (-605.428) (-607.042) [-607.478] (-604.378) * (-605.873) (-604.880) [-604.442] (-609.267) -- 0:00:06
901000 -- [-606.378] (-607.152) (-606.236) (-604.378) * (-607.897) (-610.088) [-604.012] (-605.916) -- 0:00:06
901500 -- [-607.884] (-605.839) (-606.602) (-604.840) * (-606.310) (-610.234) [-604.278] (-604.369) -- 0:00:06
902000 -- (-606.983) (-607.058) (-604.909) [-607.662] * [-605.998] (-604.026) (-605.305) (-605.037) -- 0:00:05
902500 -- [-605.975] (-606.450) (-604.110) (-604.598) * [-605.979] (-603.673) (-606.458) (-604.493) -- 0:00:05
903000 -- (-606.769) (-605.566) (-607.810) [-603.575] * (-606.766) (-604.134) (-607.107) [-604.938] -- 0:00:05
903500 -- [-605.720] (-604.958) (-604.778) (-604.663) * [-609.266] (-604.134) (-608.955) (-603.926) -- 0:00:05
904000 -- [-604.978] (-603.917) (-608.274) (-603.739) * [-605.998] (-607.786) (-604.732) (-604.469) -- 0:00:05
904500 -- (-603.736) (-603.976) [-607.318] (-603.732) * (-604.828) (-608.207) (-606.904) [-605.687] -- 0:00:05
905000 -- (-603.739) (-607.713) (-606.271) [-605.612] * (-605.179) (-604.797) (-607.438) [-606.277] -- 0:00:05
Average standard deviation of split frequencies: 0.008650
905500 -- (-604.758) (-607.401) [-607.853] (-604.124) * (-604.864) (-604.537) (-607.272) [-606.275] -- 0:00:05
906000 -- [-606.192] (-609.041) (-606.000) (-604.724) * [-605.884] (-604.498) (-604.647) (-606.361) -- 0:00:05
906500 -- (-608.436) (-604.682) (-605.531) [-605.394] * (-605.902) (-604.303) (-604.963) [-605.504] -- 0:00:05
907000 -- (-607.777) (-605.890) [-603.962] (-605.857) * [-608.620] (-604.726) (-605.062) (-607.112) -- 0:00:05
907500 -- [-605.245] (-605.805) (-605.415) (-605.585) * (-606.081) (-605.493) (-604.148) [-605.383] -- 0:00:05
908000 -- [-603.750] (-611.316) (-609.019) (-604.967) * (-604.863) [-604.427] (-604.336) (-605.545) -- 0:00:05
908500 -- (-604.006) [-604.821] (-608.602) (-605.217) * (-607.460) (-604.072) (-604.691) [-606.550] -- 0:00:05
909000 -- (-607.681) [-605.040] (-604.673) (-606.991) * (-606.640) [-609.483] (-604.952) (-605.684) -- 0:00:05
909500 -- (-610.836) (-606.752) (-606.369) [-607.002] * (-606.410) (-608.794) [-605.070] (-606.127) -- 0:00:05
910000 -- (-606.752) (-604.780) (-607.165) [-606.107] * (-605.534) (-605.990) (-606.864) [-608.086] -- 0:00:05
Average standard deviation of split frequencies: 0.008282
910500 -- (-606.873) (-604.710) (-605.728) [-607.551] * [-608.513] (-605.340) (-605.512) (-607.376) -- 0:00:05
911000 -- [-607.050] (-606.959) (-604.569) (-609.772) * (-607.972) (-605.549) [-605.567] (-607.031) -- 0:00:05
911500 -- (-605.993) (-605.159) (-608.451) [-605.046] * (-604.699) (-605.750) (-606.272) [-607.676] -- 0:00:05
912000 -- (-607.649) [-607.493] (-613.051) (-607.468) * (-604.898) [-605.767] (-605.796) (-606.040) -- 0:00:05
912500 -- (-610.363) [-605.049] (-605.669) (-604.965) * (-606.051) [-605.199] (-604.945) (-605.943) -- 0:00:05
913000 -- (-606.306) (-604.894) (-604.787) [-604.237] * (-604.824) [-605.856] (-604.271) (-606.620) -- 0:00:05
913500 -- (-608.542) (-605.023) (-604.422) [-607.893] * (-605.958) [-605.683] (-605.050) (-604.661) -- 0:00:05
914000 -- (-603.877) [-604.823] (-612.782) (-603.868) * (-604.723) [-608.658] (-611.208) (-604.839) -- 0:00:05
914500 -- (-603.898) (-605.845) (-609.694) [-605.261] * (-604.844) [-606.033] (-605.883) (-606.637) -- 0:00:05
915000 -- (-604.305) [-606.616] (-606.093) (-604.767) * (-604.772) (-606.203) (-606.922) [-607.907] -- 0:00:05
Average standard deviation of split frequencies: 0.007994
915500 -- (-605.663) (-606.885) [-610.227] (-606.052) * (-606.682) [-607.062] (-606.895) (-605.744) -- 0:00:05
916000 -- (-607.406) (-606.674) [-606.347] (-606.164) * (-604.098) (-605.170) (-604.480) [-606.851] -- 0:00:05
916500 -- (-605.860) [-604.774] (-608.185) (-608.061) * [-607.948] (-603.861) (-607.629) (-605.074) -- 0:00:05
917000 -- (-606.730) (-605.517) (-608.970) [-607.964] * (-607.164) (-606.088) (-606.475) [-604.478] -- 0:00:05
917500 -- (-608.745) (-606.210) [-606.492] (-607.300) * (-604.135) [-604.232] (-608.772) (-603.812) -- 0:00:05
918000 -- [-612.285] (-613.242) (-606.701) (-604.062) * (-604.902) (-605.964) [-605.604] (-605.606) -- 0:00:05
918500 -- (-608.571) (-606.048) [-603.981] (-605.756) * [-604.649] (-605.606) (-612.799) (-607.452) -- 0:00:04
919000 -- [-604.840] (-606.228) (-608.223) (-607.375) * (-608.936) (-605.435) (-605.294) [-609.801] -- 0:00:04
919500 -- [-604.372] (-608.582) (-605.361) (-608.502) * [-608.919] (-606.049) (-611.397) (-607.232) -- 0:00:04
920000 -- (-607.268) (-607.109) [-605.936] (-605.350) * [-607.325] (-605.769) (-605.449) (-605.838) -- 0:00:04
Average standard deviation of split frequencies: 0.007953
920500 -- (-607.097) [-607.804] (-604.386) (-605.544) * (-604.201) (-605.683) [-605.173] (-607.212) -- 0:00:04
921000 -- (-605.512) (-606.052) [-604.967] (-604.590) * (-605.158) (-605.871) (-604.635) [-606.502] -- 0:00:04
921500 -- (-605.251) (-610.281) [-604.589] (-605.307) * (-606.629) [-604.494] (-603.558) (-606.413) -- 0:00:04
922000 -- [-605.422] (-611.756) (-604.301) (-605.510) * (-604.297) (-604.822) [-603.502] (-610.349) -- 0:00:04
922500 -- (-606.329) (-607.902) (-603.777) [-609.300] * (-604.017) [-604.872] (-607.647) (-605.094) -- 0:00:04
