--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:39:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplO/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -603.41          -606.69
2       -603.43          -606.48
--------------------------------------
TOTAL     -603.42          -606.59
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.884346    0.087811    0.349787    1.447047    0.851087   1243.05   1372.03    1.000
r(A<->C){all}   0.161795    0.019550    0.000101    0.445047    0.124325    171.04    200.58    1.005
r(A<->G){all}   0.169363    0.020978    0.000061    0.468438    0.130141    159.96    165.42    1.000
r(A<->T){all}   0.173305    0.021172    0.000287    0.466521    0.135033    131.47    192.24    1.000
r(C<->G){all}   0.167415    0.019454    0.000005    0.461365    0.131933    302.20    386.76    1.016
r(C<->T){all}   0.168054    0.019995    0.000007    0.459478    0.129286    157.81    266.83    1.001
r(G<->T){all}   0.160068    0.018868    0.000002    0.443485    0.124643    223.99    257.23    1.000
pi(A){all}      0.253257    0.000444    0.211013    0.292368    0.253071   1179.97   1192.86    1.000
pi(C){all}      0.267374    0.000428    0.226649    0.307353    0.267136   1093.70   1145.50    1.000
pi(G){all}      0.291612    0.000456    0.249537    0.331716    0.291285   1202.18   1278.85    1.000
pi(T){all}      0.187756    0.000351    0.152591    0.225858    0.187032   1501.00   1501.00    1.000
alpha{1,2}      0.413763    0.240434    0.000227    1.390792    0.244296   1232.55   1240.69    1.000
alpha{3}        0.467090    0.235466    0.000312    1.463892    0.301254   1307.83   1333.39    1.000
pinvar{all}     0.996365    0.000018    0.988505    0.999999    0.997777   1163.02   1185.99    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-585.739168
Model 2: PositiveSelection	-585.739109
Model 0: one-ratio	-585.739109
Model 7: beta	-585.739259
Model 8: beta&w>1	-585.739108


Model 0 vs 1	1.1799999992945231E-4

Model 2 vs 1	1.1799999992945231E-4

Model 8 vs 7	3.019999999196443E-4
>C1
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C2
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C3
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C4
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C5
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C6
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146 

C1              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C2              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C3              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C4              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C5              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C6              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
                **************************************************

C1              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C2              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C3              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C4              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C5              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C6              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
                **************************************************

C1              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C2              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C3              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C4              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C5              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C6              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  146 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  146 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4380]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4380]--->[4380]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.679 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C2              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C3              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C4              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C5              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C6              VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
                **************************************************

C1              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C2              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C3              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C4              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C5              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C6              GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
                **************************************************

C1              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C2              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C3              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C4              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C5              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C6              KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C2              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C3              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C4              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C5              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C6              GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
                **************************************************

C1              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C2              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C3              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C4              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C5              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C6              ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
                **************************************************

C1              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C2              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C3              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C4              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C5              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C6              GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
                **************************************************

C1              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C2              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C3              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C4              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C5              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C6              GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
                **************************************************

C1              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C2              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C3              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C4              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C5              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C6              GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
                **************************************************

C1              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C2              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C3              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C4              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C5              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C6              GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
                **************************************************

C1              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C2              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C3              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C4              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C5              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C6              AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
                **************************************************

C1              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C2              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C3              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C4              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C5              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C6              GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
                **************************************************

C1              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C2              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C3              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C4              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C5              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C6              ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
                **************************************



>C1
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C2
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C3
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C4
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C5
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C6
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C1
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C2
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C3
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C4
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C5
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C6
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 438 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790315
      Setting output file names to "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 200923194
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0793890995
      Seed = 709819965
      Swapseed = 1579790315
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -980.265000 -- -24.965149
         Chain 2 -- -980.265000 -- -24.965149
         Chain 3 -- -980.265000 -- -24.965149
         Chain 4 -- -980.265000 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -980.264944 -- -24.965149
         Chain 2 -- -980.265000 -- -24.965149
         Chain 3 -- -980.264944 -- -24.965149
         Chain 4 -- -980.264944 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-980.265] (-980.265) (-980.265) (-980.265) * [-980.265] (-980.265) (-980.265) (-980.265) 
        500 -- (-612.362) [-614.911] (-617.202) (-613.274) * [-618.244] (-608.696) (-614.677) (-609.146) -- 0:00:00
       1000 -- (-615.175) [-612.662] (-617.601) (-609.740) * [-614.019] (-611.515) (-610.437) (-617.035) -- 0:00:00
       1500 -- (-618.024) [-613.586] (-610.180) (-609.521) * (-611.985) (-613.614) [-612.658] (-613.951) -- 0:00:00
       2000 -- (-608.654) (-612.808) [-613.871] (-616.933) * [-610.438] (-613.521) (-608.374) (-617.456) -- 0:00:00
       2500 -- (-611.159) [-606.492] (-611.225) (-610.984) * (-613.611) [-610.368] (-616.933) (-609.300) -- 0:00:00
       3000 -- (-618.409) (-612.713) (-608.338) [-612.180] * (-606.834) (-612.645) (-611.718) [-612.029] -- 0:00:00
       3500 -- (-611.483) (-614.860) [-608.026] (-609.626) * (-614.840) (-613.085) [-616.002] (-611.289) -- 0:00:00
       4000 -- (-616.525) (-611.046) [-612.390] (-608.572) * (-617.820) (-609.848) (-615.756) [-612.107] -- 0:00:00
       4500 -- [-611.175] (-608.567) (-610.452) (-613.950) * [-612.083] (-619.719) (-616.158) (-617.800) -- 0:00:00
       5000 -- (-616.694) (-614.390) [-613.533] (-620.411) * (-614.305) (-612.474) [-622.604] (-613.915) -- 0:00:00

      Average standard deviation of split frequencies: 0.104757

       5500 -- [-610.007] (-609.406) (-613.723) (-612.336) * (-611.206) (-616.072) [-610.831] (-612.091) -- 0:00:00
       6000 -- (-614.591) (-623.165) [-610.473] (-618.735) * (-611.326) (-610.238) [-610.053] (-620.504) -- 0:00:00
       6500 -- (-613.701) (-611.282) [-613.789] (-617.777) * (-615.207) (-610.540) [-613.032] (-618.081) -- 0:00:00
       7000 -- (-612.051) [-613.765] (-614.651) (-616.041) * (-619.024) (-612.407) (-615.309) [-614.432] -- 0:00:00
       7500 -- (-616.263) (-610.165) [-621.958] (-621.194) * (-614.019) (-620.814) [-611.241] (-619.099) -- 0:00:00
       8000 -- [-615.948] (-614.129) (-620.903) (-612.261) * (-615.881) (-614.131) (-610.813) [-621.921] -- 0:02:04
       8500 -- (-605.092) [-612.224] (-608.582) (-614.846) * (-615.575) (-617.407) (-609.677) [-613.650] -- 0:01:56
       9000 -- (-605.321) (-615.105) [-614.035] (-609.900) * (-611.492) [-614.244] (-614.654) (-607.670) -- 0:01:50
       9500 -- [-603.815] (-618.723) (-609.692) (-612.163) * (-604.694) [-615.063] (-611.727) (-613.008) -- 0:01:44
      10000 -- [-606.402] (-615.131) (-617.249) (-617.339) * (-604.043) (-613.660) [-620.651] (-604.481) -- 0:01:39

      Average standard deviation of split frequencies: 0.058926

      10500 -- [-605.612] (-624.535) (-620.643) (-608.841) * [-602.831] (-610.154) (-623.241) (-605.169) -- 0:01:34
      11000 -- (-604.114) [-609.113] (-608.413) (-612.479) * (-602.983) (-608.229) [-607.291] (-602.532) -- 0:01:29
      11500 -- (-607.012) (-611.958) (-611.592) [-610.609] * (-604.008) (-612.913) [-612.673] (-603.275) -- 0:01:25
      12000 -- [-605.748] (-623.049) (-614.827) (-614.707) * (-605.283) (-609.404) (-621.055) [-603.708] -- 0:01:22
      12500 -- (-602.246) (-608.222) (-615.292) [-613.868] * (-604.236) (-611.090) (-622.876) [-604.363] -- 0:01:19
      13000 -- (-604.671) (-606.632) (-616.578) [-613.392] * (-602.313) [-609.368] (-615.772) (-604.698) -- 0:01:15
      13500 -- [-603.071] (-612.503) (-612.377) (-609.783) * (-607.179) [-604.710] (-604.222) (-604.086) -- 0:01:13
      14000 -- (-603.253) [-615.612] (-616.349) (-614.411) * (-607.940) (-606.958) (-603.886) [-604.163] -- 0:01:10
      14500 -- (-606.925) (-617.946) [-614.672] (-616.613) * [-607.310] (-607.255) (-604.898) (-602.976) -- 0:01:07
      15000 -- [-603.774] (-613.140) (-614.021) (-612.679) * (-605.668) [-603.727] (-605.208) (-604.521) -- 0:01:05

      Average standard deviation of split frequencies: 0.053033

      15500 -- (-602.567) (-613.364) (-613.242) [-616.177] * [-603.072] (-608.861) (-606.540) (-602.168) -- 0:01:03
      16000 -- [-603.439] (-608.035) (-609.302) (-616.337) * [-602.212] (-603.598) (-603.957) (-603.919) -- 0:01:01
      16500 -- (-603.031) (-622.076) (-614.215) [-609.457] * [-602.938] (-606.352) (-607.142) (-602.769) -- 0:00:59
      17000 -- (-603.042) (-610.973) [-611.032] (-611.038) * (-603.041) (-603.196) [-602.047] (-602.926) -- 0:00:57
      17500 -- (-607.104) [-611.742] (-613.451) (-612.742) * (-603.274) (-603.388) (-605.894) [-606.098] -- 0:00:56
      18000 -- (-602.619) [-612.624] (-618.305) (-615.436) * (-611.058) [-606.054] (-604.567) (-604.762) -- 0:00:54
      18500 -- (-603.277) (-608.943) [-615.822] (-616.849) * [-606.221] (-604.932) (-611.192) (-609.312) -- 0:00:53
      19000 -- [-604.075] (-613.081) (-614.928) (-609.131) * (-608.553) (-603.338) [-605.892] (-611.415) -- 0:00:51
      19500 -- [-605.603] (-617.995) (-612.600) (-618.389) * [-604.863] (-605.594) (-606.361) (-604.827) -- 0:00:50
      20000 -- (-603.218) (-611.373) [-613.982] (-615.824) * (-604.311) (-603.346) [-606.695] (-603.012) -- 0:00:49

      Average standard deviation of split frequencies: 0.062094

      20500 -- [-602.818] (-616.811) (-614.691) (-622.107) * [-606.043] (-602.947) (-609.102) (-603.529) -- 0:00:47
      21000 -- (-607.001) (-617.132) [-619.788] (-612.521) * (-606.171) [-602.051] (-604.764) (-604.387) -- 0:00:46
      21500 -- (-606.756) (-622.070) [-607.551] (-609.748) * (-603.788) [-602.620] (-610.390) (-604.407) -- 0:00:45
      22000 -- (-610.003) (-603.411) (-608.643) [-611.017] * [-602.827] (-604.181) (-605.483) (-605.714) -- 0:00:44
      22500 -- (-604.012) (-607.880) [-605.002] (-618.203) * (-607.575) (-606.829) (-606.173) [-602.480] -- 0:00:43
      23000 -- (-606.101) (-603.195) (-603.447) [-618.485] * (-604.736) (-604.195) (-607.692) [-604.843] -- 0:00:42
      23500 -- (-603.768) (-603.962) (-603.485) [-614.593] * [-608.528] (-604.517) (-607.793) (-603.717) -- 0:00:41
      24000 -- [-604.497] (-604.930) (-602.772) (-622.281) * (-607.344) (-606.388) [-604.726] (-604.629) -- 0:00:40
      24500 -- [-602.591] (-605.251) (-602.540) (-610.285) * (-606.477) (-605.762) [-605.818] (-605.267) -- 0:00:39
      25000 -- (-603.544) [-604.279] (-602.633) (-614.852) * (-606.094) (-602.724) [-603.755] (-606.750) -- 0:01:18

      Average standard deviation of split frequencies: 0.046759

      25500 -- (-606.831) (-607.279) (-606.832) [-612.328] * (-604.276) (-608.561) [-606.325] (-602.163) -- 0:01:16
      26000 -- [-605.585] (-602.397) (-602.915) (-619.739) * (-603.564) (-603.818) (-603.522) [-602.377] -- 0:01:14
      26500 -- [-606.266] (-604.931) (-604.398) (-609.747) * (-603.957) (-604.735) [-603.504] (-604.352) -- 0:01:13
      27000 -- [-603.593] (-603.329) (-607.374) (-623.470) * (-602.721) (-606.186) [-602.129] (-608.101) -- 0:01:12
      27500 -- [-604.015] (-604.171) (-606.311) (-635.569) * (-602.383) (-608.280) (-602.883) [-603.455] -- 0:01:10
      28000 -- (-604.867) (-604.064) (-605.251) [-621.353] * (-603.375) [-603.889] (-607.267) (-605.717) -- 0:01:09
      28500 -- (-606.219) (-603.396) (-603.194) [-608.466] * (-603.396) (-602.767) [-606.261] (-605.594) -- 0:01:08
      29000 -- [-605.284] (-603.273) (-603.628) (-609.691) * (-604.518) (-605.731) [-604.469] (-604.021) -- 0:01:06
      29500 -- (-603.884) [-603.949] (-603.284) (-617.705) * (-605.093) (-606.185) (-604.489) [-606.356] -- 0:01:05
      30000 -- (-606.759) (-602.736) (-609.946) [-609.839] * (-602.373) (-605.651) [-605.088] (-603.781) -- 0:01:04

      Average standard deviation of split frequencies: 0.044498

      30500 -- [-606.685] (-603.937) (-606.947) (-610.980) * [-604.192] (-606.226) (-605.956) (-604.384) -- 0:01:03
      31000 -- (-603.876) [-603.655] (-606.042) (-616.612) * (-601.961) (-609.766) (-604.561) [-603.595] -- 0:01:02
      31500 -- (-608.751) (-605.324) (-604.413) [-616.788] * [-602.893] (-604.654) (-604.991) (-605.230) -- 0:01:01
      32000 -- (-606.407) (-605.968) [-604.438] (-609.565) * (-603.076) [-608.098] (-606.384) (-617.619) -- 0:01:00
      32500 -- [-605.865] (-604.463) (-602.881) (-614.393) * (-602.397) [-603.776] (-603.230) (-608.268) -- 0:00:59
      33000 -- (-604.306) [-602.507] (-603.253) (-615.426) * (-603.538) (-602.572) (-605.067) [-604.081] -- 0:00:58
      33500 -- (-602.245) (-601.955) (-604.224) [-610.578] * (-603.550) (-604.715) (-603.481) [-602.434] -- 0:00:57
      34000 -- (-604.219) (-602.799) (-608.834) [-610.682] * (-604.222) (-606.512) (-607.397) [-604.342] -- 0:00:56
      34500 -- (-603.886) [-603.326] (-604.478) (-619.104) * (-607.058) (-604.968) (-602.900) [-606.597] -- 0:00:55
      35000 -- (-603.496) (-604.043) (-603.627) [-614.284] * (-605.640) [-603.563] (-604.936) (-606.780) -- 0:00:55

      Average standard deviation of split frequencies: 0.034459

      35500 -- (-602.497) (-602.376) [-603.436] (-617.210) * (-608.324) (-606.679) (-604.758) [-603.624] -- 0:00:54
      36000 -- (-603.562) (-610.596) (-603.632) [-609.156] * (-606.279) (-603.801) (-602.288) [-602.491] -- 0:00:53
      36500 -- (-606.027) [-602.797] (-603.875) (-617.495) * (-605.786) (-605.289) (-604.060) [-602.480] -- 0:00:52
      37000 -- (-604.061) (-607.461) (-602.930) [-620.879] * (-603.714) [-606.666] (-604.649) (-606.181) -- 0:00:52
      37500 -- (-608.208) (-606.337) (-602.678) [-614.476] * (-602.496) [-606.465] (-605.674) (-602.487) -- 0:00:51
      38000 -- (-606.171) (-607.865) [-603.398] (-612.508) * (-603.661) (-609.812) (-605.414) [-603.194] -- 0:00:50
      38500 -- (-605.403) [-603.835] (-601.841) (-611.888) * (-604.812) [-606.853] (-606.682) (-606.146) -- 0:00:49
      39000 -- [-602.163] (-603.211) (-605.493) (-612.763) * [-603.726] (-603.828) (-604.304) (-606.778) -- 0:00:49
      39500 -- (-603.556) (-602.820) (-603.308) [-608.806] * (-603.993) (-602.908) (-605.037) [-602.893] -- 0:00:48
      40000 -- (-603.696) [-603.644] (-604.494) (-609.716) * (-602.820) [-602.497] (-604.168) (-604.377) -- 0:00:48

      Average standard deviation of split frequencies: 0.043927

      40500 -- [-605.810] (-605.329) (-606.807) (-612.120) * (-602.542) (-604.914) [-602.883] (-605.389) -- 0:00:47
      41000 -- (-602.755) (-602.798) [-605.047] (-611.886) * (-603.543) [-604.505] (-602.800) (-602.859) -- 0:00:46
      41500 -- (-604.483) [-602.255] (-605.119) (-612.020) * (-602.618) [-607.142] (-605.707) (-602.957) -- 0:00:46
      42000 -- (-609.408) [-601.894] (-604.358) (-618.568) * (-604.292) (-602.830) (-604.534) [-603.742] -- 0:01:08
      42500 -- (-607.204) [-604.013] (-602.700) (-624.973) * (-605.369) [-603.996] (-604.312) (-604.770) -- 0:01:07
      43000 -- (-604.974) (-604.337) (-607.510) [-614.294] * (-607.441) (-604.129) (-604.702) [-604.452] -- 0:01:06
      43500 -- (-604.104) (-604.395) [-604.013] (-624.512) * (-607.817) (-608.417) (-605.490) [-605.643] -- 0:01:05
      44000 -- [-602.937] (-603.704) (-607.528) (-616.907) * [-605.994] (-603.162) (-608.761) (-603.949) -- 0:01:05
      44500 -- [-602.402] (-604.151) (-602.690) (-606.006) * [-602.796] (-610.051) (-604.998) (-603.502) -- 0:01:04
      45000 -- (-605.454) (-607.293) (-602.565) [-607.169] * [-603.213] (-604.343) (-604.879) (-603.163) -- 0:01:03

      Average standard deviation of split frequencies: 0.042855

      45500 -- [-603.997] (-606.574) (-602.542) (-605.941) * (-602.971) (-602.045) [-603.426] (-603.696) -- 0:01:02
      46000 -- [-602.117] (-604.043) (-606.969) (-604.976) * [-602.898] (-603.059) (-606.409) (-604.220) -- 0:01:02
      46500 -- (-602.698) [-603.989] (-605.572) (-603.603) * (-602.400) (-603.906) [-602.819] (-604.426) -- 0:01:01
      47000 -- [-601.997] (-605.347) (-603.638) (-608.159) * [-603.520] (-609.162) (-604.642) (-603.150) -- 0:01:00
      47500 -- [-603.849] (-602.897) (-603.839) (-608.149) * (-604.645) (-603.180) [-603.932] (-605.376) -- 0:01:00
      48000 -- (-602.833) (-602.894) (-603.638) [-603.748] * (-604.401) (-603.362) [-607.632] (-605.135) -- 0:00:59
      48500 -- [-602.330] (-604.020) (-603.884) (-604.671) * (-602.691) (-607.219) [-604.675] (-605.463) -- 0:00:58
      49000 -- (-604.937) (-603.711) [-605.071] (-604.261) * (-606.509) [-602.650] (-602.813) (-602.954) -- 0:00:58
      49500 -- [-602.692] (-606.277) (-604.999) (-606.363) * (-606.092) (-603.214) (-605.086) [-602.657] -- 0:00:57
      50000 -- (-601.928) [-605.025] (-605.024) (-605.780) * [-603.933] (-603.694) (-607.164) (-602.859) -- 0:00:57

      Average standard deviation of split frequencies: 0.042291

      50500 -- [-602.329] (-603.979) (-606.310) (-604.587) * (-605.599) (-603.117) [-603.083] (-602.695) -- 0:00:56
      51000 -- [-604.265] (-606.634) (-602.952) (-605.850) * (-606.759) (-602.309) [-606.351] (-604.194) -- 0:00:55
      51500 -- [-602.696] (-604.575) (-602.396) (-602.810) * [-605.310] (-602.678) (-603.208) (-603.432) -- 0:00:55
      52000 -- [-603.446] (-604.195) (-605.954) (-606.895) * (-601.914) [-602.678] (-603.389) (-604.943) -- 0:00:54
      52500 -- (-603.672) (-603.980) [-605.978] (-603.699) * (-603.263) (-605.127) (-602.791) [-603.259] -- 0:00:54
      53000 -- (-604.222) [-603.380] (-604.350) (-604.294) * (-602.845) (-607.276) (-604.672) [-603.710] -- 0:00:53
      53500 -- (-604.519) (-602.460) [-605.031] (-604.254) * (-602.843) (-605.433) [-605.730] (-602.229) -- 0:00:53
      54000 -- (-605.493) (-603.177) [-603.126] (-607.108) * [-603.449] (-602.568) (-605.605) (-602.490) -- 0:00:52
      54500 -- [-603.778] (-604.654) (-602.972) (-603.733) * (-604.398) (-603.504) (-602.902) [-602.556] -- 0:00:52
      55000 -- (-603.687) (-604.829) (-605.822) [-603.506] * [-605.518] (-603.482) (-604.642) (-602.604) -- 0:00:51

      Average standard deviation of split frequencies: 0.035444

      55500 -- (-605.459) (-603.604) (-606.871) [-603.909] * (-605.596) (-602.909) [-606.411] (-603.258) -- 0:00:51
      56000 -- (-603.871) (-605.445) (-604.265) [-603.621] * [-603.780] (-604.219) (-605.693) (-602.300) -- 0:00:50
      56500 -- (-606.892) [-605.959] (-602.616) (-603.637) * (-603.550) [-603.553] (-604.857) (-603.904) -- 0:00:50
      57000 -- (-604.639) (-605.040) (-605.361) [-605.072] * (-605.192) (-602.635) [-606.199] (-612.042) -- 0:00:49
      57500 -- (-603.285) (-604.538) [-603.857] (-602.499) * (-603.215) (-603.730) [-605.868] (-608.191) -- 0:00:49
      58000 -- (-606.290) (-603.844) (-602.166) [-604.473] * (-603.283) (-607.120) [-605.954] (-604.269) -- 0:00:48
      58500 -- (-606.059) (-605.767) (-604.268) [-602.391] * [-603.215] (-602.008) (-606.776) (-602.282) -- 0:01:04
      59000 -- (-602.831) (-604.465) [-602.960] (-603.356) * (-603.287) (-604.695) (-607.306) [-603.573] -- 0:01:03
      59500 -- (-603.928) (-604.380) (-602.750) [-603.702] * (-603.782) (-606.886) [-604.736] (-606.413) -- 0:01:03
      60000 -- (-603.228) (-603.605) (-606.297) [-603.420] * (-603.473) [-607.235] (-603.571) (-604.044) -- 0:01:02

      Average standard deviation of split frequencies: 0.030673

      60500 -- (-606.793) [-605.227] (-606.650) (-602.586) * (-603.226) (-604.909) [-602.604] (-604.980) -- 0:01:02
      61000 -- (-603.472) [-605.339] (-606.869) (-602.991) * (-603.658) (-606.520) (-604.658) [-604.075] -- 0:01:01
      61500 -- (-605.826) [-603.492] (-608.035) (-603.672) * (-604.139) (-602.721) (-602.688) [-604.114] -- 0:01:01
      62000 -- (-602.351) (-602.860) (-605.212) [-604.465] * (-605.260) (-603.517) [-602.916] (-602.020) -- 0:01:00
      62500 -- [-603.848] (-603.484) (-605.118) (-605.628) * (-606.248) (-602.654) (-603.648) [-602.533] -- 0:01:00
      63000 -- (-602.995) (-602.728) (-605.118) [-604.861] * [-604.170] (-603.351) (-601.924) (-603.337) -- 0:00:59
      63500 -- (-602.944) (-604.844) (-603.428) [-607.497] * (-603.336) (-604.351) (-607.784) [-605.016] -- 0:00:58
      64000 -- (-607.341) (-604.421) (-604.498) [-602.482] * [-604.610] (-603.829) (-609.004) (-603.081) -- 0:00:58
      64500 -- (-606.226) (-602.701) (-604.472) [-604.196] * (-606.651) (-602.828) (-607.626) [-607.904] -- 0:00:58
      65000 -- (-603.891) [-604.149] (-605.531) (-604.570) * (-607.766) (-607.331) [-605.593] (-608.053) -- 0:00:57

      Average standard deviation of split frequencies: 0.026784

      65500 -- [-603.341] (-604.925) (-602.490) (-603.405) * (-605.127) (-608.126) (-605.482) [-602.382] -- 0:00:57
      66000 -- (-606.549) (-605.545) [-602.722] (-605.980) * [-602.093] (-606.005) (-609.567) (-603.737) -- 0:00:56
      66500 -- (-604.587) (-602.856) [-605.926] (-604.441) * [-602.364] (-614.656) (-607.687) (-603.509) -- 0:00:56
      67000 -- (-607.101) (-604.168) (-602.734) [-604.107] * (-603.311) (-606.279) (-606.366) [-603.046] -- 0:00:55
      67500 -- (-604.657) [-604.154] (-603.620) (-603.716) * [-602.455] (-611.054) (-607.706) (-605.887) -- 0:00:55
      68000 -- (-603.267) [-602.457] (-605.340) (-609.291) * [-605.264] (-605.155) (-611.518) (-605.767) -- 0:00:54
      68500 -- [-602.732] (-605.408) (-603.399) (-605.150) * [-604.392] (-605.883) (-606.692) (-604.261) -- 0:00:54
      69000 -- (-605.657) (-608.175) (-608.918) [-603.490] * (-603.887) [-603.156] (-603.762) (-608.465) -- 0:00:53
      69500 -- (-604.044) (-605.519) (-608.706) [-605.320] * (-602.815) (-606.045) [-603.273] (-603.417) -- 0:00:53
      70000 -- (-606.123) (-605.547) [-604.582] (-603.361) * (-602.505) (-602.722) (-605.903) [-605.425] -- 0:00:53

      Average standard deviation of split frequencies: 0.028439

      70500 -- (-602.199) (-606.618) (-605.267) [-603.611] * (-602.821) [-603.059] (-604.491) (-603.323) -- 0:00:52
      71000 -- [-606.296] (-603.614) (-606.844) (-602.490) * (-606.067) [-602.824] (-603.920) (-603.098) -- 0:00:52
      71500 -- (-605.784) [-603.161] (-608.056) (-602.645) * (-607.278) (-604.995) (-604.324) [-604.598] -- 0:00:51
      72000 -- [-606.033] (-603.761) (-607.091) (-607.391) * (-605.679) (-606.647) [-605.493] (-605.809) -- 0:00:51
      72500 -- (-605.390) [-604.081] (-603.848) (-604.023) * (-606.450) (-603.224) (-607.436) [-604.305] -- 0:00:51
      73000 -- (-606.854) [-601.969] (-602.598) (-604.268) * [-604.842] (-604.926) (-608.072) (-603.414) -- 0:00:50
      73500 -- (-607.513) [-604.665] (-602.460) (-605.696) * (-602.016) [-603.029] (-604.432) (-605.402) -- 0:00:50
      74000 -- (-606.740) (-605.800) [-605.743] (-602.432) * [-604.412] (-603.124) (-604.835) (-603.040) -- 0:00:50
      74500 -- (-602.824) (-605.221) (-606.399) [-606.507] * [-603.621] (-603.746) (-606.949) (-607.251) -- 0:00:49
      75000 -- (-603.315) (-602.415) [-604.108] (-610.936) * (-606.474) [-604.342] (-603.711) (-605.770) -- 0:00:49

      Average standard deviation of split frequencies: 0.031944

      75500 -- (-604.095) (-608.764) [-606.248] (-605.892) * (-605.780) (-604.813) [-603.648] (-605.235) -- 0:01:01
      76000 -- (-602.503) [-606.907] (-603.279) (-608.915) * (-605.578) (-609.007) [-604.457] (-606.034) -- 0:01:00
      76500 -- (-604.446) [-603.592] (-603.183) (-604.152) * [-605.591] (-609.040) (-604.596) (-603.690) -- 0:01:00
      77000 -- (-603.148) [-603.375] (-603.357) (-602.867) * (-608.285) (-605.969) [-602.200] (-608.424) -- 0:00:59
      77500 -- (-603.751) (-606.839) (-606.437) [-602.519] * (-603.696) (-604.514) (-606.135) [-604.447] -- 0:00:59
      78000 -- (-602.705) (-602.620) (-604.676) [-603.997] * (-605.719) (-607.334) (-602.370) [-604.476] -- 0:00:59
      78500 -- [-603.453] (-602.539) (-605.365) (-604.050) * [-604.856] (-606.550) (-602.239) (-604.174) -- 0:00:58
      79000 -- (-605.631) (-606.122) (-605.610) [-603.039] * (-603.693) (-606.840) [-604.562] (-605.930) -- 0:00:58
      79500 -- (-604.143) (-603.832) [-604.478] (-602.656) * (-604.394) (-602.612) (-604.515) [-608.798] -- 0:00:57
      80000 -- (-602.512) (-603.139) [-604.421] (-602.599) * (-601.982) (-603.668) [-603.411] (-605.380) -- 0:00:57

      Average standard deviation of split frequencies: 0.028384

      80500 -- [-602.831] (-604.207) (-603.644) (-608.498) * (-602.246) (-602.536) (-608.698) [-604.307] -- 0:00:57
      81000 -- (-602.231) [-607.628] (-604.367) (-605.830) * [-604.053] (-604.677) (-604.997) (-604.143) -- 0:00:56
      81500 -- (-603.605) (-602.997) (-605.433) [-603.770] * (-605.591) (-603.749) (-605.204) [-608.376] -- 0:00:56
      82000 -- [-603.660] (-603.116) (-605.369) (-606.800) * [-604.059] (-604.465) (-605.551) (-603.020) -- 0:00:55
      82500 -- (-604.730) [-606.655] (-603.554) (-605.773) * (-605.219) (-609.689) (-605.318) [-605.999] -- 0:00:55
      83000 -- [-603.643] (-604.681) (-605.762) (-602.564) * [-604.426] (-608.342) (-604.229) (-606.258) -- 0:00:55
      83500 -- (-603.473) (-605.456) (-607.943) [-601.971] * [-603.518] (-603.984) (-605.751) (-604.322) -- 0:00:54
      84000 -- (-605.558) (-603.665) (-605.278) [-602.017] * (-602.622) (-603.858) (-603.494) [-606.363] -- 0:00:54
      84500 -- (-603.580) (-604.227) (-605.612) [-602.738] * [-603.433] (-606.504) (-602.428) (-603.614) -- 0:00:54
      85000 -- (-602.398) (-609.778) [-603.725] (-605.725) * [-603.805] (-607.116) (-603.831) (-605.424) -- 0:00:53

      Average standard deviation of split frequencies: 0.027407

      85500 -- (-607.480) [-609.222] (-602.965) (-606.491) * (-602.209) [-604.833] (-601.772) (-605.476) -- 0:00:53
      86000 -- (-605.550) (-607.703) [-602.576] (-605.110) * (-604.489) (-604.595) (-602.586) [-603.668] -- 0:00:53
      86500 -- (-607.248) [-606.982] (-603.486) (-608.129) * [-603.058] (-606.136) (-603.563) (-602.199) -- 0:00:52
      87000 -- (-606.967) (-604.182) (-603.211) [-609.249] * (-606.174) (-604.554) (-607.264) [-603.354] -- 0:00:52
      87500 -- (-608.493) (-603.323) [-602.563] (-604.952) * [-607.907] (-603.913) (-604.574) (-602.614) -- 0:00:52
      88000 -- (-608.471) (-602.569) [-604.036] (-610.036) * (-609.978) (-603.503) [-604.358] (-605.411) -- 0:00:51
      88500 -- (-604.548) [-602.080] (-605.603) (-603.171) * (-604.833) (-603.170) (-603.556) [-607.889] -- 0:00:51
      89000 -- [-604.629] (-606.974) (-604.011) (-602.329) * (-602.996) (-605.069) [-602.639] (-602.855) -- 0:00:51
      89500 -- (-605.619) (-603.018) [-602.431] (-602.065) * (-602.842) (-604.743) [-602.511] (-606.566) -- 0:00:50
      90000 -- (-606.358) (-602.259) (-604.963) [-602.907] * [-603.973] (-604.548) (-605.038) (-603.093) -- 0:00:50

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-609.950) (-603.501) (-604.992) [-613.251] * (-606.359) (-604.195) (-607.091) [-602.102] -- 0:00:50
      91000 -- (-604.080) (-604.567) (-602.408) [-604.347] * [-605.206] (-603.694) (-605.632) (-602.691) -- 0:00:49
      91500 -- (-604.731) (-603.816) (-602.254) [-602.779] * [-603.690] (-602.923) (-603.746) (-606.796) -- 0:00:49
      92000 -- (-604.156) [-603.724] (-603.307) (-603.812) * (-605.943) (-603.482) [-603.508] (-602.653) -- 0:00:59
      92500 -- [-603.821] (-603.608) (-602.171) (-607.049) * (-602.006) (-603.396) [-603.589] (-605.338) -- 0:00:58
      93000 -- (-609.618) (-604.958) (-602.765) [-604.271] * [-603.354] (-602.736) (-605.645) (-604.015) -- 0:00:58
      93500 -- (-606.136) (-605.500) (-608.272) [-603.519] * (-604.500) (-602.945) (-605.142) [-606.749] -- 0:00:58
      94000 -- (-603.739) (-603.389) (-605.416) [-603.524] * (-605.035) (-603.942) [-604.185] (-603.441) -- 0:00:57
      94500 -- (-606.744) [-606.972] (-602.643) (-607.898) * (-603.955) [-603.548] (-606.958) (-605.018) -- 0:00:57
      95000 -- [-604.521] (-606.291) (-613.246) (-607.720) * (-603.890) [-609.418] (-603.304) (-606.234) -- 0:00:57

      Average standard deviation of split frequencies: 0.027124

      95500 -- [-603.529] (-607.205) (-603.697) (-607.743) * (-604.499) (-606.157) [-604.922] (-607.022) -- 0:00:56
      96000 -- (-603.098) [-604.023] (-606.004) (-604.131) * (-603.048) (-605.537) (-606.300) [-603.436] -- 0:00:56
      96500 -- [-604.560] (-605.055) (-604.748) (-605.634) * (-604.444) (-606.922) [-602.396] (-603.850) -- 0:00:56
      97000 -- (-606.041) (-603.492) [-602.316] (-604.807) * (-602.726) (-602.900) (-603.135) [-604.108] -- 0:00:55
      97500 -- (-607.034) (-605.389) (-604.101) [-602.958] * (-606.763) (-605.128) (-603.658) [-606.533] -- 0:00:55
      98000 -- (-604.597) [-605.950] (-606.115) (-604.621) * (-604.193) [-601.965] (-603.855) (-603.768) -- 0:00:55
      98500 -- (-604.728) [-603.499] (-607.081) (-605.801) * (-603.273) [-606.332] (-604.968) (-602.972) -- 0:00:54
      99000 -- (-603.441) (-605.161) [-606.598] (-604.044) * (-603.690) (-604.155) (-610.052) [-604.260] -- 0:00:54
      99500 -- (-607.384) [-605.988] (-605.220) (-603.761) * (-604.415) [-604.994] (-609.725) (-602.695) -- 0:00:54
      100000 -- (-606.218) (-607.889) (-605.682) [-606.304] * (-606.483) (-607.891) (-607.261) [-604.444] -- 0:00:54