923000 -- [-606.904] (-609.695) (-604.929) (-607.768) * [-605.181] (-605.674) (-605.138) (-605.386) -- 0:00:04
923500 -- (-612.596) (-608.457) (-606.654) [-605.296] * (-608.890) [-604.381] (-605.451) (-606.611) -- 0:00:04
924000 -- [-605.370] (-604.927) (-607.662) (-606.864) * (-606.461) (-605.028) [-607.981] (-606.230) -- 0:00:04
924500 -- [-604.389] (-608.565) (-614.641) (-605.785) * (-605.556) [-603.904] (-606.027) (-612.583) -- 0:00:04
925000 -- (-606.889) [-606.812] (-604.991) (-608.756) * (-608.650) [-603.540] (-605.033) (-604.031) -- 0:00:04
Average standard deviation of split frequencies: 0.007541
925500 -- (-609.621) (-605.597) [-609.555] (-606.388) * (-605.320) [-605.262] (-608.608) (-605.822) -- 0:00:04
926000 -- (-609.760) [-604.695] (-609.741) (-606.759) * (-608.990) (-606.037) [-607.156] (-605.048) -- 0:00:04
926500 -- (-609.488) (-605.459) (-610.587) [-605.785] * (-606.827) (-606.929) (-606.224) [-603.868] -- 0:00:04
927000 -- (-607.349) (-604.966) (-604.364) [-611.991] * (-605.391) (-605.339) [-605.680] (-608.405) -- 0:00:04
927500 -- (-609.276) (-605.435) [-604.621] (-604.911) * (-604.347) [-608.563] (-607.641) (-606.044) -- 0:00:04
928000 -- (-606.536) (-606.050) [-604.879] (-607.336) * [-605.671] (-609.661) (-607.373) (-605.786) -- 0:00:04
928500 -- (-607.070) (-605.871) [-605.294] (-609.334) * (-605.270) (-606.019) (-605.784) [-604.738] -- 0:00:04
929000 -- (-608.250) [-603.989] (-607.796) (-605.908) * [-604.902] (-607.691) (-607.008) (-605.159) -- 0:00:04
929500 -- (-606.074) (-603.986) (-606.014) [-607.647] * (-603.590) [-606.705] (-606.099) (-605.558) -- 0:00:04
930000 -- (-607.348) (-606.567) (-605.924) [-608.767] * (-603.745) [-604.699] (-606.599) (-610.411) -- 0:00:04
Average standard deviation of split frequencies: 0.007724
930500 -- (-605.231) (-606.529) (-605.085) [-606.988] * (-606.297) [-606.526] (-606.531) (-606.944) -- 0:00:04
931000 -- (-605.026) (-605.245) [-604.126] (-606.931) * (-606.567) (-605.984) [-604.654] (-606.476) -- 0:00:04
931500 -- (-606.087) [-606.191] (-606.372) (-607.127) * (-604.246) (-606.949) (-605.759) [-606.650] -- 0:00:04
932000 -- (-607.795) (-605.166) (-607.309) [-604.445] * (-604.633) (-611.685) (-604.222) [-605.182] -- 0:00:04
932500 -- (-605.842) (-604.434) (-605.602) [-603.882] * (-605.211) [-604.091] (-607.412) (-606.299) -- 0:00:04
933000 -- [-604.458] (-604.473) (-605.725) (-605.165) * (-606.677) (-604.300) (-604.455) [-605.455] -- 0:00:04
933500 -- (-605.071) (-605.326) (-605.542) [-605.672] * (-607.461) (-604.948) [-604.392] (-605.012) -- 0:00:04
934000 -- (-609.944) (-604.384) [-605.242] (-606.359) * (-606.623) (-606.573) [-603.747] (-607.505) -- 0:00:04
934500 -- (-605.395) (-607.477) (-605.852) [-606.301] * (-606.888) (-606.441) [-603.934] (-604.574) -- 0:00:03
935000 -- (-607.688) (-606.967) (-607.867) [-606.563] * (-607.016) (-606.307) (-606.155) [-604.188] -- 0:00:03
Average standard deviation of split frequencies: 0.007964
935500 -- [-606.109] (-605.505) (-605.681) (-604.803) * (-604.603) (-609.323) (-608.705) [-607.091] -- 0:00:03
936000 -- (-606.315) (-604.688) (-606.212) [-605.699] * (-605.692) (-610.768) [-606.484] (-605.048) -- 0:00:03
936500 -- (-605.661) (-607.299) (-606.649) [-603.999] * (-605.759) (-611.796) (-606.102) [-609.306] -- 0:00:03
937000 -- (-605.220) (-608.234) (-606.476) [-605.670] * (-604.134) [-605.691] (-605.986) (-607.485) -- 0:00:03
937500 -- [-605.182] (-606.307) (-605.358) (-605.335) * (-605.659) [-610.467] (-605.144) (-605.009) -- 0:00:03
938000 -- [-604.165] (-606.049) (-605.261) (-605.513) * (-605.556) (-605.845) [-603.878] (-606.955) -- 0:00:03
938500 -- (-605.980) (-606.757) (-604.871) [-607.498] * (-604.984) [-605.621] (-604.417) (-605.160) -- 0:00:03
939000 -- (-606.563) (-607.217) [-606.512] (-605.342) * (-604.932) (-604.130) (-604.316) [-604.301] -- 0:00:03
939500 -- (-605.118) [-604.889] (-604.051) (-605.064) * (-605.884) (-605.020) (-605.844) [-606.241] -- 0:00:03
940000 -- (-606.333) (-604.308) (-604.047) [-605.401] * [-607.475] (-604.628) (-606.774) (-607.048) -- 0:00:03
Average standard deviation of split frequencies: 0.008144
940500 -- (-605.005) (-605.487) [-603.768] (-607.495) * (-605.846) (-606.621) (-606.113) [-603.665] -- 0:00:03
941000 -- [-606.645] (-606.157) (-605.056) (-604.345) * (-609.402) (-604.354) [-605.778] (-605.271) -- 0:00:03
941500 -- [-604.961] (-606.834) (-605.648) (-606.100) * (-604.707) [-605.964] (-603.942) (-604.442) -- 0:00:03
942000 -- (-606.396) [-607.185] (-604.465) (-606.959) * (-604.480) [-604.296] (-603.955) (-606.501) -- 0:00:03
942500 -- (-605.145) [-604.015] (-606.631) (-607.396) * [-604.748] (-607.562) (-603.974) (-607.335) -- 0:00:03
943000 -- (-606.305) (-606.105) [-606.182] (-605.236) * (-606.831) [-603.985] (-604.906) (-606.190) -- 0:00:03
943500 -- (-604.918) [-607.680] (-604.804) (-606.254) * (-606.917) (-605.147) (-607.634) [-607.687] -- 0:00:03
944000 -- (-605.780) (-611.480) [-604.445] (-610.154) * (-605.439) (-604.984) (-610.999) [-603.835] -- 0:00:03
944500 -- [-606.005] (-604.039) (-606.176) (-604.998) * [-605.574] (-606.874) (-606.552) (-605.382) -- 0:00:03