      Average standard deviation of split frequencies: 0.032567

      100500 -- (-607.430) [-604.277] (-603.804) (-604.279) * (-602.448) (-605.351) (-612.136) [-606.069] -- 0:00:53
      101000 -- (-604.036) (-604.952) [-604.370] (-604.413) * [-602.772] (-604.124) (-603.079) (-606.711) -- 0:00:53
      101500 -- (-607.706) (-606.911) [-603.795] (-604.554) * [-603.852] (-605.448) (-602.820) (-605.579) -- 0:00:53
      102000 -- (-608.126) (-603.532) [-603.067] (-602.470) * (-602.920) (-602.347) (-603.607) [-605.032] -- 0:00:52
      102500 -- (-604.873) [-602.064] (-602.025) (-604.514) * (-603.910) (-605.466) (-606.438) [-605.235] -- 0:00:52
      103000 -- [-603.901] (-604.550) (-604.026) (-602.976) * (-605.353) (-606.344) (-605.677) [-602.602] -- 0:00:52
      103500 -- (-604.430) [-605.591] (-601.823) (-604.442) * (-606.134) (-605.204) [-603.852] (-604.619) -- 0:00:51
      104000 -- (-606.020) (-606.094) (-601.862) [-604.669] * (-608.582) (-602.616) (-606.642) [-602.793] -- 0:00:51
      104500 -- [-604.521] (-605.004) (-603.094) (-601.923) * (-605.154) [-602.786] (-604.962) (-604.895) -- 0:00:51
      105000 -- (-606.308) [-602.237] (-603.121) (-607.470) * (-602.585) (-602.927) [-602.763] (-606.262) -- 0:00:51

      Average standard deviation of split frequencies: 0.031711

      105500 -- [-605.219] (-601.819) (-603.042) (-603.506) * (-602.426) (-604.170) [-603.419] (-609.812) -- 0:00:50
      106000 -- (-608.984) [-601.983] (-602.254) (-602.459) * (-603.636) (-605.239) [-604.246] (-604.120) -- 0:00:50
      106500 -- [-603.787] (-602.268) (-604.330) (-602.397) * (-602.986) (-608.311) (-602.697) [-605.340] -- 0:00:50
      107000 -- [-604.335] (-602.127) (-605.116) (-609.449) * (-606.928) (-605.497) (-605.408) [-603.782] -- 0:00:50
      107500 -- [-603.433] (-603.957) (-605.111) (-610.048) * [-602.110] (-608.979) (-607.094) (-604.983) -- 0:00:49
      108000 -- (-605.644) [-603.937] (-605.296) (-610.440) * (-602.764) (-605.024) [-604.652] (-602.395) -- 0:00:49
      108500 -- (-606.614) (-607.940) (-602.896) [-601.874] * (-604.495) [-604.453] (-608.353) (-607.094) -- 0:00:49
      109000 -- (-607.740) (-606.551) [-602.563] (-603.204) * (-603.381) (-605.092) (-606.190) [-604.253] -- 0:00:57
      109500 -- [-605.405] (-605.999) (-603.274) (-607.128) * (-603.138) (-604.284) [-605.616] (-603.798) -- 0:00:56
      110000 -- [-605.135] (-606.831) (-605.877) (-605.367) * (-602.924) [-602.286] (-602.019) (-604.783) -- 0:00:56

      Average standard deviation of split frequencies: 0.031238

      110500 -- [-602.360] (-604.011) (-602.789) (-604.856) * [-603.692] (-603.786) (-602.019) (-606.611) -- 0:00:56
      111000 -- (-602.028) (-603.539) (-607.106) [-602.161] * [-605.002] (-603.172) (-601.822) (-604.634) -- 0:00:56
      111500 -- (-603.988) [-606.879] (-605.163) (-604.624) * [-607.778] (-604.839) (-607.282) (-603.655) -- 0:00:55
      112000 -- (-602.308) (-602.570) (-603.301) [-604.465] * (-604.614) [-603.939] (-606.993) (-604.444) -- 0:00:55
      112500 -- (-603.061) [-605.681] (-602.770) (-603.677) * (-605.830) (-603.844) (-602.428) [-606.031] -- 0:00:55
      113000 -- (-603.654) (-603.006) (-602.022) [-605.137] * (-605.131) (-603.479) (-605.059) [-602.893] -- 0:00:54
      113500 -- (-607.904) (-603.859) (-605.757) [-603.800] * (-604.485) (-602.519) [-604.572] (-604.980) -- 0:00:54
      114000 -- (-604.588) [-604.631] (-606.729) (-613.310) * (-606.310) (-603.753) (-607.586) [-602.670] -- 0:00:54
      114500 -- (-605.068) [-602.764] (-608.973) (-603.649) * (-605.268) [-601.904] (-607.264) (-604.874) -- 0:00:54
      115000 -- (-604.342) [-603.227] (-604.374) (-606.704) * (-604.574) (-603.517) (-602.511) [-604.600] -- 0:00:53

      Average standard deviation of split frequencies: 0.033478

      115500 -- (-602.635) (-606.411) [-603.828] (-603.697) * (-607.532) [-603.609] (-608.852) (-607.061) -- 0:00:53
      116000 -- (-607.283) [-606.155] (-603.821) (-602.980) * (-603.010) [-603.752] (-603.828) (-602.048) -- 0:00:53
      116500 -- (-604.912) [-603.143] (-606.228) (-604.134) * (-602.826) (-603.456) [-603.407] (-605.365) -- 0:00:53
      117000 -- (-608.342) [-603.107] (-607.151) (-608.035) * (-604.708) (-606.281) (-605.004) [-605.933] -- 0:00:52
      117500 -- [-603.162] (-609.278) (-605.630) (-604.912) * [-604.715] (-610.467) (-604.121) (-604.192) -- 0:00:52
      118000 -- (-603.311) [-603.606] (-602.676) (-605.187) * (-606.522) (-605.807) [-604.458] (-603.743) -- 0:00:52
      118500 -- [-603.084] (-606.238) (-609.265) (-603.004) * (-604.018) (-607.037) [-605.959] (-604.343) -- 0:00:52
      119000 -- (-604.637) (-604.867) (-606.222) [-602.367] * (-606.765) (-602.435) (-606.329) [-604.150] -- 0:00:51
      119500 -- (-604.244) [-602.185] (-602.597) (-605.045) * [-605.995] (-604.523) (-606.198) (-605.173) -- 0:00:51
      120000 -- (-606.733) [-603.768] (-604.253) (-606.335) * (-606.234) [-602.931] (-605.074) (-608.262) -- 0:00:51

      Average standard deviation of split frequencies: 0.032621

      120500 -- [-602.959] (-604.222) (-603.744) (-606.174) * (-603.232) [-605.204] (-606.993) (-606.659) -- 0:00:51
      121000 -- (-605.533) (-604.507) [-604.408] (-603.011) * [-603.609] (-603.109) (-603.319) (-607.191) -- 0:00:50
      121500 -- (-603.138) (-604.232) (-602.681) [-603.437] * (-607.025) (-603.102) (-604.088) [-604.117] -- 0:00:50
      122000 -- [-603.852] (-604.718) (-603.016) (-605.932) * (-611.784) (-602.620) (-602.964) [-605.879] -- 0:00:50
      122500 -- [-604.336] (-604.294) (-602.778) (-603.637) * (-606.345) (-603.161) (-602.896) [-605.074] -- 0:00:50
      123000 -- (-603.327) (-603.189) (-602.641) [-602.880] * (-607.687) (-605.908) (-604.772) [-602.332] -- 0:00:49
      123500 -- [-602.201] (-606.679) (-603.953) (-604.525) * (-604.136) (-607.324) (-604.579) [-604.972] -- 0:00:49
      124000 -- [-602.818] (-603.463) (-603.869) (-602.455) * (-602.120) [-603.455] (-604.643) (-604.565) -- 0:00:49
      124500 -- (-606.903) (-604.571) [-605.190] (-602.633) * (-603.759) (-605.743) [-603.776] (-603.297) -- 0:00:49
      125000 -- (-603.491) [-603.657] (-603.904) (-603.758) * (-605.895) [-604.525] (-603.850) (-603.646) -- 0:00:49

      Average standard deviation of split frequencies: 0.029080

      125500 -- (-604.290) (-608.231) [-604.673] (-602.207) * (-603.275) (-604.452) [-603.894] (-602.950) -- 0:00:55
      126000 -- (-604.096) (-603.588) (-606.179) [-604.280] * (-607.231) (-603.561) (-602.006) [-607.624] -- 0:00:55
      126500 -- (-603.674) [-602.590] (-606.433) (-605.484) * (-604.069) [-603.101] (-604.542) (-606.695) -- 0:00:55
      127000 -- (-603.954) [-601.901] (-602.806) (-606.296) * [-602.965] (-603.422) (-604.125) (-602.181) -- 0:00:54
      127500 -- [-606.161] (-602.182) (-604.423) (-603.013) * [-603.306] (-604.694) (-610.864) (-603.386) -- 0:00:54
      128000 -- (-604.221) [-603.997] (-605.111) (-604.054) * (-602.711) (-606.598) [-604.542] (-604.664) -- 0:00:54
      128500 -- (-603.938) (-607.028) [-604.542] (-607.712) * (-602.786) (-604.477) [-602.724] (-603.959) -- 0:00:54
      129000 -- (-603.978) (-608.709) [-603.473] (-607.449) * (-604.633) (-602.941) (-603.436) [-602.236] -- 0:00:54
      129500 -- (-604.873) (-603.107) (-602.309) [-604.875] * (-609.836) (-605.162) (-606.790) [-604.582] -- 0:00:53
      130000 -- (-602.950) (-606.521) (-602.419) [-602.596] * (-607.715) [-601.892] (-607.977) (-605.295) -- 0:00:53

      Average standard deviation of split frequencies: 0.030124

      130500 -- [-602.412] (-604.125) (-605.259) (-604.728) * (-605.512) (-607.079) [-606.482] (-605.904) -- 0:00:53
      131000 -- [-602.540] (-603.189) (-602.806) (-608.451) * (-603.640) [-603.461] (-605.313) (-606.120) -- 0:00:53
      131500 -- (-602.868) (-603.231) [-603.354] (-607.588) * [-602.915] (-603.046) (-602.553) (-605.684) -- 0:00:52
      132000 -- [-605.478] (-603.370) (-603.149) (-608.310) * (-605.576) (-602.217) [-603.794] (-605.997) -- 0:00:52
      132500 -- (-602.718) (-608.441) [-603.811] (-604.615) * [-602.684] (-603.453) (-603.612) (-603.352) -- 0:00:52
      133000 -- [-602.656] (-603.560) (-604.739) (-602.999) * [-602.904] (-605.836) (-609.427) (-602.253) -- 0:00:52
      133500 -- (-602.620) (-602.412) (-603.459) [-608.648] * [-603.157] (-603.500) (-606.974) (-603.239) -- 0:00:51
      134000 -- (-603.432) [-602.933] (-604.678) (-602.453) * (-603.058) (-603.471) (-605.584) [-602.530] -- 0:00:51
      134500 -- (-605.065) [-603.681] (-602.856) (-604.742) * (-602.249) (-605.072) (-609.379) [-603.803] -- 0:00:51
      135000 -- (-605.502) (-603.769) [-605.044] (-605.093) * (-603.335) [-604.935] (-605.038) (-604.340) -- 0:00:51

      Average standard deviation of split frequencies: 0.031196

      135500 -- (-603.426) [-605.227] (-604.988) (-607.278) * (-603.800) (-603.382) (-603.382) [-604.871] -- 0:00:51
      136000 -- [-604.065] (-607.053) (-603.415) (-607.915) * (-603.262) [-609.975] (-603.680) (-604.458) -- 0:00:50
      136500 -- [-602.878] (-603.563) (-602.803) (-605.172) * [-606.043] (-607.720) (-603.842) (-602.614) -- 0:00:50
      137000 -- (-603.989) (-605.802) [-604.126] (-602.794) * (-605.635) [-606.228] (-604.236) (-610.748) -- 0:00:50
      137500 -- [-602.595] (-602.190) (-606.803) (-603.940) * (-604.881) [-608.562] (-604.206) (-603.804) -- 0:00:50
      138000 -- (-603.250) (-605.509) [-602.982] (-606.842) * (-605.470) (-603.925) (-604.036) [-603.208] -- 0:00:49
      138500 -- (-603.510) [-602.489] (-604.618) (-604.156) * (-604.503) [-605.133] (-605.151) (-604.796) -- 0:00:49
      139000 -- (-609.400) [-602.393] (-605.847) (-608.875) * [-606.212] (-603.355) (-604.716) (-602.464) -- 0:00:49
      139500 -- (-605.751) [-603.908] (-608.073) (-611.495) * [-602.265] (-602.644) (-604.982) (-604.545) -- 0:00:49
      140000 -- (-610.253) (-603.493) (-607.944) [-604.770] * (-602.297) (-607.627) [-604.608] (-607.056) -- 0:00:49

      Average standard deviation of split frequencies: 0.029103

      140500 -- [-606.790] (-606.848) (-608.435) (-604.164) * [-603.094] (-604.933) (-604.543) (-605.038) -- 0:00:48
      141000 -- (-607.685) (-606.032) (-602.460) [-603.954] * [-605.072] (-603.487) (-604.194) (-606.729) -- 0:00:48
      141500 -- (-605.816) (-606.678) [-604.924] (-604.212) * (-603.077) (-604.100) [-603.956] (-605.059) -- 0:00:48
      142000 -- [-602.627] (-603.800) (-602.733) (-603.394) * (-604.270) (-604.397) [-604.858] (-603.174) -- 0:00:54
      142500 -- (-602.926) (-610.397) (-602.196) [-603.599] * (-603.662) [-603.186] (-602.437) (-607.778) -- 0:00:54
      143000 -- (-606.922) (-604.553) (-602.566) [-605.179] * [-602.092] (-603.503) (-602.816) (-604.847) -- 0:00:53
      143500 -- (-608.543) [-604.188] (-602.277) (-606.620) * [-602.261] (-605.485) (-604.770) (-603.616) -- 0:00:53
      144000 -- (-603.762) [-607.787] (-605.176) (-606.076) * [-604.576] (-605.258) (-609.602) (-605.111) -- 0:00:53
      144500 -- (-603.733) (-603.517) [-602.942] (-603.253) * (-604.260) [-604.278] (-606.472) (-607.090) -- 0:00:53
      145000 -- [-604.887] (-603.076) (-605.620) (-603.448) * [-602.382] (-605.643) (-603.210) (-604.109) -- 0:00:53

      Average standard deviation of split frequencies: 0.026292

      145500 -- (-605.801) (-602.924) [-604.731] (-602.717) * (-605.111) [-604.473] (-607.022) (-606.303) -- 0:00:52
      146000 -- [-606.658] (-603.066) (-605.054) (-604.260) * [-605.566] (-604.269) (-607.953) (-604.093) -- 0:00:52
      146500 -- [-604.392] (-603.877) (-604.324) (-602.551) * (-602.829) (-602.859) (-602.377) [-604.207] -- 0:00:52
      147000 -- (-606.758) [-603.729] (-608.640) (-605.055) * (-605.663) [-605.075] (-602.964) (-605.085) -- 0:00:52
      147500 -- (-604.201) [-603.199] (-607.286) (-607.025) * (-603.394) [-605.838] (-606.122) (-606.509) -- 0:00:52
      148000 -- (-602.846) (-602.779) (-605.243) [-603.617] * (-603.717) (-607.234) (-604.900) [-607.917] -- 0:00:51
      148500 -- (-605.336) (-604.499) (-608.282) [-604.518] * (-604.514) (-604.310) [-603.304] (-607.417) -- 0:00:51
      149000 -- (-603.599) (-604.694) (-605.466) [-604.704] * (-604.843) (-603.044) [-603.081] (-609.684) -- 0:00:51
      149500 -- (-604.999) [-602.962] (-607.777) (-604.998) * (-606.463) (-604.864) [-603.780] (-606.126) -- 0:00:51
      150000 -- (-604.577) (-606.017) [-606.457] (-606.143) * [-602.666] (-606.661) (-605.451) (-606.158) -- 0:00:51

      Average standard deviation of split frequencies: 0.025969

      150500 -- (-604.613) (-608.788) (-603.063) [-603.740] * [-602.476] (-606.138) (-603.510) (-607.809) -- 0:00:50
      151000 -- [-605.116] (-603.001) (-603.553) (-602.222) * [-606.354] (-603.170) (-604.750) (-606.831) -- 0:00:50
      151500 -- (-607.551) [-603.507] (-608.629) (-602.784) * (-604.657) (-604.880) [-603.703] (-610.127) -- 0:00:50
      152000 -- (-607.420) (-603.473) [-603.562] (-607.441) * (-603.155) [-606.225] (-602.412) (-607.656) -- 0:00:50
      152500 -- (-604.210) (-602.536) (-603.785) [-606.847] * (-605.521) [-603.302] (-602.196) (-606.674) -- 0:00:50
      153000 -- [-606.133] (-604.024) (-606.618) (-603.946) * (-602.691) [-606.663] (-602.223) (-607.055) -- 0:00:49
      153500 -- (-604.457) (-604.595) (-604.610) [-602.343] * [-604.716] (-604.440) (-602.098) (-603.693) -- 0:00:49
      154000 -- (-605.999) [-605.698] (-609.068) (-603.557) * (-605.010) (-604.244) [-601.776] (-603.505) -- 0:00:49
      154500 -- (-606.158) [-604.001] (-604.949) (-602.002) * [-602.740] (-603.235) (-602.322) (-604.254) -- 0:00:49
      155000 -- [-603.155] (-602.665) (-604.195) (-603.707) * [-604.399] (-603.488) (-603.194) (-603.719) -- 0:00:49