945000 -- (-607.689) [-605.787] (-606.780) (-607.981) * (-608.209) (-608.285) [-605.596] (-605.907) -- 0:00:03
Average standard deviation of split frequencies: 0.007911
945500 -- (-605.619) (-607.516) [-605.114] (-610.782) * (-604.956) (-604.876) [-603.910] (-606.342) -- 0:00:03
946000 -- (-605.406) (-606.090) (-610.393) [-610.788] * (-605.053) (-605.354) (-607.230) [-605.739] -- 0:00:03
946500 -- (-607.111) (-606.622) (-606.020) [-606.560] * (-605.815) (-607.073) [-607.357] (-607.228) -- 0:00:03
947000 -- (-605.579) [-604.603] (-605.103) (-608.389) * [-606.128] (-605.235) (-605.514) (-606.121) -- 0:00:03
947500 -- [-606.978] (-605.792) (-604.970) (-606.039) * (-606.712) (-604.923) [-605.699] (-604.608) -- 0:00:03
948000 -- (-604.829) (-605.164) (-607.903) [-605.606] * (-606.742) (-604.081) [-609.790] (-603.969) -- 0:00:03
948500 -- [-606.605] (-605.290) (-604.748) (-605.985) * (-608.757) (-604.062) [-607.011] (-603.763) -- 0:00:03
949000 -- (-606.430) (-606.704) [-611.763] (-604.468) * (-604.130) [-606.820] (-607.063) (-605.245) -- 0:00:03
949500 -- (-606.791) (-605.399) (-605.020) [-604.668] * (-605.280) (-604.855) [-608.425] (-606.908) -- 0:00:03
950000 -- [-607.138] (-607.633) (-604.141) (-604.723) * (-603.819) [-604.900] (-605.485) (-605.338) -- 0:00:03
Average standard deviation of split frequencies: 0.007841
950500 -- (-606.944) [-606.080] (-605.775) (-603.943) * (-604.802) (-604.926) (-606.063) [-608.385] -- 0:00:03
951000 -- (-604.592) (-607.377) [-604.114] (-606.634) * (-604.818) (-608.826) (-604.550) [-604.865] -- 0:00:02
951500 -- [-604.261] (-605.170) (-604.080) (-605.001) * (-607.326) (-607.000) [-604.678] (-608.454) -- 0:00:02
952000 -- (-604.202) (-606.298) (-605.529) [-607.407] * (-605.896) (-604.338) [-604.305] (-605.337) -- 0:00:02
952500 -- (-606.735) (-607.209) (-606.222) [-605.986] * (-604.972) (-605.489) [-606.131] (-606.456) -- 0:00:02
953000 -- (-606.985) [-606.161] (-606.778) (-609.339) * (-607.915) [-605.346] (-607.401) (-603.981) -- 0:00:02
953500 -- [-606.559] (-606.524) (-606.290) (-607.945) * (-606.968) [-604.803] (-606.228) (-604.366) -- 0:00:02
954000 -- (-608.714) (-604.236) [-604.886] (-603.684) * (-603.911) (-606.692) (-604.615) [-605.696] -- 0:00:02
954500 -- (-605.625) [-606.322] (-605.704) (-607.515) * (-605.952) [-603.835] (-605.420) (-604.507) -- 0:00:02
955000 -- (-605.683) (-606.920) (-604.590) [-608.463] * (-605.337) (-605.007) (-603.822) [-604.682] -- 0:00:02
Average standard deviation of split frequencies: 0.007766
955500 -- (-604.500) (-606.680) (-605.893) [-606.848] * [-604.896] (-605.184) (-606.080) (-608.090) -- 0:00:02
956000 -- [-607.475] (-608.665) (-605.577) (-604.641) * (-607.792) [-605.506] (-605.605) (-606.504) -- 0:00:02
956500 -- (-605.891) (-603.661) [-608.948] (-606.483) * (-606.655) [-604.913] (-610.441) (-608.514) -- 0:00:02
957000 -- (-604.383) [-603.979] (-604.838) (-609.002) * (-608.020) (-604.843) [-609.248] (-607.262) -- 0:00:02
957500 -- (-606.457) [-605.682] (-605.489) (-613.077) * (-608.494) (-604.435) (-606.415) [-605.356] -- 0:00:02
958000 -- (-604.750) (-606.073) (-607.475) [-608.806] * (-606.635) [-604.759] (-612.256) (-603.866) -- 0:00:02
958500 -- (-606.649) (-605.781) (-606.083) [-603.993] * (-606.099) (-604.793) [-606.754] (-604.324) -- 0:00:02
959000 -- (-607.060) (-604.991) (-610.745) [-609.703] * (-606.715) (-608.671) (-608.652) [-610.066] -- 0:00:02
959500 -- [-606.632] (-604.115) (-605.397) (-606.003) * (-612.308) [-605.194] (-607.333) (-606.367) -- 0:00:02
960000 -- (-606.475) (-605.217) [-604.438] (-604.076) * [-608.768] (-608.163) (-606.203) (-605.115) -- 0:00:02
Average standard deviation of split frequencies: 0.007821
960500 -- (-605.900) (-604.502) [-610.090] (-604.393) * [-606.093] (-605.170) (-606.582) (-606.175) -- 0:00:02
961000 -- (-607.537) (-606.892) [-605.885] (-605.442) * [-608.336] (-606.415) (-605.108) (-605.639) -- 0:00:02
961500 -- [-604.030] (-608.659) (-604.911) (-605.987) * (-609.701) (-604.238) [-604.476] (-604.952) -- 0:00:02
962000 -- [-605.197] (-608.101) (-606.303) (-605.094) * (-607.782) [-604.221] (-606.626) (-607.221) -- 0:00:02
962500 -- (-606.358) (-605.167) (-606.542) [-604.634] * (-608.227) [-604.243] (-605.185) (-606.392) -- 0:00:02
963000 -- (-606.837) (-607.670) (-603.548) [-605.103] * (-609.282) [-604.594] (-603.999) (-604.700) -- 0:00:02
963500 -- [-609.213] (-614.355) (-606.532) (-607.289) * (-607.276) (-605.429) [-604.825] (-605.890) -- 0:00:02
964000 -- (-605.375) [-611.026] (-607.896) (-603.836) * [-606.748] (-606.220) (-603.533) (-604.562) -- 0:00:02
964500 -- (-609.659) (-608.261) (-605.863) [-605.377] * [-605.602] (-612.117) (-604.674) (-604.461) -- 0:00:02
965000 -- [-604.791] (-606.886) (-606.950) (-608.953) * (-609.761) (-606.525) (-610.358) [-605.129] -- 0:00:02
Average standard deviation of split frequencies: 0.007747
965500 -- (-605.118) [-605.728] (-603.803) (-609.107) * (-606.159) (-605.744) [-604.453] (-607.531) -- 0:00:02
966000 -- (-604.906) (-606.889) (-606.730) [-607.050] * (-606.186) [-604.594] (-606.352) (-606.090) -- 0:00:02
966500 -- (-606.944) [-606.449] (-604.653) (-605.857) * (-606.087) [-604.843] (-607.582) (-603.802) -- 0:00:02
967000 -- (-607.021) (-607.766) [-606.653] (-606.934) * (-609.204) (-603.819) [-606.815] (-607.215) -- 0:00:02
967500 -- (-605.747) (-609.934) (-605.468) [-605.667] * (-607.421) (-605.648) (-610.350) [-605.175] -- 0:00:01
968000 -- (-604.921) [-606.490] (-604.725) (-607.958) * (-604.890) (-604.637) [-606.236] (-604.774) -- 0:00:01
968500 -- [-606.253] (-605.965) (-604.972) (-607.900) * (-605.517) (-604.100) (-609.045) [-604.706] -- 0:00:01
969000 -- (-605.705) (-610.162) [-604.010] (-603.722) * [-603.854] (-607.354) (-606.723) (-605.979) -- 0:00:01
969500 -- (-606.630) [-606.996] (-606.682) (-604.263) * [-604.094] (-605.091) (-609.135) (-608.005) -- 0:00:01
970000 -- (-607.683) (-606.708) [-605.121] (-611.667) * (-607.898) (-605.533) [-605.223] (-607.294) -- 0:00:01
Average standard deviation of split frequencies: 0.007558
970500 -- (-605.646) (-604.859) (-604.455) [-604.832] * (-605.231) (-605.420) [-609.146] (-606.252) -- 0:00:01
971000 -- (-604.261) (-605.101) (-606.122) [-605.031] * (-604.737) (-604.194) [-604.822] (-610.186) -- 0:00:01
971500 -- [-605.844] (-605.732) (-607.505) (-604.539) * (-604.590) (-605.748) [-606.529] (-606.877) -- 0:00:01
972000 -- (-607.895) (-608.433) [-608.623] (-613.783) * (-606.142) [-603.866] (-608.265) (-609.598) -- 0:00:01
972500 -- (-607.038) [-608.807] (-606.802) (-606.578) * (-603.566) [-604.584] (-607.752) (-604.794) -- 0:00:01
973000 -- [-607.604] (-607.381) (-606.815) (-606.578) * (-605.748) (-607.563) [-605.459] (-605.469) -- 0:00:01
973500 -- (-604.766) (-608.171) [-606.379] (-605.607) * (-607.627) [-606.440] (-606.608) (-606.667) -- 0:00:01
974000 -- (-604.997) (-606.383) (-609.760) [-605.039] * (-604.787) (-606.982) (-606.787) [-609.043] -- 0:00:01
974500 -- (-606.624) (-603.619) [-606.220] (-604.256) * (-607.152) [-605.033] (-607.664) (-605.082) -- 0:00:01
975000 -- [-605.847] (-605.166) (-605.251) (-606.441) * [-605.205] (-606.288) (-607.606) (-604.395) -- 0:00:01
Average standard deviation of split frequencies: 0.007879
975500 -- (-607.973) [-607.568] (-606.544) (-605.576) * (-608.063) (-604.289) (-604.644) [-604.697] -- 0:00:01
976000 -- (-605.369) [-606.513] (-606.480) (-605.449) * (-608.572) [-604.826] (-605.327) (-609.832) -- 0:00:01
976500 -- (-607.845) (-606.894) (-605.412) [-606.249] * (-607.375) [-606.692] (-605.874) (-604.451) -- 0:00:01
977000 -- [-608.150] (-606.427) (-606.353) (-607.669) * (-607.463) (-606.006) (-605.119) [-608.147] -- 0:00:01
977500 -- (-608.725) (-607.570) (-605.713) [-604.886] * [-604.487] (-604.223) (-605.127) (-606.595) -- 0:00:01
978000 -- (-610.272) [-605.532] (-606.470) (-605.792) * (-604.494) (-606.830) (-605.433) [-606.136] -- 0:00:01
978500 -- [-605.582] (-606.132) (-608.563) (-604.262) * [-607.578] (-607.304) (-606.772) (-606.934) -- 0:00:01
979000 -- (-610.494) (-605.709) [-614.057] (-604.275) * (-606.465) (-606.143) (-605.054) [-604.727] -- 0:00:01
979500 -- (-609.442) (-605.371) [-606.916] (-604.325) * (-608.924) (-606.791) [-605.932] (-604.959) -- 0:00:01
980000 -- (-605.840) (-607.856) [-605.631] (-605.264) * (-604.509) (-606.028) (-608.934) [-604.976] -- 0:00:01
Average standard deviation of split frequencies: 0.007871
980500 -- (-608.359) (-612.086) (-605.966) [-609.830] * (-610.796) (-606.832) [-605.430] (-605.004) -- 0:00:01
981000 -- [-606.013] (-610.174) (-605.982) (-609.761) * [-611.557] (-607.843) (-606.422) (-605.547) -- 0:00:01
981500 -- (-606.592) [-606.872] (-608.883) (-608.092) * (-606.726) (-606.205) [-606.943] (-605.938) -- 0:00:01
982000 -- [-604.180] (-604.198) (-608.709) (-608.660) * (-604.745) (-605.372) (-606.576) [-606.887] -- 0:00:01
982500 -- (-608.307) [-605.940] (-612.942) (-605.572) * (-605.863) (-605.086) (-606.934) [-607.139] -- 0:00:01
983000 -- (-607.576) [-604.572] (-604.792) (-604.949) * (-607.816) (-612.660) [-604.305] (-605.545) -- 0:00:01
983500 -- (-604.133) (-604.744) [-604.200] (-606.216) * (-604.551) (-605.041) (-605.080) [-606.087] -- 0:00:01
984000 -- (-608.984) [-606.917] (-604.410) (-605.491) * (-605.330) [-607.894] (-604.053) (-605.916) -- 0:00:00
984500 -- [-605.251] (-605.598) (-604.490) (-604.832) * (-609.972) [-604.891] (-604.080) (-603.524) -- 0:00:00
985000 -- [-605.916] (-606.077) (-604.617) (-606.917) * (-604.605) [-605.620] (-606.132) (-607.760) -- 0:00:00
Average standard deviation of split frequencies: 0.007799
985500 -- [-606.072] (-606.089) (-604.614) (-605.763) * (-608.260) [-604.815] (-604.138) (-608.062) -- 0:00:00
986000 -- (-605.876) (-606.444) (-606.013) [-606.080] * [-606.368] (-604.764) (-607.034) (-610.836) -- 0:00:00
986500 -- (-603.821) (-605.678) [-604.698] (-606.472) * (-606.261) [-603.635] (-605.332) (-609.703) -- 0:00:00
987000 -- (-604.377) (-605.846) [-605.476] (-604.791) * (-605.090) (-607.593) [-604.955] (-604.863) -- 0:00:00
987500 -- (-606.026) (-607.966) (-605.938) [-605.254] * [-603.754] (-606.430) (-604.674) (-605.218) -- 0:00:00
988000 -- (-605.230) (-606.905) [-606.379] (-605.994) * (-605.678) [-608.068] (-607.314) (-607.286) -- 0:00:00
988500 -- (-604.043) (-607.931) [-605.153] (-605.789) * [-607.441] (-607.133) (-608.682) (-604.640) -- 0:00:00
989000 -- (-606.386) (-605.559) (-606.271) [-607.483] * [-606.793] (-613.306) (-606.557) (-605.652) -- 0:00:00