      Average standard deviation of split frequencies: 0.030067

      155500 -- (-603.513) [-604.775] (-603.993) (-606.940) * [-604.419] (-605.424) (-603.524) (-607.333) -- 0:00:48
      156000 -- (-603.209) [-604.241] (-602.495) (-602.139) * [-603.958] (-603.758) (-607.221) (-606.660) -- 0:00:48
      156500 -- (-603.012) (-604.441) (-603.096) [-602.515] * (-604.916) (-603.885) [-607.927] (-604.793) -- 0:00:48
      157000 -- (-606.122) (-604.130) [-604.870] (-602.889) * [-605.167] (-605.083) (-603.528) (-602.911) -- 0:00:48
      157500 -- [-603.099] (-614.133) (-606.028) (-603.110) * (-606.683) (-602.420) [-602.603] (-605.749) -- 0:00:53
      158000 -- (-607.592) (-615.905) (-606.585) [-603.508] * [-602.974] (-602.572) (-602.169) (-603.047) -- 0:00:53
      158500 -- [-602.620] (-612.807) (-603.575) (-603.076) * (-602.267) (-604.171) (-603.090) [-604.944] -- 0:00:53
      159000 -- [-605.692] (-610.521) (-602.952) (-603.157) * (-605.965) [-604.759] (-604.687) (-610.262) -- 0:00:52
      159500 -- [-603.651] (-607.855) (-606.389) (-602.748) * [-603.765] (-605.630) (-604.519) (-609.564) -- 0:00:52
      160000 -- (-606.489) (-604.875) (-605.120) [-603.787] * (-602.245) (-603.653) (-602.506) [-605.363] -- 0:00:52

      Average standard deviation of split frequencies: 0.026406

      160500 -- (-607.612) (-604.113) [-602.756] (-601.917) * (-607.987) (-604.362) (-603.971) [-606.461] -- 0:00:52
      161000 -- [-605.876] (-603.601) (-602.624) (-602.256) * (-603.198) (-604.118) [-604.502] (-607.997) -- 0:00:52
      161500 -- (-603.505) (-603.563) [-603.551] (-602.751) * (-603.774) (-603.796) (-603.270) [-606.878] -- 0:00:51
      162000 -- (-603.544) (-603.544) [-603.875] (-602.550) * (-604.657) (-607.000) [-603.741] (-603.609) -- 0:00:51
      162500 -- (-603.629) (-603.968) (-603.874) [-604.245] * [-605.120] (-611.220) (-603.135) (-604.327) -- 0:00:51
      163000 -- (-603.120) [-603.333] (-605.374) (-605.639) * [-602.503] (-603.995) (-604.224) (-602.636) -- 0:00:51
      163500 -- (-604.102) (-602.484) (-602.825) [-602.762] * [-604.704] (-603.242) (-606.546) (-606.726) -- 0:00:51
      164000 -- (-602.837) (-602.320) [-604.059] (-602.788) * [-605.865] (-602.831) (-604.424) (-605.686) -- 0:00:50
      164500 -- (-603.839) (-605.193) (-602.686) [-605.980] * [-603.684] (-603.477) (-604.846) (-602.135) -- 0:00:50
      165000 -- (-603.438) (-605.280) (-604.693) [-605.114] * (-603.878) (-603.561) [-606.743] (-603.822) -- 0:00:50

      Average standard deviation of split frequencies: 0.023286

      165500 -- (-603.984) (-604.031) [-602.856] (-604.045) * (-605.341) (-604.645) [-603.845] (-603.299) -- 0:00:50
      166000 -- [-604.492] (-602.644) (-604.962) (-605.502) * [-602.178] (-603.267) (-605.943) (-604.541) -- 0:00:50
      166500 -- [-603.825] (-603.744) (-602.265) (-603.147) * [-604.780] (-605.448) (-602.970) (-605.025) -- 0:00:50
      167000 -- (-603.542) [-604.209] (-606.725) (-604.068) * [-603.102] (-605.266) (-603.042) (-604.686) -- 0:00:49
      167500 -- [-603.742] (-603.474) (-602.598) (-607.151) * (-606.491) [-603.665] (-603.784) (-604.110) -- 0:00:49
      168000 -- [-605.964] (-603.504) (-603.658) (-604.118) * [-604.456] (-604.030) (-604.711) (-606.382) -- 0:00:49
      168500 -- (-609.688) (-603.963) [-602.681] (-602.385) * (-605.372) [-604.761] (-606.865) (-603.386) -- 0:00:49
      169000 -- (-606.181) (-604.843) [-602.308] (-605.163) * (-604.060) (-604.733) (-604.427) [-604.167] -- 0:00:49
      169500 -- [-603.742] (-605.057) (-605.372) (-602.487) * (-606.277) [-604.393] (-603.483) (-603.861) -- 0:00:48
      170000 -- [-602.868] (-604.916) (-605.694) (-604.310) * [-607.322] (-602.927) (-608.209) (-605.160) -- 0:00:53

      Average standard deviation of split frequencies: 0.022097

      170500 -- [-602.605] (-605.858) (-602.958) (-602.556) * (-606.607) (-607.502) [-603.576] (-604.348) -- 0:00:53
      171000 -- (-603.063) (-605.732) (-603.399) [-604.882] * [-607.515] (-604.774) (-605.014) (-608.173) -- 0:00:53
      171500 -- [-603.522] (-603.533) (-603.336) (-604.406) * [-603.972] (-603.610) (-601.905) (-607.729) -- 0:00:53
      172000 -- [-604.939] (-603.401) (-604.397) (-604.511) * [-605.208] (-606.342) (-602.068) (-602.733) -- 0:00:52
      172500 -- (-605.226) [-605.215] (-603.232) (-602.978) * [-605.502] (-604.832) (-604.069) (-602.721) -- 0:00:52
      173000 -- (-606.251) (-611.127) [-602.589] (-604.173) * (-604.345) (-602.373) [-603.178] (-602.508) -- 0:00:52
      173500 -- [-606.398] (-604.399) (-602.652) (-602.289) * (-602.620) (-603.321) (-605.752) [-603.459] -- 0:00:52
      174000 -- (-606.091) [-602.283] (-602.906) (-601.805) * (-605.787) [-604.459] (-603.691) (-604.615) -- 0:00:52
      174500 -- (-604.757) [-605.328] (-603.751) (-602.551) * [-604.663] (-603.158) (-605.104) (-606.433) -- 0:00:52
      175000 -- (-605.335) (-602.079) [-605.359] (-605.164) * (-604.223) (-607.203) (-604.734) [-606.042] -- 0:00:51

      Average standard deviation of split frequencies: 0.019686

      175500 -- (-602.524) (-603.417) [-603.154] (-603.543) * (-603.065) [-604.802] (-603.569) (-604.773) -- 0:00:51
      176000 -- (-608.228) (-603.872) [-606.905] (-602.787) * (-607.200) (-603.197) [-605.020] (-604.538) -- 0:00:51
      176500 -- [-608.617] (-602.395) (-605.596) (-603.187) * (-604.912) [-604.761] (-602.203) (-603.076) -- 0:00:51
      177000 -- (-605.551) [-603.079] (-602.612) (-603.530) * [-606.283] (-604.153) (-605.257) (-602.356) -- 0:00:51
      177500 -- [-604.624] (-604.524) (-605.273) (-604.585) * [-602.881] (-603.041) (-610.185) (-603.022) -- 0:00:50
      178000 -- [-603.495] (-602.591) (-606.494) (-607.389) * (-606.735) (-603.632) (-611.288) [-602.904] -- 0:00:50
      178500 -- (-603.235) (-606.514) [-604.854] (-609.478) * (-604.829) (-603.168) (-610.013) [-604.186] -- 0:00:50
      179000 -- (-607.285) (-602.591) (-605.610) [-604.915] * (-604.578) (-603.843) (-603.869) [-603.522] -- 0:00:50
      179500 -- (-605.195) (-604.136) (-602.697) [-602.867] * (-604.438) (-608.064) (-605.325) [-602.249] -- 0:00:50
      180000 -- [-603.991] (-604.270) (-604.285) (-606.717) * (-603.575) [-602.702] (-603.377) (-603.509) -- 0:00:50

      Average standard deviation of split frequencies: 0.019961

      180500 -- (-610.102) (-604.334) [-603.346] (-603.605) * (-603.427) (-605.277) [-603.173] (-604.027) -- 0:00:49
      181000 -- (-605.775) (-603.999) (-603.975) [-603.274] * [-603.936] (-603.873) (-607.617) (-610.076) -- 0:00:49
      181500 -- (-604.464) (-603.093) (-605.324) [-602.388] * (-603.828) (-603.226) [-602.871] (-605.588) -- 0:00:49
      182000 -- (-604.712) (-603.785) [-604.196] (-604.735) * (-602.015) [-603.023] (-602.850) (-603.879) -- 0:00:49
      182500 -- (-603.755) (-604.387) [-603.603] (-602.529) * [-602.777] (-606.643) (-603.084) (-604.653) -- 0:00:49
      183000 -- [-602.208] (-602.285) (-605.818) (-604.903) * (-606.775) (-602.723) [-607.131] (-606.286) -- 0:00:53
      183500 -- (-604.937) (-602.371) [-602.354] (-604.609) * (-603.912) (-602.914) (-605.774) [-604.429] -- 0:00:53
      184000 -- [-604.473] (-603.422) (-602.450) (-602.840) * [-603.258] (-603.387) (-603.317) (-604.854) -- 0:00:53
      184500 -- (-603.614) (-607.095) (-604.086) [-603.864] * (-604.904) (-604.678) [-603.388] (-605.354) -- 0:00:53
      185000 -- [-602.951] (-607.180) (-606.512) (-604.346) * (-602.292) (-602.607) [-603.647] (-604.377) -- 0:00:52

      Average standard deviation of split frequencies: 0.020402

      185500 -- (-605.198) (-605.571) [-607.256] (-603.020) * (-603.168) (-602.918) (-603.479) [-604.720] -- 0:00:52
      186000 -- (-606.618) (-605.023) [-603.858] (-606.500) * (-608.629) [-603.698] (-603.852) (-602.899) -- 0:00:52
      186500 -- (-602.295) [-603.286] (-604.625) (-605.200) * [-603.240] (-604.928) (-603.291) (-603.156) -- 0:00:52
      187000 -- (-607.768) (-603.892) [-603.004] (-604.816) * (-603.860) [-603.836] (-602.037) (-603.213) -- 0:00:52
      187500 -- (-604.851) (-605.737) (-605.603) [-606.719] * (-605.235) (-602.665) (-602.050) [-602.821] -- 0:00:52
      188000 -- [-605.786] (-603.188) (-604.284) (-602.760) * (-605.053) (-604.683) (-603.122) [-602.747] -- 0:00:51
      188500 -- (-603.505) (-605.360) [-602.613] (-603.565) * (-602.723) (-604.384) [-605.977] (-605.061) -- 0:00:51
      189000 -- (-603.426) (-605.076) (-605.874) [-604.404] * [-603.819] (-605.178) (-602.652) (-604.964) -- 0:00:51
      189500 -- (-604.759) (-605.524) [-604.251] (-603.782) * (-603.346) [-602.404] (-603.893) (-606.831) -- 0:00:51
      190000 -- [-604.088] (-605.119) (-604.975) (-604.256) * (-605.126) [-603.693] (-602.957) (-604.387) -- 0:00:51

      Average standard deviation of split frequencies: 0.022252

      190500 -- (-606.209) (-606.987) (-603.159) [-606.644] * (-603.214) [-606.226] (-604.001) (-607.289) -- 0:00:50
      191000 -- (-607.943) (-606.918) (-606.530) [-603.843] * [-604.320] (-605.907) (-603.062) (-606.977) -- 0:00:50
      191500 -- (-605.156) [-601.959] (-604.689) (-604.774) * (-603.400) (-604.324) (-605.609) [-602.048] -- 0:00:50
      192000 -- [-603.131] (-606.904) (-605.036) (-606.595) * (-603.071) (-603.228) (-603.596) [-602.631] -- 0:00:50
      192500 -- [-603.065] (-605.496) (-603.711) (-605.252) * (-604.028) (-602.732) (-603.547) [-606.724] -- 0:00:50
      193000 -- (-602.701) (-602.538) [-605.231] (-602.922) * (-602.172) [-604.832] (-604.183) (-601.967) -- 0:00:50
      193500 -- (-604.317) (-604.130) (-602.597) [-604.477] * (-605.243) [-603.637] (-604.583) (-602.000) -- 0:00:50
      194000 -- (-610.779) (-606.704) (-605.398) [-603.267] * (-603.587) [-603.790] (-604.148) (-607.598) -- 0:00:49
      194500 -- (-606.316) [-604.924] (-604.401) (-607.865) * (-607.093) [-603.300] (-602.827) (-608.187) -- 0:00:49
      195000 -- [-604.487] (-603.437) (-608.055) (-602.734) * (-603.315) (-606.220) (-603.349) [-607.232] -- 0:00:49

      Average standard deviation of split frequencies: 0.021526

      195500 -- (-605.606) (-605.173) (-603.441) [-602.673] * [-602.680] (-607.702) (-602.655) (-605.517) -- 0:00:53
      196000 -- (-607.015) (-604.172) (-603.765) [-605.856] * (-603.771) (-605.315) (-604.625) [-605.550] -- 0:00:53
      196500 -- [-605.567] (-604.890) (-609.308) (-602.662) * (-602.677) (-607.152) [-603.320] (-603.835) -- 0:00:53
      197000 -- (-602.182) (-604.580) [-603.628] (-602.616) * [-603.107] (-603.683) (-605.790) (-605.124) -- 0:00:52
      197500 -- (-607.460) (-605.199) (-603.747) [-605.361] * (-602.315) (-605.182) [-603.502] (-611.433) -- 0:00:52
      198000 -- (-606.711) (-603.011) (-606.217) [-603.619] * [-602.918] (-608.124) (-603.875) (-603.719) -- 0:00:52
      198500 -- [-608.219] (-602.883) (-602.153) (-603.679) * (-603.334) (-603.045) (-603.342) [-603.046] -- 0:00:52
      199000 -- (-607.981) [-602.993] (-603.217) (-607.234) * [-603.342] (-603.290) (-606.144) (-602.541) -- 0:00:52
      199500 -- (-605.594) [-605.526] (-603.249) (-602.441) * (-610.749) [-605.475] (-603.740) (-603.199) -- 0:00:52
      200000 -- (-605.194) (-604.726) (-603.339) [-603.480] * (-604.037) (-604.811) [-604.920] (-604.729) -- 0:00:51

      Average standard deviation of split frequencies: 0.023121

      200500 -- (-605.235) (-604.067) [-604.639] (-603.100) * (-605.688) [-602.685] (-605.753) (-603.199) -- 0:00:51
      201000 -- (-604.050) (-603.104) [-605.374] (-604.389) * (-604.175) (-604.004) [-603.314] (-606.490) -- 0:00:51
      201500 -- (-602.690) [-607.835] (-606.445) (-607.357) * (-606.396) (-604.801) [-603.966] (-603.774) -- 0:00:51
      202000 -- (-604.027) (-602.547) (-611.917) [-605.399] * (-604.082) (-606.002) (-603.867) [-602.376] -- 0:00:51
      202500 -- [-604.836] (-602.883) (-604.177) (-603.986) * [-604.604] (-606.391) (-606.819) (-602.335) -- 0:00:51
      203000 -- (-605.468) (-607.588) (-603.856) [-603.892] * (-607.133) (-609.044) (-604.423) [-602.118] -- 0:00:51
      203500 -- (-605.840) (-608.674) [-603.998] (-605.073) * [-605.868] (-603.035) (-603.631) (-602.470) -- 0:00:50
      204000 -- [-605.260] (-603.623) (-604.985) (-604.221) * (-602.185) [-602.144] (-601.860) (-604.362) -- 0:00:50
      204500 -- (-607.170) (-604.287) (-603.106) [-602.021] * (-602.333) [-601.993] (-603.420) (-603.877) -- 0:00:50
      205000 -- (-608.809) [-606.832] (-603.660) (-602.215) * (-604.263) (-603.384) [-602.206] (-608.612) -- 0:00:50

      Average standard deviation of split frequencies: 0.023913

      205500 -- [-606.242] (-604.822) (-602.048) (-607.193) * [-604.602] (-603.027) (-606.996) (-604.235) -- 0:00:50
      206000 -- (-605.692) (-604.384) (-603.046) [-603.898] * (-603.589) (-602.999) [-602.464] (-604.339) -- 0:00:50
      206500 -- (-605.149) (-608.241) (-607.836) [-602.872] * (-603.267) [-602.023] (-604.253) (-605.970) -- 0:00:49
      207000 -- (-602.357) (-609.863) (-604.452) [-604.481] * (-603.255) (-606.329) (-604.408) [-602.762] -- 0:00:49
      207500 -- (-603.606) (-604.181) [-603.885] (-602.546) * (-603.574) [-606.309] (-603.784) (-603.282) -- 0:00:49
      208000 -- (-604.725) (-603.700) (-608.022) [-602.680] * (-603.026) (-609.163) (-604.086) [-603.606] -- 0:00:49
      208500 -- (-603.078) (-606.592) (-604.423) [-604.632] * (-602.886) (-610.294) (-602.786) [-605.270] -- 0:00:49
      209000 -- (-605.532) (-605.901) (-602.741) [-611.069] * (-604.349) (-603.237) [-602.979] (-602.981) -- 0:00:49
      209500 -- (-604.505) (-606.286) (-603.495) [-606.317] * [-602.703] (-603.204) (-605.536) (-603.620) -- 0:00:49
      210000 -- (-604.555) (-603.108) [-604.662] (-606.292) * (-603.124) (-604.713) (-604.746) [-603.745] -- 0:00:48