989500 -- (-604.742) (-604.123) (-607.760) [-607.058] * (-606.639) (-607.698) (-606.204) [-607.392] -- 0:00:00
990000 -- (-605.317) (-604.817) [-605.382] (-607.576) * (-605.301) (-607.240) [-604.933] (-607.303) -- 0:00:00
Average standard deviation of split frequencies: 0.007732
990500 -- (-605.683) (-603.650) (-604.092) [-605.550] * (-603.741) (-604.393) [-604.080] (-606.017) -- 0:00:00
991000 -- (-605.763) (-605.754) [-604.874] (-608.644) * [-604.247] (-608.812) (-604.331) (-604.903) -- 0:00:00
991500 -- [-604.592] (-604.877) (-604.564) (-605.649) * [-605.204] (-606.015) (-604.542) (-609.472) -- 0:00:00
992000 -- (-606.202) (-604.519) [-604.876] (-604.834) * [-607.079] (-608.396) (-611.085) (-607.152) -- 0:00:00
992500 -- (-604.489) [-605.407] (-606.323) (-605.661) * [-606.998] (-605.646) (-606.085) (-606.860) -- 0:00:00
993000 -- [-604.028] (-605.024) (-604.847) (-604.544) * (-609.393) (-606.758) [-606.798] (-605.142) -- 0:00:00
993500 -- (-604.937) (-604.389) [-610.853] (-605.178) * (-607.020) (-605.880) [-604.494] (-607.048) -- 0:00:00
994000 -- (-604.175) (-604.762) (-605.768) [-605.094] * (-607.682) [-604.968] (-606.169) (-606.825) -- 0:00:00
994500 -- (-605.962) (-606.978) [-605.828] (-606.556) * (-605.295) [-605.185] (-606.545) (-605.725) -- 0:00:00
995000 -- [-604.114] (-606.575) (-607.886) (-606.495) * (-609.053) [-607.016] (-607.472) (-605.512) -- 0:00:00
Average standard deviation of split frequencies: 0.007395
995500 -- (-605.922) (-609.285) (-608.258) [-607.632] * (-608.373) (-607.885) [-607.138] (-605.422) -- 0:00:00
996000 -- [-609.579] (-607.216) (-606.847) (-605.727) * (-608.216) (-607.487) (-603.953) [-605.485] -- 0:00:00
996500 -- [-606.813] (-606.644) (-604.634) (-606.511) * [-608.157] (-605.152) (-606.130) (-610.298) -- 0:00:00
997000 -- (-606.656) (-603.641) [-604.795] (-607.030) * (-605.757) (-604.230) [-606.499] (-605.850) -- 0:00:00
997500 -- (-605.315) (-606.266) (-604.107) [-605.981] * (-605.840) (-611.216) [-603.785] (-603.648) -- 0:00:00
998000 -- [-604.330] (-605.781) (-603.780) (-604.684) * (-605.509) (-605.420) [-603.785] (-604.136) -- 0:00:00
998500 -- [-606.549] (-606.796) (-605.558) (-606.115) * [-605.271] (-608.404) (-608.691) (-604.858) -- 0:00:00
999000 -- [-606.567] (-606.498) (-610.018) (-607.069) * (-605.065) (-606.102) (-606.401) [-605.989] -- 0:00:00
999500 -- [-605.841] (-605.722) (-605.112) (-606.827) * (-606.081) (-607.524) [-605.901] (-606.465) -- 0:00:00
1000000 -- (-605.026) (-609.191) (-606.177) [-607.056] * [-604.842] (-605.180) (-605.181) (-606.663) -- 0:00:00
Average standard deviation of split frequencies: 0.007214
Analysis completed in 1 mins 1 seconds
Analysis used 59.69 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -603.35
Likelihood of best state for "cold" chain of run 2 was -603.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.1 % ( 17 %) Dirichlet(Pi{all})
33.9 % ( 28 %) Slider(Pi{all})
78.5 % ( 52 %) Multiplier(Alpha{1,2})
77.7 % ( 47 %) Multiplier(Alpha{3})
24.4 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.1 % ( 31 %) Dirichlet(Pi{all})
33.8 % ( 33 %) Slider(Pi{all})
78.7 % ( 48 %) Multiplier(Alpha{1,2})
77.8 % ( 55 %) Multiplier(Alpha{3})
24.5 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 35 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166759 0.82 0.67
3 | 166927 166394 0.84
4 | 166905 166412 166603
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166591 0.82 0.67
3 | 166607 166967 0.84
4 | 166843 166613 166379
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -604.95
| 2 |
| 1 |
|2 1 1 |
| 1 2 12 1 * 2 |
|1 2 1 22 1 2 2 1 2 |
| * 2 12 1 21 1 2 |
| 12 1 2 12 1**1 21 2 1 1 2 21 1 1 2 2|
| 2221 1 21 2 2 21 2 1 1 |
| 12 1 2 22 2 212 2 2 212 2 2 21|
| 2 1 21 1 1 1 1 1 1 21 1 |
| 1 21 1 2 111 |
| 2 2 1 |
| 2 * 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -606.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -605.14 -610.19
2 -605.11 -607.99
--------------------------------------
TOTAL -605.12 -609.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898308 0.090977 0.365075 1.510573 0.865391 1501.00 1501.00 1.000
r(A<->C){all} 0.175530 0.022589 0.000007 0.478553 0.134240 169.20 220.16 1.000
r(A<->G){all} 0.153115 0.018024 0.000035 0.411630 0.117519 258.27 294.88 1.000
r(A<->T){all} 0.163054 0.018777 0.000176 0.436573 0.125057 182.43 186.53 1.000
r(C<->G){all} 0.159555 0.018120 0.000104 0.418225 0.127729 169.88 263.96 1.020
r(C<->T){all} 0.172276 0.019422 0.000148 0.449490 0.140200 207.82 295.01 1.002
r(G<->T){all} 0.176469 0.021434 0.000089 0.466227 0.140129 156.48 183.23 1.003
pi(A){all} 0.224695 0.000381 0.187534 0.264837 0.224461 1210.12 1231.41 1.000
pi(C){all} 0.312469 0.000502 0.267378 0.355640 0.311544 1068.93 1134.43 1.000
pi(G){all} 0.274353 0.000457 0.232881 0.316174 0.274477 1371.31 1395.57 1.000
pi(T){all} 0.188483 0.000358 0.150893 0.224365 0.188059 1357.27 1410.00 1.000
alpha{1,2} 0.407076 0.217556 0.000182 1.346624 0.241369 1259.58 1279.58 1.000
alpha{3} 0.446580 0.234095 0.000145 1.375782 0.285265 1006.90 1161.05 1.001
pinvar{all} 0.996395 0.000020 0.988595 0.999993 0.997842 1175.27 1254.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..**..
9 -- ..*..*
10 -- ..****
11 -- .**.**
12 -- ....**
13 -- .***.*
14 -- ...*.*
15 -- .****.
16 -- .*.***
17 -- .**...
18 -- ..*.*.
19 -- ...**.
20 -- .*.*..
21 -- .*..*.
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 474 0.157895 0.008480 0.151899 0.163891 2
8 457 0.152232 0.004240 0.149234 0.155230 2
9 455 0.151566 0.005182 0.147901 0.155230 2
10 452 0.150566 0.000942 0.149900 0.151233 2
11 439 0.146236 0.007066 0.141239 0.151233 2
12 426 0.141905 0.004711 0.138574 0.145237 2
13 425 0.141572 0.019315 0.127915 0.155230 2
14 424 0.141239 0.005653 0.137242 0.145237 2
15 416 0.138574 0.009422 0.131912 0.145237 2
16 416 0.138574 0.000942 0.137908 0.139241 2
17 413 0.137575 0.003298 0.135243 0.139907 2
18 412 0.137242 0.006595 0.132578 0.141905 2
19 412 0.137242 0.008480 0.131246 0.143238 2
20 399 0.132911 0.018373 0.119920 0.145903 2
21 396 0.131912 0.005653 0.127915 0.135909 2
22 291 0.096935 0.007066 0.091939 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100306 0.010053 0.000005 0.298202 0.070660 1.000 2
length{all}[2] 0.096920 0.008776 0.000022 0.281249 0.070133 1.000 2
length{all}[3] 0.099136 0.009509 0.000033 0.290130 0.070615 1.001 2
length{all}[4] 0.100168 0.009817 0.000059 0.300138 0.069552 1.000 2
length{all}[5] 0.102190 0.010234 0.000141 0.300236 0.072390 1.000 2
length{all}[6] 0.099165 0.009615 0.000009 0.287857 0.071033 1.000 2
length{all}[7] 0.099081 0.009738 0.000335 0.298447 0.068361 1.007 2
length{all}[8] 0.103250 0.010046 0.000217 0.282301 0.073193 0.998 2
length{all}[9] 0.101157 0.010659 0.000378 0.295162 0.065907 1.000 2
length{all}[10] 0.092629 0.008235 0.000214 0.274910 0.065059 1.000 2
length{all}[11] 0.101870 0.010876 0.000637 0.340102 0.067350 0.998 2
length{all}[12] 0.100683 0.011155 0.000374 0.299370 0.071631 0.999 2
length{all}[13] 0.099166 0.009704 0.000255 0.300012 0.071223 0.998 2
length{all}[14] 0.098607 0.008328 0.000486 0.288181 0.071440 1.000 2
length{all}[15] 0.104659 0.012194 0.000283 0.308184 0.074399 0.998 2
length{all}[16] 0.102002 0.013040 0.000249 0.305521 0.066126 0.998 2
length{all}[17] 0.093008 0.008786 0.000034 0.252903 0.067943 0.999 2
length{all}[18] 0.098606 0.010557 0.000651 0.320030 0.064646 0.998 2
length{all}[19] 0.097761 0.009740 0.000029 0.309613 0.067697 0.998 2
length{all}[20] 0.101726 0.009359 0.000329 0.315417 0.070067 0.998 2
length{all}[21] 0.107381 0.010174 0.000073 0.315721 0.078042 0.997 2
length{all}[22] 0.107068 0.012127 0.000099 0.290208 0.076495 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007214
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 441
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 147 / 147 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 147 / 147 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099727 0.086735 0.042931 0.103710 0.059146 0.049766 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -640.700123
Iterating by ming2
Initial: fx= 640.700123
x= 0.09973 0.08674 0.04293 0.10371 0.05915 0.04977 0.30000 1.30000
1 h-m-p 0.0000 0.0003 350.2992 +++ 603.928093 m 0.0003 14 | 1/8
2 h-m-p 0.0010 0.0051 58.3900 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 321.8602 ++ 598.994470 m 0.0000 45 | 2/8
4 h-m-p 0.0003 0.0072 41.8903 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 287.8434 ++ 593.569859 m 0.0001 75 | 3/8
6 h-m-p 0.0005 0.0091 33.5123 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 249.2762 +++ 581.524115 m 0.0002 107 | 4/8
8 h-m-p 0.0017 0.0132 23.3871 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 204.3507 ++ 577.708054 m 0.0001 139 | 5/8
10 h-m-p 0.0010 0.0235 13.5550 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 144.7804 ++ 577.120914 m 0.0000 170 | 6/8
12 h-m-p 0.1906 8.0000 0.0000 +Y 577.120914 0 0.7623 182 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 --------------Y 577.120914 0 0.0000 209
Out..
lnL = -577.120914
210 lfun, 210 eigenQcodon, 1260 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026013 0.026459 0.083167 0.057601 0.077351 0.085901 0.299738 0.855086 0.435647
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.145044
np = 9
lnL0 = -627.719669
Iterating by ming2
Initial: fx= 627.719669
x= 0.02601 0.02646 0.08317 0.05760 0.07735 0.08590 0.29974 0.85509 0.43565
1 h-m-p 0.0000 0.0002 341.9697 +++ 605.908749 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 281.9197 ++ 605.588656 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0003 328.0008 +++ 588.548336 m 0.0003 40 | 3/9
4 h-m-p 0.0001 0.0005 225.8014 ++ 579.122607 m 0.0005 52 | 4/9
5 h-m-p 0.0000 0.0001 427.4890 ++ 577.483970 m 0.0001 64 | 5/9
6 h-m-p 0.0000 0.0001 845.1690 ++ 577.120909 m 0.0001 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0003 ++ 577.120909 m 8.0000 88 | 6/9
8 h-m-p 0.0412 8.0000 0.0598 ----------C 577.120909 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 577.120909 m 8.0000 131 | 6/9
10 h-m-p 0.0000 0.0213 17.0509 +++++ 577.120900 m 0.0213 149 | 7/9
11 h-m-p 0.1521 0.7607 0.5582 ++ 577.120896 m 0.7607 161 | 8/9
12 h-m-p 0.1891 0.9457 0.2722 ++ 577.120878 m 0.9457 175 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 C 577.120878 0 0.0160 188
Out..