      Average standard deviation of split frequencies: 0.024261

      210500 -- (-606.632) (-604.467) (-602.476) [-604.634] * (-602.763) (-603.197) (-602.479) [-604.851] -- 0:00:48
      211000 -- (-604.581) (-603.473) [-603.321] (-602.942) * [-603.616] (-603.490) (-607.466) (-604.223) -- 0:00:48
      211500 -- (-604.962) (-605.626) (-605.637) [-603.891] * (-604.370) (-604.586) [-604.218] (-604.803) -- 0:00:48
      212000 -- [-604.815] (-608.885) (-604.682) (-605.244) * (-602.380) (-604.200) (-605.100) [-605.082] -- 0:00:52
      212500 -- (-603.351) (-605.390) (-609.914) [-603.900] * [-603.720] (-604.349) (-604.890) (-609.823) -- 0:00:51
      213000 -- (-606.822) (-604.889) [-606.794] (-606.101) * (-605.563) (-604.553) [-602.797] (-605.666) -- 0:00:51
      213500 -- (-603.399) [-602.949] (-606.513) (-605.251) * (-607.760) (-603.708) (-605.014) [-605.575] -- 0:00:51
      214000 -- [-606.021] (-603.508) (-605.051) (-603.521) * (-604.976) (-602.480) (-607.202) [-605.959] -- 0:00:51
      214500 -- [-603.242] (-604.709) (-604.146) (-604.919) * (-610.435) [-603.219] (-606.145) (-606.067) -- 0:00:51
      215000 -- [-605.437] (-608.542) (-609.208) (-603.892) * [-606.939] (-602.175) (-605.258) (-611.935) -- 0:00:51

      Average standard deviation of split frequencies: 0.025500

      215500 -- (-608.096) (-603.906) (-606.623) [-604.377] * (-605.039) (-603.557) [-605.540] (-611.085) -- 0:00:50
      216000 -- (-605.479) (-604.051) [-602.818] (-603.335) * (-605.793) (-604.509) (-604.019) [-603.150] -- 0:00:50
      216500 -- (-602.984) (-603.926) (-602.203) [-602.954] * (-607.041) [-602.891] (-604.476) (-606.748) -- 0:00:50
      217000 -- (-603.870) (-602.731) [-605.569] (-604.331) * [-604.424] (-605.089) (-606.691) (-607.674) -- 0:00:50
      217500 -- (-604.592) (-604.192) (-606.625) [-605.342] * (-606.286) (-602.767) (-606.034) [-607.491] -- 0:00:50
      218000 -- (-603.112) (-606.646) (-606.513) [-605.068] * (-605.693) (-604.530) [-606.765] (-602.947) -- 0:00:50
      218500 -- (-603.174) (-604.760) [-605.418] (-602.596) * (-602.983) (-607.545) [-606.041] (-603.061) -- 0:00:50
      219000 -- [-605.906] (-605.050) (-605.914) (-603.790) * (-607.903) (-604.906) (-611.755) [-602.593] -- 0:00:49
      219500 -- (-605.321) [-606.398] (-605.620) (-604.333) * (-605.597) [-602.318] (-612.934) (-604.452) -- 0:00:49
      220000 -- (-605.749) (-606.429) (-604.015) [-604.741] * (-607.649) (-603.109) (-604.476) [-603.065] -- 0:00:49

      Average standard deviation of split frequencies: 0.026535

      220500 -- [-606.002] (-607.089) (-604.798) (-602.685) * [-606.305] (-605.170) (-604.731) (-608.107) -- 0:00:49
      221000 -- (-604.959) (-606.833) [-602.500] (-602.542) * (-606.059) (-605.099) [-604.372] (-603.540) -- 0:00:49
      221500 -- (-604.790) [-603.186] (-603.696) (-603.966) * (-602.761) (-602.706) [-605.264] (-603.367) -- 0:00:49
      222000 -- (-603.793) (-607.241) (-602.217) [-604.469] * [-602.937] (-603.505) (-604.461) (-604.291) -- 0:00:49
      222500 -- (-603.776) [-602.842] (-602.391) (-603.818) * (-604.606) (-605.737) [-604.402] (-602.854) -- 0:00:48
      223000 -- (-602.884) (-604.023) [-603.446] (-607.272) * [-603.002] (-602.980) (-603.981) (-603.606) -- 0:00:48
      223500 -- (-604.346) (-603.038) (-603.606) [-602.261] * [-604.205] (-602.818) (-604.182) (-602.073) -- 0:00:48
      224000 -- [-602.838] (-602.561) (-605.796) (-604.566) * [-604.335] (-605.886) (-603.769) (-603.083) -- 0:00:48
      224500 -- [-603.438] (-602.063) (-603.481) (-606.477) * (-608.966) (-604.199) (-604.890) [-602.113] -- 0:00:48
      225000 -- (-603.902) (-605.050) (-603.772) [-606.215] * (-608.162) (-603.292) [-606.697] (-603.098) -- 0:00:48

      Average standard deviation of split frequencies: 0.026282

      225500 -- (-604.864) (-602.926) [-603.270] (-606.138) * [-603.963] (-604.437) (-603.086) (-604.300) -- 0:00:48
      226000 -- (-606.354) (-603.685) (-603.925) [-603.755] * (-603.090) (-602.528) (-603.850) [-603.955] -- 0:00:47
      226500 -- [-605.457] (-602.814) (-603.594) (-602.233) * [-602.800] (-607.884) (-605.519) (-601.738) -- 0:00:47
      227000 -- (-604.782) (-606.643) [-603.750] (-603.088) * (-602.800) [-606.938] (-607.164) (-602.972) -- 0:00:47
      227500 -- (-606.662) (-602.654) [-602.509] (-605.206) * (-603.584) [-603.792] (-607.463) (-603.244) -- 0:00:47
      228000 -- [-603.914] (-605.411) (-605.210) (-604.751) * (-605.925) [-603.951] (-607.838) (-603.282) -- 0:00:47
      228500 -- (-603.465) (-605.428) [-602.792] (-607.042) * (-607.655) (-603.685) (-606.599) [-603.803] -- 0:00:50
      229000 -- (-605.770) (-603.685) (-603.408) [-604.057] * (-606.448) (-602.745) (-605.080) [-603.221] -- 0:00:50
      229500 -- (-604.911) [-605.406] (-606.483) (-603.370) * (-609.047) (-602.422) [-605.082] (-606.681) -- 0:00:50
      230000 -- (-604.654) (-605.035) (-606.292) [-605.925] * [-603.024] (-604.096) (-604.100) (-609.938) -- 0:00:50

      Average standard deviation of split frequencies: 0.025600

      230500 -- [-602.139] (-602.334) (-603.387) (-607.050) * (-606.915) (-604.951) (-605.766) [-604.447] -- 0:00:50
      231000 -- (-604.127) (-603.984) (-603.212) [-604.616] * [-604.598] (-607.448) (-606.336) (-602.537) -- 0:00:49
      231500 -- [-604.992] (-603.007) (-602.124) (-604.329) * (-602.391) (-610.729) (-602.666) [-602.403] -- 0:00:49
      232000 -- [-603.429] (-605.745) (-604.194) (-605.424) * [-604.449] (-606.587) (-602.933) (-602.139) -- 0:00:49
      232500 -- (-603.011) (-605.938) [-602.119] (-603.031) * (-603.948) [-602.236] (-607.745) (-605.820) -- 0:00:49
      233000 -- (-602.879) (-607.725) [-602.746] (-605.284) * (-605.676) [-603.391] (-604.070) (-604.441) -- 0:00:49
      233500 -- (-605.124) [-605.215] (-604.243) (-607.630) * (-604.088) (-605.283) [-603.329] (-610.954) -- 0:00:49
      234000 -- (-603.878) (-604.906) [-603.058] (-607.267) * (-605.916) (-604.703) [-602.145] (-604.457) -- 0:00:49
      234500 -- (-604.138) [-602.759] (-602.972) (-603.094) * (-607.112) [-603.923] (-602.588) (-603.135) -- 0:00:48
      235000 -- [-604.114] (-603.855) (-605.994) (-602.694) * (-604.139) (-602.576) [-605.293] (-605.951) -- 0:00:48

      Average standard deviation of split frequencies: 0.024706

      235500 -- [-605.038] (-603.194) (-602.965) (-603.283) * [-604.720] (-604.432) (-603.204) (-605.638) -- 0:00:48
      236000 -- [-603.700] (-602.491) (-607.004) (-603.637) * (-604.454) (-603.528) (-607.631) [-604.987] -- 0:00:48
      236500 -- (-604.024) (-602.757) [-608.954] (-604.207) * (-604.339) (-605.116) [-603.963] (-605.030) -- 0:00:48
      237000 -- (-604.950) [-603.214] (-608.818) (-603.700) * (-605.112) [-603.418] (-602.741) (-603.838) -- 0:00:48
      237500 -- [-604.894] (-606.610) (-603.010) (-603.169) * (-605.643) [-603.498] (-602.205) (-607.773) -- 0:00:48
      238000 -- (-604.067) (-606.711) (-602.659) [-605.912] * (-605.129) [-603.720] (-603.930) (-604.315) -- 0:00:48
      238500 -- (-603.099) (-607.318) (-602.257) [-602.138] * (-602.851) (-604.877) (-606.201) [-605.926] -- 0:00:47
      239000 -- (-605.426) [-603.635] (-606.199) (-608.446) * (-605.922) (-607.423) (-603.668) [-604.343] -- 0:00:47
      239500 -- (-603.035) (-606.589) [-603.775] (-606.420) * [-604.600] (-609.465) (-603.315) (-605.799) -- 0:00:47
      240000 -- (-604.416) (-612.677) (-606.399) [-603.847] * (-606.911) (-603.981) (-602.546) [-604.631] -- 0:00:47

      Average standard deviation of split frequencies: 0.023093

      240500 -- (-609.356) (-605.033) (-603.425) [-603.865] * (-604.722) (-603.743) [-605.254] (-604.622) -- 0:00:47
      241000 -- (-606.224) (-604.127) [-605.794] (-607.874) * [-602.576] (-604.823) (-602.139) (-604.442) -- 0:00:47
      241500 -- (-603.093) [-603.633] (-609.225) (-604.540) * (-603.601) [-603.264] (-603.743) (-603.033) -- 0:00:47
      242000 -- (-606.381) (-604.055) [-605.780] (-604.626) * (-605.944) (-604.606) (-604.737) [-609.686] -- 0:00:46
      242500 -- (-604.125) [-603.864] (-602.575) (-604.628) * (-604.915) [-605.738] (-602.772) (-606.995) -- 0:00:46
      243000 -- [-602.441] (-606.347) (-602.522) (-603.856) * [-603.218] (-603.329) (-602.785) (-605.891) -- 0:00:46
      243500 -- (-605.921) (-604.853) (-608.580) [-602.525] * (-602.955) [-607.674] (-607.980) (-604.849) -- 0:00:46
      244000 -- (-603.129) (-604.817) (-605.746) [-605.468] * (-604.446) [-603.392] (-605.859) (-604.485) -- 0:00:46
      244500 -- (-603.102) [-606.567] (-603.648) (-603.133) * (-604.675) [-604.130] (-606.462) (-602.193) -- 0:00:46
      245000 -- (-603.241) [-603.751] (-603.738) (-602.875) * (-604.683) [-603.173] (-606.196) (-602.451) -- 0:00:46

      Average standard deviation of split frequencies: 0.023096

      245500 -- [-603.466] (-605.402) (-605.860) (-602.386) * (-604.842) (-602.871) [-603.524] (-603.392) -- 0:00:49
      246000 -- [-608.874] (-604.853) (-604.195) (-602.595) * (-603.522) (-602.236) [-602.138] (-601.992) -- 0:00:49
      246500 -- (-611.775) (-604.278) (-606.736) [-602.253] * (-603.295) (-602.826) [-602.800] (-603.893) -- 0:00:48
      247000 -- [-603.596] (-605.870) (-605.442) (-605.412) * (-603.987) (-603.347) [-607.239] (-604.417) -- 0:00:48
      247500 -- [-604.466] (-608.988) (-607.848) (-605.236) * (-604.645) (-602.893) (-605.394) [-605.194] -- 0:00:48
      248000 -- (-606.081) (-603.913) (-606.393) [-602.702] * (-602.659) (-605.360) (-605.777) [-605.870] -- 0:00:48
      248500 -- (-602.371) (-605.956) (-604.426) [-605.974] * [-603.299] (-603.346) (-603.292) (-603.354) -- 0:00:48
      249000 -- (-602.750) (-604.070) (-603.196) [-608.891] * (-605.442) (-603.373) [-602.745] (-604.892) -- 0:00:48
      249500 -- (-603.517) (-603.833) (-607.919) [-604.369] * (-605.781) (-605.640) [-603.853] (-605.437) -- 0:00:48
      250000 -- (-605.255) (-604.044) [-602.246] (-604.548) * [-602.254] (-605.762) (-604.817) (-606.464) -- 0:00:48

      Average standard deviation of split frequencies: 0.023925

      250500 -- [-609.064] (-604.068) (-604.198) (-604.917) * (-603.409) (-603.598) [-603.437] (-604.094) -- 0:00:47
      251000 -- (-608.341) (-602.542) (-604.940) [-604.152] * (-603.605) (-602.787) (-603.554) [-603.428] -- 0:00:47
      251500 -- (-607.771) (-606.715) [-604.023] (-604.448) * [-602.515] (-603.167) (-604.166) (-605.336) -- 0:00:47
      252000 -- [-603.261] (-603.672) (-603.968) (-604.375) * (-604.317) (-605.819) [-603.719] (-605.648) -- 0:00:47
      252500 -- (-603.599) [-603.099] (-606.593) (-605.165) * (-605.769) [-605.122] (-603.590) (-606.427) -- 0:00:47
      253000 -- (-603.516) [-603.935] (-605.250) (-602.385) * (-603.992) (-608.038) [-604.838] (-604.542) -- 0:00:47
      253500 -- (-606.682) [-605.010] (-604.903) (-604.312) * (-603.918) [-604.285] (-602.596) (-603.956) -- 0:00:47
      254000 -- (-604.404) [-603.286] (-602.463) (-602.911) * (-606.724) [-604.289] (-604.772) (-605.862) -- 0:00:46
      254500 -- (-604.217) (-603.727) [-605.075] (-603.043) * (-605.473) (-604.978) (-605.512) [-605.207] -- 0:00:46
      255000 -- [-604.823] (-603.731) (-603.202) (-605.251) * (-605.450) (-603.692) [-602.453] (-605.288) -- 0:00:46

      Average standard deviation of split frequencies: 0.024041

      255500 -- [-604.830] (-603.201) (-603.004) (-605.068) * (-603.908) (-602.446) [-603.168] (-606.778) -- 0:00:46
      256000 -- (-602.910) (-608.387) (-605.049) [-606.193] * (-603.667) (-606.226) [-611.200] (-607.234) -- 0:00:46
      256500 -- [-604.200] (-606.027) (-603.827) (-607.947) * [-602.600] (-602.718) (-605.441) (-603.880) -- 0:00:46
      257000 -- (-609.627) (-606.170) (-604.343) [-603.755] * (-602.196) (-606.778) (-605.597) [-604.680] -- 0:00:46
      257500 -- (-602.798) [-603.143] (-605.692) (-602.828) * [-604.175] (-607.456) (-606.994) (-602.963) -- 0:00:46
      258000 -- (-606.050) (-603.556) (-606.004) [-604.407] * [-602.733] (-604.727) (-605.394) (-606.178) -- 0:00:46
      258500 -- [-605.783] (-602.465) (-607.099) (-606.301) * (-603.745) (-604.797) [-606.434] (-605.934) -- 0:00:45
      259000 -- (-603.510) [-602.348] (-602.739) (-605.185) * [-603.862] (-605.064) (-604.771) (-603.023) -- 0:00:45
      259500 -- [-604.432] (-603.069) (-604.691) (-603.095) * [-604.817] (-602.626) (-607.751) (-605.972) -- 0:00:45
      260000 -- (-604.200) (-603.031) [-603.279] (-603.813) * (-610.173) (-604.527) (-604.453) [-602.729] -- 0:00:45

      Average standard deviation of split frequencies: 0.024113

      260500 -- [-606.759] (-602.950) (-605.418) (-604.070) * (-603.025) (-608.264) [-603.775] (-604.295) -- 0:00:45
      261000 -- (-604.715) [-604.188] (-604.546) (-605.910) * (-605.779) (-603.112) [-607.365] (-603.994) -- 0:00:45
      261500 -- (-605.092) [-604.419] (-603.804) (-605.787) * [-602.618] (-602.493) (-606.440) (-607.587) -- 0:00:45
      262000 -- (-603.680) (-603.122) (-604.587) [-605.103] * [-605.718] (-603.957) (-603.323) (-603.795) -- 0:00:45
      262500 -- (-604.196) [-603.063] (-602.553) (-603.915) * [-608.023] (-607.574) (-602.092) (-603.217) -- 0:00:47
      263000 -- (-603.787) (-603.640) (-603.705) [-604.698] * [-602.658] (-603.823) (-603.538) (-604.479) -- 0:00:47
      263500 -- [-603.544] (-602.496) (-607.258) (-604.118) * [-604.028] (-603.005) (-602.916) (-603.252) -- 0:00:47
      264000 -- (-604.232) [-602.162] (-603.325) (-609.709) * [-602.988] (-604.090) (-604.074) (-602.885) -- 0:00:47
      264500 -- (-604.985) [-606.480] (-602.747) (-606.870) * [-604.585] (-603.364) (-604.646) (-602.986) -- 0:00:47
      265000 -- [-603.363] (-602.638) (-603.203) (-604.945) * (-604.122) (-608.082) (-604.967) [-602.428] -- 0:00:47

      Average standard deviation of split frequencies: 0.023412

      265500 -- [-602.754] (-605.398) (-604.202) (-603.875) * (-606.001) (-605.054) (-602.208) [-604.299] -- 0:00:47
      266000 -- (-603.374) (-605.916) (-602.939) [-602.281] * (-605.113) (-606.082) [-602.768] (-605.318) -- 0:00:46
      266500 -- (-611.373) [-602.397] (-603.940) (-602.856) * (-603.038) (-602.447) (-604.685) [-603.360] -- 0:00:46
      267000 -- (-611.322) (-602.219) [-603.149] (-602.745) * [-604.700] (-603.168) (-603.937) (-603.242) -- 0:00:46
      267500 -- [-605.452] (-602.870) (-602.382) (-604.010) * (-606.072) (-608.156) [-605.761] (-602.636) -- 0:00:46
      268000 -- (-605.561) (-602.794) (-603.720) [-602.994] * [-603.420] (-606.642) (-602.621) (-603.450) -- 0:00:46
      268500 -- (-603.866) [-603.320] (-604.302) (-602.308) * (-605.728) [-603.447] (-602.324) (-603.896) -- 0:00:46
      269000 -- [-604.160] (-603.671) (-605.735) (-604.249) * (-606.117) [-604.749] (-607.769) (-603.926) -- 0:00:46
      269500 -- (-602.672) (-603.156) [-603.255] (-604.173) * (-605.887) (-605.307) (-603.098) [-604.168] -- 0:00:46
      270000 -- (-607.015) (-604.624) [-604.956] (-604.629) * [-602.886] (-602.395) (-605.080) (-603.700) -- 0:00:45

      Average standard deviation of split frequencies: 0.022183

      270500 -- (-606.538) (-605.093) (-603.963) [-605.254] * (-602.275) (-608.883) [-609.154] (-608.337) -- 0:00:45
      271000 -- (-602.474) (-602.693) [-606.962] (-602.020) * [-602.640] (-605.207) (-603.291) (-605.421) -- 0:00:45
      271500 -- (-602.345) [-605.868] (-604.470) (-603.796) * (-603.998) (-602.849) (-602.877) [-602.881] -- 0:00:45
      272000 -- (-604.348) (-602.996) (-604.536) [-602.985] * [-603.396] (-604.550) (-608.386) (-605.765) -- 0:00:45
      272500 -- (-606.099) (-603.671) (-605.582) [-603.949] * (-603.038) [-604.573] (-604.724) (-602.985) -- 0:00:45
      273000 -- (-603.340) [-603.212] (-602.522) (-606.270) * (-603.978) [-602.607] (-605.220) (-604.871) -- 0:00:45
      273500 -- [-603.146] (-603.754) (-602.604) (-604.613) * (-605.538) (-603.180) [-603.769] (-602.620) -- 0:00:45
      274000 -- (-603.277) (-603.193) (-602.647) [-606.453] * (-606.401) (-604.894) (-604.981) [-607.146] -- 0:00:45
      274500 -- (-603.324) (-603.309) (-603.591) [-603.745] * (-604.988) [-603.640] (-606.204) (-605.866) -- 0:00:44
      275000 -- (-603.282) (-607.761) (-605.529) [-603.074] * (-604.012) (-604.223) [-603.284] (-602.825) -- 0:00:44

      Average standard deviation of split frequencies: 0.022204

      275500 -- (-603.298) (-604.796) (-603.439) [-604.950] * (-604.541) (-606.234) (-605.798) [-603.411] -- 0:00:44
      276000 -- (-603.170) (-604.273) [-604.862] (-603.784) * (-606.789) (-605.000) [-602.492] (-604.244) -- 0:00:44
      276500 -- (-605.153) (-604.247) (-602.515) [-603.291] * [-605.149] (-603.495) (-602.638) (-601.909) -- 0:00:44
      277000 -- (-602.763) [-602.196] (-606.892) (-605.388) * [-602.776] (-603.636) (-603.642) (-605.530) -- 0:00:44
      277500 -- (-602.891) (-603.153) (-606.538) [-604.276] * (-609.492) (-606.552) [-604.742] (-603.893) -- 0:00:44
      278000 -- (-603.490) (-607.837) [-602.824] (-602.837) * (-603.691) [-607.533] (-604.743) (-603.694) -- 0:00:44
      278500 -- [-607.461] (-614.581) (-603.800) (-603.858) * (-603.279) (-605.125) (-606.344) [-602.533] -- 0:00:44
      279000 -- [-604.355] (-606.292) (-605.079) (-605.521) * (-602.993) [-604.202] (-603.132) (-603.442) -- 0:00:43
      279500 -- (-607.340) [-603.330] (-604.962) (-604.867) * (-603.199) [-608.437] (-602.595) (-603.853) -- 0:00:46
      280000 -- (-602.859) (-606.848) (-605.970) [-603.851] * (-602.804) (-605.527) [-604.243] (-603.517) -- 0:00:46

      Average standard deviation of split frequencies: 0.022100

      280500 -- (-602.160) [-604.626] (-603.787) (-604.065) * [-603.209] (-602.722) (-605.292) (-605.468) -- 0:00:46
      281000 -- (-603.792) (-604.124) (-606.399) [-602.503] * (-605.263) (-604.489) [-604.725] (-605.736) -- 0:00:46
      281500 -- [-602.994] (-604.102) (-603.559) (-603.507) * (-605.259) (-601.905) (-603.177) [-604.941] -- 0:00:45
      282000 -- (-602.979) (-605.495) (-604.179) [-605.856] * (-608.905) [-605.621] (-606.166) (-606.069) -- 0:00:45
      282500 -- (-603.810) (-605.790) [-604.688] (-604.604) * (-605.759) [-603.229] (-604.190) (-608.864) -- 0:00:45
      283000 -- [-602.888] (-603.769) (-602.753) (-607.022) * (-603.055) (-609.403) [-604.858] (-608.716) -- 0:00:45
      283500 -- (-604.269) (-602.944) [-603.573] (-604.722) * (-604.041) (-608.402) [-605.157] (-605.301) -- 0:00:45
      284000 -- [-604.761] (-602.487) (-604.521) (-605.206) * (-603.502) (-604.156) [-608.798] (-608.961) -- 0:00:45
      284500 -- (-604.922) (-605.840) [-603.589] (-605.129) * [-605.126] (-605.001) (-606.186) (-611.348) -- 0:00:45
      285000 -- [-604.916] (-606.415) (-605.829) (-605.372) * (-608.061) [-607.535] (-603.591) (-606.528) -- 0:00:45

      Average standard deviation of split frequencies: 0.022208

      285500 -- (-602.709) (-606.964) [-604.640] (-606.879) * (-604.372) (-610.338) [-603.720] (-605.105) -- 0:00:45
      286000 -- [-603.591] (-604.848) (-603.375) (-605.208) * (-605.671) (-607.905) [-605.165] (-603.100) -- 0:00:44
      286500 -- (-605.427) (-603.220) (-604.678) [-602.792] * [-604.358] (-603.194) (-606.547) (-603.455) -- 0:00:44
      287000 -- [-602.223] (-603.829) (-603.927) (-604.455) * (-603.487) [-605.983] (-604.257) (-603.388) -- 0:00:44
      287500 -- (-603.304) (-605.755) [-604.136] (-604.323) * (-606.627) [-605.905] (-604.292) (-605.410) -- 0:00:44
      288000 -- (-603.972) (-605.012) (-605.212) [-604.215] * (-603.890) [-603.967] (-605.123) (-603.952) -- 0:00:44
      288500 -- (-603.351) (-603.548) (-602.588) [-603.738] * (-606.669) [-604.508] (-603.249) (-604.986) -- 0:00:44
      289000 -- (-603.304) (-609.630) [-606.298] (-605.505) * (-603.113) (-603.642) [-602.582] (-603.923) -- 0:00:44
      289500 -- (-605.416) (-603.126) [-603.816] (-603.972) * (-604.396) (-603.477) [-604.973] (-602.188) -- 0:00:44
      290000 -- (-605.380) (-602.219) (-603.744) [-605.809] * (-604.986) (-603.599) [-603.209] (-602.609) -- 0:00:44

      Average standard deviation of split frequencies: 0.022615

      290500 -- (-602.815) (-606.780) [-602.476] (-603.454) * (-607.331) [-603.762] (-603.693) (-601.899) -- 0:00:43
      291000 -- (-604.336) [-603.853] (-605.925) (-604.712) * (-603.942) [-604.277] (-605.743) (-601.903) -- 0:00:43
      291500 -- (-607.425) (-604.642) [-608.231] (-605.183) * (-605.538) [-602.846] (-603.262) (-603.710) -- 0:00:43
      292000 -- (-605.866) (-603.982) (-606.249) [-605.450] * (-605.004) [-605.867] (-604.758) (-606.468) -- 0:00:43
      292500 -- [-604.441] (-602.241) (-603.485) (-605.984) * (-605.186) [-605.143] (-602.298) (-602.830) -- 0:00:43
      293000 -- (-603.223) [-602.631] (-608.595) (-603.169) * (-605.318) (-604.230) [-607.436] (-607.469) -- 0:00:43
      293500 -- (-604.751) (-604.305) (-603.163) [-607.243] * (-608.267) [-604.451] (-603.358) (-603.773) -- 0:00:43
      294000 -- (-608.272) (-604.672) [-606.195] (-604.203) * (-605.992) (-602.498) [-604.722] (-603.491) -- 0:00:43
      294500 -- (-607.773) [-602.481] (-602.309) (-602.617) * (-602.027) (-603.625) (-604.554) [-603.001] -- 0:00:43
      295000 -- (-606.007) [-605.946] (-604.506) (-602.438) * (-610.626) (-605.249) (-603.834) [-602.262] -- 0:00:43

      Average standard deviation of split frequencies: 0.022031

      295500 -- [-606.703] (-602.189) (-604.350) (-604.182) * [-604.106] (-605.453) (-604.578) (-604.431) -- 0:00:42
      296000 -- [-602.639] (-603.853) (-608.326) (-605.261) * (-603.536) (-606.446) [-602.847] (-604.609) -- 0:00:45
      296500 -- (-607.885) (-602.209) (-609.230) [-605.180] * (-603.084) (-608.542) (-602.127) [-602.426] -- 0:00:45
      297000 -- (-602.413) [-601.840] (-606.957) (-602.901) * (-602.864) (-605.732) (-603.702) [-602.552] -- 0:00:44
      297500 -- (-607.353) (-603.890) (-607.087) [-603.670] * (-607.611) (-606.007) [-607.910] (-605.520) -- 0:00:44
      298000 -- (-606.897) [-603.222] (-603.786) (-602.559) * (-605.791) [-602.152] (-603.555) (-604.310) -- 0:00:44
      298500 -- (-603.481) [-604.407] (-604.667) (-603.089) * (-603.969) [-604.880] (-602.208) (-608.082) -- 0:00:44
      299000 -- (-606.132) (-602.298) [-604.367] (-609.003) * [-608.538] (-604.996) (-602.216) (-605.136) -- 0:00:44
      299500 -- (-603.810) [-604.211] (-603.901) (-603.303) * [-603.119] (-605.128) (-601.976) (-604.434) -- 0:00:44
      300000 -- (-604.666) (-604.627) (-607.428) [-603.198] * [-602.838] (-602.690) (-605.944) (-602.836) -- 0:00:44

      Average standard deviation of split frequencies: 0.019947

      300500 -- (-603.060) (-604.552) (-605.802) [-607.187] * (-604.784) (-604.069) [-603.144] (-603.792) -- 0:00:44
      301000 -- (-604.400) (-602.792) (-603.431) [-604.618] * (-603.541) (-608.195) [-603.545] (-602.895) -- 0:00:44
      301500 -- (-604.190) [-602.501] (-604.137) (-604.687) * (-611.523) (-605.705) (-602.310) [-604.427] -- 0:00:44
      302000 -- [-602.074] (-602.151) (-603.999) (-606.036) * (-603.983) (-602.830) [-603.457] (-603.633) -- 0:00:43
      302500 -- (-602.379) [-604.803] (-603.502) (-604.587) * (-603.498) (-603.626) [-602.358] (-609.440) -- 0:00:43
      303000 -- (-603.097) (-606.381) [-604.857] (-603.041) * (-607.524) [-605.211] (-604.475) (-605.633) -- 0:00:43
      303500 -- (-605.565) (-604.212) [-603.537] (-604.375) * (-606.602) (-603.766) [-602.353] (-606.982) -- 0:00:43
      304000 -- (-602.749) [-604.312] (-604.100) (-606.565) * [-603.405] (-608.085) (-609.063) (-606.715) -- 0:00:43
      304500 -- (-604.579) (-604.597) (-603.694) [-607.381] * (-604.070) (-604.178) (-607.409) [-606.051] -- 0:00:43
      305000 -- (-605.657) [-605.337] (-603.915) (-602.385) * (-604.414) [-603.733] (-605.757) (-607.924) -- 0:00:43

      Average standard deviation of split frequencies: 0.019856

      305500 -- [-602.962] (-604.783) (-604.140) (-602.666) * (-601.723) (-603.913) (-604.289) [-607.117] -- 0:00:43
      306000 -- (-604.554) [-602.617] (-608.342) (-603.690) * (-602.948) (-603.074) [-602.805] (-608.002) -- 0:00:43
      306500 -- (-604.657) (-602.262) (-604.999) [-602.573] * (-604.956) [-604.275] (-602.423) (-604.091) -- 0:00:42
      307000 -- [-602.274] (-602.590) (-605.267) (-602.604) * (-604.537) (-602.326) (-602.176) [-605.770] -- 0:00:42
      307500 -- (-605.756) (-603.634) [-603.844] (-605.342) * (-602.899) (-602.760) [-602.908] (-603.823) -- 0:00:42
      308000 -- (-603.714) (-603.393) [-602.021] (-604.466) * (-603.909) (-605.493) (-610.115) [-605.546] -- 0:00:42
      308500 -- (-602.448) (-602.676) (-608.060) [-603.330] * (-604.315) [-603.893] (-602.888) (-605.918) -- 0:00:42
      309000 -- (-604.790) [-604.478] (-605.380) (-602.463) * (-607.469) [-605.613] (-604.243) (-603.675) -- 0:00:42
      309500 -- (-604.357) [-602.645] (-603.298) (-606.801) * (-606.099) [-604.854] (-607.531) (-606.771) -- 0:00:42
      310000 -- (-603.580) (-602.649) [-602.180] (-604.113) * [-607.193] (-602.596) (-604.741) (-604.225) -- 0:00:42

      Average standard deviation of split frequencies: 0.019810

      310500 -- (-609.884) [-602.379] (-603.517) (-603.480) * (-602.877) (-603.675) [-602.869] (-609.198) -- 0:00:42
      311000 -- [-602.491] (-602.677) (-602.727) (-609.645) * [-602.201] (-609.651) (-603.082) (-606.392) -- 0:00:42
      311500 -- (-603.213) (-605.856) (-604.066) [-602.014] * (-603.752) (-608.722) [-603.273] (-606.599) -- 0:00:41
      312000 -- (-603.612) (-604.833) (-603.474) [-607.090] * (-604.411) (-605.951) [-605.148] (-605.179) -- 0:00:41
      312500 -- [-603.472] (-604.766) (-603.856) (-602.767) * (-604.004) (-604.493) (-603.027) [-602.938] -- 0:00:41
      313000 -- (-604.805) [-603.569] (-604.306) (-604.373) * (-602.983) (-607.338) (-603.752) [-602.451] -- 0:00:43
      313500 -- (-605.774) (-604.857) [-606.425] (-603.109) * (-602.513) (-604.201) (-603.774) [-603.763] -- 0:00:43
      314000 -- (-605.632) (-607.320) (-604.366) [-603.810] * [-606.056] (-603.502) (-602.775) (-602.186) -- 0:00:43
      314500 -- (-603.887) (-603.396) (-604.428) [-603.676] * (-602.541) (-602.559) (-602.156) [-602.098] -- 0:00:43
      315000 -- (-603.293) (-602.643) [-604.301] (-604.423) * (-603.360) (-603.525) [-605.346] (-604.799) -- 0:00:43

      Average standard deviation of split frequencies: 0.018979

      315500 -- (-606.983) [-608.537] (-605.530) (-607.038) * (-602.989) (-603.294) [-603.563] (-602.671) -- 0:00:43
      316000 -- (-606.527) [-603.287] (-608.930) (-602.684) * [-603.513] (-603.520) (-607.086) (-605.412) -- 0:00:43
      316500 -- (-605.834) (-603.696) [-607.356] (-603.261) * (-603.420) (-604.434) (-604.777) [-605.002] -- 0:00:43
      317000 -- (-602.735) [-602.748] (-603.326) (-601.784) * (-607.019) (-605.079) [-604.585] (-604.034) -- 0:00:43
      317500 -- (-603.842) (-604.562) [-604.431] (-602.028) * [-605.035] (-607.704) (-604.940) (-604.964) -- 0:00:42
      318000 -- (-606.521) (-602.746) (-605.278) [-605.286] * (-604.710) (-605.745) [-602.603] (-603.838) -- 0:00:42
      318500 -- [-603.801] (-602.774) (-603.008) (-604.838) * (-602.668) [-604.832] (-604.454) (-603.872) -- 0:00:42
      319000 -- (-609.826) (-606.417) (-604.067) [-602.328] * (-601.860) (-603.350) [-602.811] (-604.149) -- 0:00:42
      319500 -- [-608.371] (-606.198) (-602.983) (-607.292) * (-604.151) (-602.358) (-606.638) [-606.434] -- 0:00:42
      320000 -- (-603.084) (-604.281) (-604.352) [-606.759] * (-602.593) (-606.543) [-604.211] (-602.735) -- 0:00:42