lnL = -577.120878
189 lfun, 567 eigenQcodon, 2268 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064808 0.074944 0.034096 0.029826 0.085037 0.070828 0.000100 1.068584 0.513133 0.248363 1.368989
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.580804
np = 11
lnL0 = -625.784190
Iterating by ming2
Initial: fx= 625.784190
x= 0.06481 0.07494 0.03410 0.02983 0.08504 0.07083 0.00011 1.06858 0.51313 0.24836 1.36899
1 h-m-p 0.0000 0.0000 311.4747 ++ 625.484199 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 182.8357 ++++ 601.415006 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0000 324.2710 ++ 598.873011 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0008 123.5199 ++ 591.312589 m 0.0008 60 | 4/11
5 h-m-p 0.0011 0.0055 26.9978 ++ 590.263951 m 0.0055 74 | 5/11
6 h-m-p 0.0001 0.0003 160.8126 ++ 586.988477 m 0.0003 88 | 6/11
7 h-m-p 0.0003 0.0038 142.9433 ++ 582.578548 m 0.0038 102 | 7/11
8 h-m-p 0.0008 0.0039 103.2347 ++ 577.120900 m 0.0039 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 577.120900 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.0064 +++++ 577.120900 m 8.0000 150 | 8/11
11 h-m-p 0.0298 8.0000 1.7050 ----------C 577.120900 0 0.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 0.0181 +++++ 577.120899 m 8.0000 194 | 8/11
13 h-m-p 0.0757 8.0000 1.9188 -----------Y 577.120899 0 0.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 Y 577.120899 0 0.0160 236 | 8/11
15 h-m-p 0.1100 8.0000 0.0000 -----------Y 577.120899 0 0.0000 264
Out..
lnL = -577.120899
265 lfun, 1060 eigenQcodon, 4770 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -577.133329 S = -577.118915 -0.005521
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:02
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055575 0.046356 0.080546 0.022096 0.075766 0.070158 0.000100 0.578258 1.917571
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.529327
np = 9
lnL0 = -624.638232
Iterating by ming2
Initial: fx= 624.638232
x= 0.05558 0.04636 0.08055 0.02210 0.07577 0.07016 0.00011 0.57826 1.91757
1 h-m-p 0.0000 0.0000 313.7246 ++ 624.441580 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0187 31.3024 +++++ 615.253936 m 0.0187 29 | 2/9
3 h-m-p 0.0003 0.0014 128.3165 ++ 604.663623 m 0.0014 41 | 3/9
4 h-m-p 0.0001 0.0005 69.0373 ++ 599.548034 m 0.0005 53 | 4/9
5 h-m-p 0.0005 0.0024 11.6271 -----------.. | 4/9
6 h-m-p 0.0000 0.0001 273.7765 ++ 595.264724 m 0.0001 86 | 5/9
7 h-m-p 0.0053 0.0837 2.5316 ------------.. | 5/9
8 h-m-p 0.0000 0.0002 236.1800 ++ 586.493115 m 0.0002 120 | 6/9
9 h-m-p 0.0159 0.2613 1.8582 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 195.1109 ++ 582.601065 m 0.0001 155 | 7/9
11 h-m-p 0.0161 8.0000 0.8476 -------------.. | 7/9
12 h-m-p 0.0000 0.0003 137.0162 +++ 577.120878 m 0.0003 193 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 -Y 577.120878 0 0.0312 206 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 ---Y 577.120878 0 0.0063 222
Out..
lnL = -577.120878
223 lfun, 2453 eigenQcodon, 13380 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078316 0.055355 0.015413 0.057893 0.062207 0.087181 0.000100 0.900000 0.236281 1.876622 1.300002
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 23.650557
np = 11
lnL0 = -621.221582
Iterating by ming2
Initial: fx= 621.221582
x= 0.07832 0.05535 0.01541 0.05789 0.06221 0.08718 0.00011 0.90000 0.23628 1.87662 1.30000
1 h-m-p 0.0000 0.0000 267.4611 ++ 621.134011 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 252.9608 +++ 610.489044 m 0.0003 31 | 2/11
3 h-m-p 0.0002 0.0008 141.1058 ++ 585.718660 m 0.0008 45 | 3/11
4 h-m-p 0.0001 0.0007 58.0776 ++ 584.204531 m 0.0007 59 | 4/11
5 h-m-p 0.0000 0.0001 1361.7352 ++ 582.029216 m 0.0001 73 | 5/11
6 h-m-p 0.0008 0.0039 11.7367 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 234.3737 ++ 581.797801 m 0.0000 110 | 6/11
8 h-m-p 0.0001 0.0189 9.8522 ++++ 581.041217 m 0.0189 126 | 6/11
9 h-m-p 0.0330 0.1651 1.2947 --------------.. | 6/11
10 h-m-p 0.0000 0.0001 199.6122 ++ 577.598153 m 0.0001 166 | 7/11
11 h-m-p 0.0000 0.0000 319.0098 ++ 577.120879 m 0.0000 180 | 8/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 577.120879 m 8.0000 194 | 8/11
13 h-m-p 0.0160 8.0000 0.0589 ---------N 577.120879 0 0.0000 220 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 ------C 577.120879 0 0.0000 243 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 577.120879 m 8.0000 263 | 8/11
16 h-m-p 0.0160 8.0000 0.0832 ----------N 577.120879 0 0.0000 290 | 8/11
17 h-m-p 0.0000 0.0007 3.5520 ++++ 577.120878 m 0.0007 309 | 9/11
18 h-m-p 1.6000 8.0000 0.0007 ----N 577.120878 0 0.0016 327 | 9/11
19 h-m-p 1.6000 8.0000 0.0000 N 577.120878 0 1.6000 343 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 N 577.120878 0 1.6000 359
Out..