      Average standard deviation of split frequencies: 0.018213

      320500 -- (-607.652) (-602.313) (-606.112) [-605.672] * (-603.193) (-604.142) [-604.913] (-603.432) -- 0:00:42
      321000 -- (-606.272) (-605.633) (-611.868) [-604.402] * (-604.021) (-603.036) (-604.635) [-603.338] -- 0:00:42
      321500 -- (-602.897) (-604.001) (-607.385) [-602.083] * [-603.640] (-602.221) (-604.035) (-604.891) -- 0:00:42
      322000 -- (-602.855) [-602.171] (-606.357) (-604.862) * (-603.237) (-604.916) [-601.949] (-604.186) -- 0:00:42
      322500 -- (-605.548) (-604.557) (-603.798) [-604.357] * (-602.906) (-607.738) [-603.623] (-603.607) -- 0:00:42
      323000 -- [-604.735] (-605.071) (-605.230) (-604.558) * (-604.303) (-608.959) [-608.617] (-604.259) -- 0:00:41
      323500 -- (-608.578) [-605.732] (-604.461) (-603.340) * (-606.808) (-606.135) (-606.284) [-602.650] -- 0:00:41
      324000 -- (-608.058) (-602.949) [-603.245] (-603.247) * (-605.478) (-604.949) (-609.978) [-602.492] -- 0:00:41
      324500 -- (-607.157) (-603.059) [-604.678] (-610.417) * [-605.708] (-606.158) (-605.605) (-602.892) -- 0:00:41
      325000 -- (-607.097) (-604.308) (-607.716) [-604.653] * [-603.916] (-604.099) (-604.684) (-607.043) -- 0:00:41

      Average standard deviation of split frequencies: 0.018638

      325500 -- (-602.364) (-603.578) [-604.928] (-603.449) * (-602.886) [-602.052] (-602.711) (-604.162) -- 0:00:41
      326000 -- [-604.226] (-602.619) (-603.078) (-604.108) * (-606.784) [-610.189] (-603.471) (-602.924) -- 0:00:41
      326500 -- [-603.695] (-602.551) (-604.756) (-603.947) * (-604.458) (-610.205) (-603.961) [-602.546] -- 0:00:41
      327000 -- [-602.473] (-602.194) (-604.380) (-603.012) * (-602.894) (-603.735) (-601.967) [-602.132] -- 0:00:41
      327500 -- [-603.383] (-603.436) (-603.293) (-602.387) * (-604.985) (-604.468) (-614.385) [-602.841] -- 0:00:41
      328000 -- (-604.146) [-604.596] (-602.338) (-602.728) * (-607.912) [-604.748] (-615.540) (-605.765) -- 0:00:40
      328500 -- (-605.540) (-606.022) (-602.451) [-603.656] * (-604.601) (-610.579) [-605.812] (-606.819) -- 0:00:40
      329000 -- [-602.593] (-604.032) (-601.743) (-603.169) * (-607.211) [-603.882] (-604.325) (-604.352) -- 0:00:42
      329500 -- (-602.564) (-603.997) (-607.825) [-606.109] * (-602.814) (-605.971) [-604.611] (-607.424) -- 0:00:42
      330000 -- (-604.865) (-605.539) [-606.877] (-605.237) * (-605.854) (-602.477) (-602.667) [-603.753] -- 0:00:42

      Average standard deviation of split frequencies: 0.017345

      330500 -- (-603.245) (-603.882) (-606.058) [-602.893] * (-608.381) [-605.151] (-602.388) (-609.973) -- 0:00:42
      331000 -- [-605.613] (-603.191) (-606.258) (-604.847) * (-603.881) [-605.684] (-603.413) (-607.734) -- 0:00:42
      331500 -- (-607.797) (-603.149) [-605.483] (-607.626) * (-602.734) [-606.565] (-605.407) (-602.150) -- 0:00:42
      332000 -- (-603.110) (-605.099) (-607.678) [-603.704] * (-602.665) (-611.664) [-604.212] (-602.530) -- 0:00:42
      332500 -- (-608.557) (-602.466) (-603.010) [-605.309] * (-602.449) (-607.644) [-603.977] (-603.587) -- 0:00:42
      333000 -- (-606.999) (-603.416) (-607.536) [-602.867] * (-604.367) (-606.089) (-604.225) [-602.607] -- 0:00:42
      333500 -- (-607.164) (-604.128) (-605.441) [-603.315] * (-607.543) (-605.512) (-602.856) [-604.459] -- 0:00:41
      334000 -- (-603.058) (-604.094) (-603.778) [-603.341] * (-607.158) (-603.195) (-610.695) [-604.855] -- 0:00:41
      334500 -- (-606.097) [-605.153] (-603.365) (-606.292) * [-605.761] (-605.784) (-606.559) (-609.764) -- 0:00:41
      335000 -- (-608.530) (-603.093) (-606.869) [-605.804] * (-605.901) (-605.997) (-604.496) [-608.190] -- 0:00:41

      Average standard deviation of split frequencies: 0.016836

      335500 -- (-610.661) (-607.799) (-611.308) [-604.926] * [-603.145] (-605.197) (-605.351) (-604.937) -- 0:00:41
      336000 -- (-609.720) [-601.960] (-610.356) (-604.084) * (-606.049) (-602.379) (-603.530) [-602.554] -- 0:00:41
      336500 -- (-603.518) (-604.334) (-603.579) [-605.891] * (-602.526) [-604.079] (-604.479) (-603.514) -- 0:00:41
      337000 -- (-603.640) [-607.435] (-604.534) (-605.132) * (-605.347) (-603.197) (-602.826) [-605.423] -- 0:00:41
      337500 -- (-603.210) [-605.036] (-606.054) (-603.810) * (-602.254) (-602.831) [-603.237] (-606.833) -- 0:00:41
      338000 -- (-606.549) (-604.557) (-603.916) [-603.412] * (-603.198) (-606.516) [-608.366] (-610.218) -- 0:00:41
      338500 -- [-605.108] (-606.812) (-604.535) (-604.493) * (-602.634) (-607.573) [-603.645] (-605.602) -- 0:00:41
      339000 -- (-603.699) [-604.595] (-603.132) (-605.126) * (-608.008) (-604.381) (-605.152) [-604.048] -- 0:00:40
      339500 -- (-603.681) [-606.690] (-605.485) (-606.585) * (-605.234) (-603.307) (-602.386) [-603.162] -- 0:00:40
      340000 -- (-605.412) (-605.418) [-603.973] (-606.501) * (-605.415) (-603.910) (-604.627) [-605.171] -- 0:00:40

      Average standard deviation of split frequencies: 0.015990

      340500 -- (-608.632) (-604.684) (-602.640) [-602.567] * [-605.650] (-607.382) (-602.117) (-603.417) -- 0:00:40
      341000 -- (-604.469) (-606.143) (-605.501) [-603.651] * (-605.649) (-609.238) [-606.996] (-606.761) -- 0:00:40
      341500 -- (-604.943) (-603.100) [-603.959] (-603.928) * (-606.510) [-605.734] (-605.889) (-606.783) -- 0:00:40
      342000 -- [-604.556] (-603.078) (-603.363) (-605.656) * (-605.402) (-605.267) [-606.635] (-602.464) -- 0:00:40
      342500 -- (-603.813) [-605.011] (-603.228) (-607.820) * (-604.076) (-606.135) [-602.377] (-603.892) -- 0:00:40
      343000 -- (-604.587) (-608.279) [-606.863] (-603.095) * [-603.089] (-604.476) (-603.797) (-604.596) -- 0:00:40
      343500 -- (-604.523) (-607.805) (-604.463) [-602.374] * [-602.515] (-603.856) (-604.642) (-604.477) -- 0:00:40
      344000 -- (-603.325) [-605.132] (-605.469) (-603.235) * (-604.541) (-603.752) [-602.884] (-602.796) -- 0:00:40
      344500 -- (-603.724) (-609.277) (-602.833) [-603.271] * [-603.963] (-605.548) (-603.362) (-602.510) -- 0:00:39
      345000 -- (-603.171) (-602.667) [-603.919] (-604.003) * (-605.890) [-604.657] (-605.092) (-604.162) -- 0:00:41

      Average standard deviation of split frequencies: 0.015214

      345500 -- [-603.865] (-602.746) (-603.876) (-602.573) * [-603.342] (-604.059) (-604.275) (-605.755) -- 0:00:41
      346000 -- (-604.674) [-602.710] (-608.254) (-602.074) * (-608.197) (-602.913) (-605.588) [-603.432] -- 0:00:41
      346500 -- (-603.279) (-603.905) (-603.574) [-604.205] * [-603.165] (-604.104) (-603.058) (-604.398) -- 0:00:41
      347000 -- (-604.459) (-609.179) [-602.428] (-605.084) * [-603.633] (-603.665) (-604.092) (-603.674) -- 0:00:41
      347500 -- (-603.246) [-602.362] (-606.501) (-604.238) * [-603.925] (-603.978) (-607.321) (-604.363) -- 0:00:41
      348000 -- (-602.346) (-602.886) (-604.115) [-606.399] * [-603.066] (-603.536) (-605.248) (-604.881) -- 0:00:41
      348500 -- (-603.041) (-604.923) (-603.418) [-604.668] * (-607.303) [-603.181] (-603.969) (-604.357) -- 0:00:41
      349000 -- (-603.170) (-604.170) [-603.018] (-606.667) * [-607.189] (-602.501) (-611.367) (-603.469) -- 0:00:41
      349500 -- [-602.752] (-604.938) (-612.936) (-603.571) * (-610.267) (-605.767) (-604.797) [-602.624] -- 0:00:40
      350000 -- (-602.678) (-604.170) (-608.973) [-603.100] * (-606.005) (-604.112) [-602.982] (-602.586) -- 0:00:40

      Average standard deviation of split frequencies: 0.015236

      350500 -- (-602.309) [-603.626] (-602.623) (-603.635) * (-608.184) [-607.337] (-604.998) (-603.850) -- 0:00:40
      351000 -- [-602.497] (-603.867) (-602.829) (-605.261) * (-603.890) [-602.641] (-603.032) (-603.160) -- 0:00:40
      351500 -- (-602.806) [-606.201] (-606.423) (-606.602) * [-602.760] (-603.952) (-602.992) (-605.832) -- 0:00:40
      352000 -- (-602.844) (-606.462) (-604.222) [-605.843] * (-603.338) [-603.423] (-604.064) (-605.979) -- 0:00:40
      352500 -- (-605.236) (-607.606) [-605.313] (-605.192) * [-603.684] (-602.072) (-604.918) (-603.418) -- 0:00:40
      353000 -- (-602.589) (-607.023) (-602.281) [-602.602] * (-603.077) (-602.908) (-604.395) [-601.983] -- 0:00:40
      353500 -- (-605.755) [-607.713] (-605.216) (-603.560) * (-608.392) (-603.777) [-603.766] (-602.662) -- 0:00:40
      354000 -- (-606.052) [-605.561] (-602.238) (-603.622) * (-602.774) (-602.966) [-608.922] (-603.542) -- 0:00:40
      354500 -- (-602.896) (-605.459) (-602.834) [-603.859] * (-604.892) (-604.239) (-607.421) [-605.745] -- 0:00:40
      355000 -- (-603.394) [-602.898] (-603.779) (-602.703) * (-602.386) (-607.390) (-605.394) [-604.697] -- 0:00:39

      Average standard deviation of split frequencies: 0.015669

      355500 -- (-603.181) (-602.720) (-610.736) [-603.211] * (-602.039) (-603.281) [-607.990] (-605.029) -- 0:00:39
      356000 -- (-605.272) (-603.624) [-605.243] (-606.630) * (-605.736) (-603.364) (-605.340) [-607.337] -- 0:00:39
      356500 -- (-604.696) [-606.538] (-607.391) (-602.864) * (-607.071) [-604.649] (-605.089) (-606.155) -- 0:00:39
      357000 -- [-605.609] (-605.482) (-606.509) (-605.641) * (-607.470) (-606.001) [-603.085] (-604.327) -- 0:00:39
      357500 -- (-607.090) (-604.897) [-605.734] (-602.416) * (-602.323) [-603.145] (-609.279) (-603.824) -- 0:00:39
      358000 -- (-607.993) [-605.804] (-604.065) (-604.034) * (-604.984) [-603.253] (-602.693) (-604.599) -- 0:00:39
      358500 -- [-606.696] (-606.121) (-606.894) (-606.195) * [-602.107] (-602.680) (-604.952) (-606.943) -- 0:00:39
      359000 -- (-603.362) (-604.455) [-602.758] (-605.912) * (-605.001) (-605.221) (-602.678) [-602.129] -- 0:00:39
      359500 -- [-603.098] (-604.561) (-603.557) (-603.794) * (-605.256) [-606.574] (-606.579) (-605.854) -- 0:00:39
      360000 -- (-603.564) (-605.414) [-602.981] (-603.187) * (-604.839) (-602.488) [-607.566] (-603.168) -- 0:00:39

      Average standard deviation of split frequencies: 0.015757

      360500 -- (-602.464) [-604.214] (-603.949) (-604.361) * (-607.964) (-606.978) [-605.975] (-603.127) -- 0:00:39
      361000 -- (-602.668) [-604.138] (-609.490) (-607.007) * (-605.921) [-607.190] (-603.095) (-605.242) -- 0:00:38
      361500 -- (-604.101) (-602.928) [-603.945] (-604.279) * (-603.791) [-604.563] (-605.011) (-605.477) -- 0:00:38
      362000 -- [-602.937] (-604.579) (-605.030) (-605.619) * (-602.289) [-608.921] (-602.245) (-601.949) -- 0:00:40
      362500 -- (-603.368) (-606.566) [-605.536] (-607.744) * (-605.125) [-603.108] (-605.000) (-602.594) -- 0:00:40
      363000 -- (-604.847) (-602.481) [-604.377] (-603.756) * (-606.779) (-603.260) [-603.935] (-603.131) -- 0:00:40
      363500 -- [-603.508] (-612.135) (-603.657) (-601.947) * (-606.976) (-603.696) [-606.080] (-604.339) -- 0:00:40
      364000 -- (-602.447) (-603.412) [-610.052] (-603.490) * (-603.681) [-602.237] (-603.848) (-604.214) -- 0:00:40
      364500 -- [-601.873] (-603.538) (-604.557) (-605.308) * (-604.228) (-603.496) [-604.843] (-603.274) -- 0:00:40
      365000 -- (-601.856) [-602.479] (-603.032) (-602.934) * (-604.701) (-602.815) [-605.554] (-605.951) -- 0:00:40

      Average standard deviation of split frequencies: 0.015599

      365500 -- (-603.229) (-602.002) [-604.085] (-604.746) * (-606.410) [-607.448] (-604.700) (-607.188) -- 0:00:39
      366000 -- [-602.719] (-608.959) (-604.474) (-604.390) * (-607.374) (-604.995) (-604.584) [-604.945] -- 0:00:39
      366500 -- (-606.880) (-605.184) [-604.670] (-602.560) * [-604.056] (-602.486) (-607.487) (-606.090) -- 0:00:39
      367000 -- (-605.928) [-603.222] (-605.195) (-603.134) * (-606.129) [-602.104] (-607.378) (-602.786) -- 0:00:39
      367500 -- [-603.174] (-602.696) (-604.233) (-603.438) * [-602.886] (-604.332) (-608.413) (-604.086) -- 0:00:39
      368000 -- (-603.358) (-605.063) (-602.657) [-603.266] * (-602.231) [-604.242] (-604.107) (-604.055) -- 0:00:39
      368500 -- [-603.523] (-603.344) (-603.937) (-605.104) * (-602.162) (-604.326) (-605.682) [-602.370] -- 0:00:39
      369000 -- (-605.769) (-603.084) (-604.687) [-605.917] * (-602.185) (-607.186) [-606.219] (-606.575) -- 0:00:39
      369500 -- [-605.358] (-605.317) (-606.683) (-606.967) * [-602.355] (-604.027) (-605.870) (-605.638) -- 0:00:39
      370000 -- (-604.353) (-604.129) (-605.847) [-605.096] * (-602.867) (-606.009) [-605.866] (-604.265) -- 0:00:39

      Average standard deviation of split frequencies: 0.015544

      370500 -- (-603.480) (-603.958) (-605.121) [-606.254] * (-602.473) (-609.925) [-604.609] (-608.957) -- 0:00:39
      371000 -- (-605.172) [-605.285] (-603.370) (-605.472) * (-602.444) (-603.394) (-604.413) [-606.589] -- 0:00:38
      371500 -- (-604.313) (-606.475) (-604.463) [-604.053] * [-602.913] (-604.139) (-605.503) (-606.417) -- 0:00:38
      372000 -- (-604.331) (-603.236) [-604.325] (-605.758) * (-602.542) (-605.291) (-604.368) [-606.571] -- 0:00:38
      372500 -- (-602.219) (-603.967) (-606.253) [-602.893] * (-604.722) (-605.903) [-602.999] (-605.046) -- 0:00:38
      373000 -- (-605.784) (-605.347) [-603.354] (-602.947) * (-605.624) (-609.060) [-603.463] (-602.422) -- 0:00:38
      373500 -- (-603.563) [-604.178] (-604.694) (-604.481) * (-606.290) (-603.317) [-603.544] (-604.380) -- 0:00:38
      374000 -- (-602.855) (-603.435) [-603.239] (-604.438) * (-603.538) (-608.758) (-606.930) [-602.309] -- 0:00:38
      374500 -- (-603.015) (-603.177) (-602.655) [-604.417] * (-603.498) [-605.279] (-608.057) (-605.724) -- 0:00:38
      375000 -- (-605.284) (-602.699) (-606.091) [-606.155] * (-606.743) (-603.574) (-604.725) [-604.356] -- 0:00:38