lnL = -577.120878
360 lfun, 4320 eigenQcodon, 23760 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -577.175923 S = -577.121737 -0.024045
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:12
did 20 / 48 patterns 0:12
did 30 / 48 patterns 0:12
did 40 / 48 patterns 0:12
did 48 / 48 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
NC_011896_1_WP_010907684_1_374_MLBR_RS01795 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
NC_002677_1_NP_301360_1_232_rplM VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG
**************************************************
NC_011896_1_WP_010907684_1_374_MLBR_RS01795 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
NC_002677_1_NP_301360_1_232_rplM GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010 GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV
**************************************************
NC_011896_1_WP_010907684_1_374_MLBR_RS01795 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
NC_002677_1_NP_301360_1_232_rplM VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010 VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
***********************************************
>NC_011896_1_WP_010907684_1_374_MLBR_RS01795 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG >NC_002677_1_NP_301360_1_232_rplM GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG >NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG >NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG >NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG >NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010 GTGCCTACATACGCGCCCAAGGCGGGTGACACCACGTGTTCGTGGTACGT CATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGCTGTAGCGGCCA CTCTGTTGCGCGGCAAGCACAAGCCCACGTTCGCTCCTAATGTTGATGGC GGTGACTTTGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGA TAAAGTACAGCATAAGATGGTTTACCGCCACTCGGGGTATCCCGGCGGCT TGCGCAAACGCACCATTGGCGAGCTGATGCAAAAGCACCCCGACCGCGTC GTAGAGAAAGCCATCGTTGGCATGCTGCCCAAAAACAAGCTTAGCCGCCA GATCCAGCGCAAGCTTCGTGTCTACGCCGGACCAGATCATCCACATTCCG CTCAGCAACCGGTTCCATTCGAAATCAAGCAGGTAGCGCAG
>NC_011896_1_WP_010907684_1_374_MLBR_RS01795 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ >NC_002677_1_NP_301360_1_232_rplM VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ >NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ >NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ >NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ >NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010 VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDG GDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRV VEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
#NEXUS
[ID: 0486216105]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907684_1_374_MLBR_RS01795
NC_002677_1_NP_301360_1_232_rplM
NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835
NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045
NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930
NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907684_1_374_MLBR_RS01795,
2 NC_002677_1_NP_301360_1_232_rplM,
3 NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835,
4 NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045,
5 NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930,
6 NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07066022,2:0.07013289,3:0.07061501,4:0.06955173,5:0.07238977,6:0.07103339);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07066022,2:0.07013289,3:0.07061501,4:0.06955173,5:0.07238977,6:0.07103339);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -605.14 -610.19
2 -605.11 -607.99
--------------------------------------
TOTAL -605.12 -609.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898308 0.090977 0.365075 1.510573 0.865391 1501.00 1501.00 1.000
r(A<->C){all} 0.175530 0.022589 0.000007 0.478553 0.134240 169.20 220.16 1.000
r(A<->G){all} 0.153115 0.018024 0.000035 0.411630 0.117519 258.27 294.88 1.000
r(A<->T){all} 0.163054 0.018777 0.000176 0.436573 0.125057 182.43 186.53 1.000
r(C<->G){all} 0.159555 0.018120 0.000104 0.418225 0.127729 169.88 263.96 1.020
r(C<->T){all} 0.172276 0.019422 0.000148 0.449490 0.140200 207.82 295.01 1.002
r(G<->T){all} 0.176469 0.021434 0.000089 0.466227 0.140129 156.48 183.23 1.003
pi(A){all} 0.224695 0.000381 0.187534 0.264837 0.224461 1210.12 1231.41 1.000
pi(C){all} 0.312469 0.000502 0.267378 0.355640 0.311544 1068.93 1134.43 1.000
pi(G){all} 0.274353 0.000457 0.232881 0.316174 0.274477 1371.31 1395.57 1.000
pi(T){all} 0.188483 0.000358 0.150893 0.224365 0.188059 1357.27 1410.00 1.000
alpha{1,2} 0.407076 0.217556 0.000182 1.346624 0.241369 1259.58 1279.58 1.000
alpha{3} 0.446580 0.234095 0.000145 1.375782 0.285265 1006.90 1161.05 1.001
pinvar{all} 0.996395 0.000020 0.988595 0.999993 0.997842 1175.27 1254.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplM/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 147
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 5 5 5 5 5 5 | CAC 3 3 3 3 3 3 | CGC 8 8 8 8 8 8
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 6 6 6 6 6 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 9 9 9 9 9 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 7 7 7 7 7 7 | GAC 6 6 6 6 6 6 | GGC 8 8 8 8 8 8
GTA 4 4 4 4 4 4 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 4 4 4 4 4 4 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907684_1_374_MLBR_RS01795
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
#2: NC_002677_1_NP_301360_1_232_rplM
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
#3: NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
#4: NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
#5: NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
#6: NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 12 | TCC 6 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 6
CTC 0 | CCC 30 | CAC 18 | CGC 48
CTA 0 | CCA 18 | Gln Q CAA 12 | CGA 0
CTG 18 | CCG 6 | CAG 36 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 42 | ACC 12 | AAC 12 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 54 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 18 | Asp D GAT 18 | Gly G GGT 12
GTC 30 | GCC 42 | GAC 36 | GGC 48
GTA 24 | GCA 0 | Glu E GAA 6 | GGA 6
GTG 24 | GCG 24 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10204 C:0.27891 A:0.24490 G:0.37415
position 2: T:0.27211 C:0.23810 A:0.31973 G:0.17007
position 3: T:0.19048 C:0.42177 A:0.10884 G:0.27891
Average T:0.18821 C:0.31293 A:0.22449 G:0.27438
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -577.120914 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299738 1.300002
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907684_1_374_MLBR_RS01795: 0.000004, NC_002677_1_NP_301360_1_232_rplM: 0.000004, NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835: 0.000004, NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045: 0.000004, NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930: 0.000004, NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29974
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 359.5 81.5 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -577.120878 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907684_1_374_MLBR_RS01795: 0.000004, NC_002677_1_NP_301360_1_232_rplM: 0.000004, NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835: 0.000004, NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045: 0.000004, NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930: 0.000004, NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -577.120899 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.755786 0.121728 0.000001 2.157935
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907684_1_374_MLBR_RS01795: 0.000004, NC_002677_1_NP_301360_1_232_rplM: 0.000004, NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835: 0.000004, NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045: 0.000004, NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930: 0.000004, NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.75579 0.12173 0.12249
w: 0.00000 1.00000 2.15793
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
7..2 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
7..3 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
7..4 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
7..5 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
7..6 0.000 366.8 74.2 0.3860 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907684_1_374_MLBR_RS01795)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907684_1_374_MLBR_RS01795)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -577.120878 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.699588
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907684_1_374_MLBR_RS01795: 0.000004, NC_002677_1_NP_301360_1_232_rplM: 0.000004, NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835: 0.000004, NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045: 0.000004, NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930: 0.000004, NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.69959
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -577.120878 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.893316 1.462504
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907684_1_374_MLBR_RS01795: 0.000004, NC_002677_1_NP_301360_1_232_rplM: 0.000004, NZ_LVXE01000013_1_WP_010907684_1_462_A3216_RS05835: 0.000004, NZ_LYPH01000014_1_WP_010907684_1_427_A8144_RS02045: 0.000004, NZ_CP029543_1_WP_010907684_1_376_DIJ64_RS01930: 0.000004, NZ_AP014567_1_WP_010907684_1_392_JK2ML_RS02010: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.89332
(p1 = 0.00001) w = 1.46250
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.46250
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 366.8 74.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907684_1_374_MLBR_RS01795)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.099 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:13
Model 1: NearlyNeutral -577.120878 Model 2: PositiveSelection -577.120899 Model 0: one-ratio -577.120914 Model 7: beta -577.120878 Model 8: beta&w>1 -577.120878 Model 0 vs 1 7.200000004559115E-5 Model 2 vs 1 4.200000012133387E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