      Average standard deviation of split frequencies: 0.016716

      375500 -- [-602.860] (-603.443) (-605.033) (-603.130) * (-603.479) (-607.740) (-605.506) [-605.299] -- 0:00:38
      376000 -- (-605.942) [-605.861] (-606.220) (-604.580) * (-606.687) (-607.977) [-603.946] (-602.323) -- 0:00:38
      376500 -- (-604.970) (-603.292) (-603.458) [-606.155] * (-605.226) (-606.943) [-603.957] (-601.857) -- 0:00:38
      377000 -- (-604.858) (-602.798) (-602.266) [-604.393] * (-603.310) [-603.956] (-604.193) (-606.745) -- 0:00:38
      377500 -- (-603.407) (-602.921) (-603.845) [-602.597] * (-608.239) [-604.268] (-605.721) (-602.921) -- 0:00:37
      378000 -- (-604.708) (-603.939) [-603.537] (-602.708) * (-607.767) [-605.104] (-603.514) (-602.713) -- 0:00:37
      378500 -- (-604.132) [-602.195] (-603.387) (-605.599) * [-602.330] (-606.513) (-602.441) (-603.814) -- 0:00:39
      379000 -- [-605.940] (-608.537) (-603.168) (-602.763) * (-603.356) (-606.165) [-603.813] (-605.764) -- 0:00:39
      379500 -- (-606.988) (-604.084) (-605.174) [-602.375] * (-603.212) [-606.682] (-604.802) (-602.433) -- 0:00:39
      380000 -- (-603.145) (-603.326) [-604.922] (-607.288) * [-606.943] (-602.656) (-607.275) (-604.116) -- 0:00:39

      Average standard deviation of split frequencies: 0.016305

      380500 -- [-603.489] (-602.810) (-602.352) (-606.981) * [-606.318] (-604.433) (-605.113) (-602.815) -- 0:00:39
      381000 -- (-605.080) (-602.833) (-603.860) [-603.498] * (-604.163) [-607.650] (-602.619) (-602.253) -- 0:00:38
      381500 -- [-602.977] (-604.455) (-603.165) (-604.598) * [-603.507] (-607.702) (-603.172) (-605.736) -- 0:00:38
      382000 -- (-604.246) (-605.579) [-602.990] (-603.463) * (-605.269) (-604.315) (-604.254) [-604.698] -- 0:00:38
      382500 -- [-602.564] (-603.375) (-605.007) (-603.970) * (-603.845) [-602.560] (-605.503) (-603.272) -- 0:00:38
      383000 -- (-602.590) (-604.478) [-603.365] (-603.020) * (-602.958) [-603.007] (-604.827) (-606.348) -- 0:00:38
      383500 -- [-605.457] (-603.097) (-603.685) (-606.064) * (-604.880) (-605.296) [-605.754] (-603.653) -- 0:00:38
      384000 -- (-602.976) (-602.468) [-604.595] (-603.267) * (-604.415) (-604.361) [-602.762] (-605.589) -- 0:00:38
      384500 -- (-608.295) [-604.982] (-605.479) (-603.065) * [-603.170] (-606.522) (-602.764) (-604.571) -- 0:00:38
      385000 -- (-603.631) (-607.293) (-605.512) [-603.314] * (-604.731) (-609.635) (-604.341) [-603.608] -- 0:00:38

      Average standard deviation of split frequencies: 0.015673

      385500 -- [-604.951] (-604.227) (-602.497) (-603.583) * (-603.572) (-609.344) [-605.657] (-603.081) -- 0:00:38
      386000 -- (-606.075) (-602.074) [-602.234] (-603.606) * (-604.559) [-602.655] (-603.603) (-602.932) -- 0:00:38
      386500 -- [-606.087] (-602.313) (-602.985) (-603.105) * [-607.096] (-603.485) (-604.885) (-602.026) -- 0:00:38
      387000 -- (-606.646) (-603.783) [-602.543] (-602.981) * (-604.420) (-605.619) [-603.835] (-604.657) -- 0:00:38
      387500 -- (-604.378) (-604.269) [-603.494] (-605.304) * (-605.928) (-608.609) [-602.957] (-602.842) -- 0:00:37
      388000 -- (-606.718) (-603.521) [-607.030] (-603.112) * [-605.356] (-606.489) (-603.527) (-603.771) -- 0:00:37
      388500 -- (-602.478) (-604.613) (-604.971) [-605.315] * (-603.352) (-605.426) [-604.064] (-602.949) -- 0:00:37
      389000 -- (-602.476) (-604.520) (-605.094) [-603.099] * (-604.900) (-604.711) [-605.135] (-602.743) -- 0:00:37
      389500 -- [-603.056] (-605.946) (-605.812) (-605.680) * (-603.730) (-606.144) (-602.563) [-603.362] -- 0:00:37
      390000 -- (-605.309) [-604.560] (-605.775) (-603.449) * [-603.683] (-605.512) (-602.371) (-605.981) -- 0:00:37

      Average standard deviation of split frequencies: 0.015486

      390500 -- (-605.005) (-605.803) [-602.840] (-601.799) * [-604.176] (-606.870) (-603.834) (-603.712) -- 0:00:37
      391000 -- (-605.396) [-605.066] (-607.043) (-606.711) * (-606.928) (-602.845) [-604.056] (-606.957) -- 0:00:37
      391500 -- (-602.316) (-607.204) [-603.790] (-604.330) * (-606.256) [-603.492] (-603.869) (-604.292) -- 0:00:37
      392000 -- (-602.750) (-606.456) [-602.669] (-603.057) * (-605.149) (-603.015) [-603.312] (-603.160) -- 0:00:37
      392500 -- [-602.397] (-605.892) (-602.306) (-606.172) * (-604.494) (-603.612) (-604.005) [-603.983] -- 0:00:37
      393000 -- [-603.687] (-602.077) (-602.757) (-603.421) * [-604.139] (-606.793) (-605.155) (-606.314) -- 0:00:37
      393500 -- (-605.860) (-601.987) (-603.617) [-603.768] * (-604.074) (-606.454) [-602.440] (-607.349) -- 0:00:36
      394000 -- (-604.221) (-602.782) (-605.788) [-603.692] * (-606.042) [-604.884] (-604.346) (-604.327) -- 0:00:36
      394500 -- (-605.164) (-603.455) (-602.805) [-603.675] * (-605.760) [-603.344] (-604.663) (-604.206) -- 0:00:36
      395000 -- (-605.347) (-603.721) [-603.456] (-609.325) * (-610.574) [-604.087] (-602.338) (-608.184) -- 0:00:36

      Average standard deviation of split frequencies: 0.015409

      395500 -- (-604.444) (-604.172) [-603.118] (-606.644) * (-605.689) (-603.311) [-603.081] (-602.425) -- 0:00:38
      396000 -- (-606.814) [-604.710] (-602.796) (-602.699) * (-604.278) [-608.268] (-602.258) (-602.453) -- 0:00:38
      396500 -- [-603.929] (-610.865) (-602.962) (-603.099) * [-603.973] (-607.292) (-606.065) (-603.710) -- 0:00:38
      397000 -- (-603.708) (-603.723) (-602.944) [-602.668] * (-604.969) [-605.912] (-603.839) (-603.791) -- 0:00:37
      397500 -- (-604.812) [-602.051] (-605.853) (-605.894) * (-602.432) (-605.184) [-603.884] (-603.597) -- 0:00:37
      398000 -- (-605.452) (-602.464) (-604.441) [-604.501] * (-602.605) [-605.596] (-605.879) (-604.043) -- 0:00:37
      398500 -- [-603.574] (-603.833) (-605.280) (-604.802) * (-603.049) (-606.218) (-604.924) [-603.149] -- 0:00:37
      399000 -- [-604.444] (-604.450) (-605.693) (-602.522) * [-603.513] (-603.178) (-602.332) (-606.213) -- 0:00:37
      399500 -- (-603.771) (-605.134) (-608.446) [-604.079] * (-605.338) (-603.676) [-602.494] (-607.711) -- 0:00:37
      400000 -- [-606.037] (-605.089) (-603.144) (-606.924) * (-604.135) (-603.531) [-603.322] (-607.593) -- 0:00:37

      Average standard deviation of split frequencies: 0.015099

      400500 -- (-607.236) (-602.200) (-602.137) [-603.916] * (-603.299) (-606.899) [-605.680] (-603.053) -- 0:00:37
      401000 -- (-603.902) (-602.020) (-602.818) [-602.124] * (-606.152) [-605.175] (-603.734) (-603.180) -- 0:00:37
      401500 -- (-609.530) (-604.586) [-602.738] (-602.653) * (-602.781) (-604.207) (-603.817) [-602.945] -- 0:00:37
      402000 -- (-603.869) (-604.838) (-608.462) [-604.887] * (-603.661) (-602.824) (-603.617) [-602.791] -- 0:00:37
      402500 -- (-603.211) [-604.351] (-604.674) (-606.724) * [-602.361] (-602.446) (-603.441) (-607.460) -- 0:00:37
      403000 -- (-604.664) [-603.820] (-606.772) (-603.656) * (-602.958) (-603.773) (-604.246) [-605.951] -- 0:00:37
      403500 -- (-604.356) [-603.028] (-604.888) (-602.421) * [-602.990] (-603.654) (-604.190) (-607.630) -- 0:00:36
      404000 -- (-604.274) [-603.330] (-605.580) (-604.572) * (-604.346) [-606.834] (-604.998) (-605.399) -- 0:00:36
      404500 -- (-605.597) [-604.931] (-607.011) (-604.807) * [-604.548] (-603.047) (-604.080) (-602.807) -- 0:00:36
      405000 -- (-601.904) [-608.951] (-603.614) (-605.359) * (-603.023) (-603.250) [-603.127] (-602.146) -- 0:00:36

      Average standard deviation of split frequencies: 0.014256

      405500 -- (-602.173) (-606.331) (-605.238) [-604.095] * (-602.980) (-603.743) (-603.277) [-604.136] -- 0:00:36
      406000 -- (-603.546) [-604.158] (-603.784) (-608.738) * [-601.998] (-603.308) (-604.334) (-603.403) -- 0:00:36
      406500 -- [-602.815] (-605.118) (-602.728) (-604.615) * (-602.280) [-605.560] (-607.141) (-607.087) -- 0:00:36
      407000 -- (-603.709) [-602.644] (-603.332) (-604.079) * (-605.758) (-602.753) [-610.065] (-605.525) -- 0:00:36
      407500 -- (-604.557) (-603.001) [-604.494] (-604.513) * (-604.121) [-602.519] (-604.021) (-602.498) -- 0:00:36
      408000 -- (-603.987) [-606.748] (-604.177) (-605.963) * (-602.538) (-604.157) (-607.505) [-604.772] -- 0:00:36
      408500 -- [-605.125] (-602.260) (-602.977) (-603.682) * (-606.626) (-606.445) [-603.268] (-603.134) -- 0:00:36
      409000 -- (-603.995) (-602.667) (-603.846) [-606.337] * (-603.262) (-603.461) (-603.304) [-606.246] -- 0:00:36
      409500 -- [-604.984] (-605.766) (-606.507) (-602.578) * [-602.877] (-606.802) (-603.522) (-604.970) -- 0:00:36
      410000 -- (-607.964) (-606.173) (-604.598) [-603.377] * (-606.830) (-606.655) (-607.554) [-604.505] -- 0:00:35

      Average standard deviation of split frequencies: 0.012627

      410500 -- (-607.285) (-605.504) [-610.909] (-603.232) * (-604.211) (-604.952) [-607.592] (-605.618) -- 0:00:35
      411000 -- (-604.181) (-603.527) [-602.145] (-606.483) * [-602.560] (-607.734) (-605.765) (-605.434) -- 0:00:35
      411500 -- (-606.546) (-605.340) (-603.271) [-602.697] * (-603.712) (-603.778) [-605.252] (-604.730) -- 0:00:35
      412000 -- (-609.115) [-603.894] (-603.534) (-603.361) * (-602.356) (-604.359) (-602.100) [-602.424] -- 0:00:37
      412500 -- (-604.175) [-606.416] (-606.880) (-608.044) * [-602.003] (-603.558) (-602.376) (-604.026) -- 0:00:37
      413000 -- (-605.926) [-604.872] (-603.154) (-606.326) * (-604.714) (-607.114) (-605.574) [-603.826] -- 0:00:36
      413500 -- (-604.443) (-606.586) [-604.365] (-611.946) * (-606.698) (-602.718) (-602.280) [-603.265] -- 0:00:36
      414000 -- (-602.921) (-602.585) (-607.671) [-605.591] * [-602.926] (-605.044) (-602.428) (-602.893) -- 0:00:36
      414500 -- (-603.741) (-603.569) (-603.757) [-603.398] * (-605.502) (-609.337) (-602.339) [-603.851] -- 0:00:36
      415000 -- (-606.595) [-605.496] (-605.860) (-603.375) * (-607.036) [-604.291] (-604.889) (-603.279) -- 0:00:36

      Average standard deviation of split frequencies: 0.011773

      415500 -- (-608.821) [-603.944] (-605.406) (-603.257) * (-604.066) [-604.854] (-602.639) (-608.160) -- 0:00:36
      416000 -- (-603.883) (-605.025) [-603.259] (-603.546) * [-605.109] (-603.480) (-603.247) (-603.801) -- 0:00:36
      416500 -- (-601.922) [-603.486] (-602.422) (-606.318) * (-602.047) [-603.333] (-606.327) (-603.289) -- 0:00:36
      417000 -- [-604.245] (-604.892) (-606.539) (-603.438) * (-604.031) [-604.126] (-602.769) (-604.454) -- 0:00:36
      417500 -- (-603.667) [-604.381] (-608.600) (-604.176) * [-604.264] (-607.748) (-603.813) (-604.438) -- 0:00:36
      418000 -- [-608.326] (-602.308) (-604.572) (-605.681) * (-603.144) (-605.572) (-605.299) [-603.626] -- 0:00:36
      418500 -- (-602.687) [-603.165] (-606.329) (-603.443) * (-607.131) (-605.037) (-606.209) [-603.553] -- 0:00:36
      419000 -- (-603.939) [-603.566] (-605.751) (-604.419) * (-603.602) (-603.433) (-602.705) [-606.740] -- 0:00:36
      419500 -- (-605.634) (-606.537) [-605.278] (-604.650) * (-603.515) (-604.124) (-603.405) [-605.499] -- 0:00:35
      420000 -- (-607.785) (-602.726) (-603.300) [-606.498] * (-604.719) (-603.470) [-606.557] (-605.075) -- 0:00:35

      Average standard deviation of split frequencies: 0.010481

      420500 -- (-605.242) (-602.824) (-604.074) [-602.942] * [-603.893] (-605.666) (-605.849) (-604.085) -- 0:00:35
      421000 -- (-607.682) (-606.478) (-604.819) [-603.504] * [-602.383] (-603.235) (-604.774) (-603.194) -- 0:00:35
      421500 -- (-603.601) (-605.011) (-603.471) [-605.739] * [-603.299] (-603.897) (-602.827) (-605.109) -- 0:00:35
      422000 -- (-605.942) (-602.641) [-603.933] (-603.387) * (-602.533) (-602.764) (-604.264) [-607.570] -- 0:00:35
      422500 -- (-605.055) (-602.934) [-602.971] (-602.857) * [-602.492] (-603.731) (-602.772) (-603.087) -- 0:00:35
      423000 -- (-606.406) [-604.044] (-602.695) (-609.372) * (-602.852) (-603.310) [-606.512] (-605.086) -- 0:00:35
      423500 -- (-606.495) [-602.682] (-606.609) (-603.486) * [-602.488] (-607.109) (-602.588) (-604.553) -- 0:00:35
      424000 -- (-607.226) [-602.466] (-606.019) (-602.437) * (-602.280) (-604.548) [-603.414] (-604.928) -- 0:00:35
      424500 -- (-603.194) [-603.042] (-604.055) (-603.530) * (-606.946) [-605.877] (-609.382) (-603.692) -- 0:00:35
      425000 -- (-603.154) [-603.230] (-604.503) (-607.931) * (-603.671) (-606.546) [-603.104] (-608.985) -- 0:00:35

      Average standard deviation of split frequencies: 0.010480

      425500 -- (-603.589) [-604.890] (-607.940) (-610.973) * (-602.226) [-606.040] (-602.960) (-604.660) -- 0:00:35
      426000 -- [-605.573] (-607.789) (-606.233) (-609.854) * (-603.020) (-603.824) [-604.209] (-610.649) -- 0:00:35
      426500 -- (-604.577) (-604.924) (-602.597) [-609.525] * (-604.520) (-604.747) [-602.924] (-603.387) -- 0:00:34
      427000 -- (-604.112) [-603.737] (-606.126) (-605.620) * (-602.575) (-606.157) (-603.966) [-603.657] -- 0:00:34
      427500 -- (-605.777) (-605.510) [-603.372] (-605.555) * (-603.422) (-611.324) (-605.964) [-603.631] -- 0:00:34
      428000 -- [-602.118] (-605.778) (-604.544) (-603.846) * (-605.397) (-604.272) (-605.037) [-603.447] -- 0:00:34
      428500 -- (-609.570) [-603.976] (-609.541) (-603.453) * (-605.988) (-605.577) (-606.143) [-602.576] -- 0:00:34
      429000 -- (-602.962) [-603.121] (-609.862) (-604.790) * (-605.659) (-603.407) [-605.058] (-602.961) -- 0:00:35
      429500 -- (-603.227) (-603.635) (-604.841) [-603.346] * [-603.506] (-605.651) (-603.987) (-602.819) -- 0:00:35
      430000 -- (-603.888) (-602.300) [-608.532] (-606.818) * (-604.713) [-604.765] (-605.627) (-603.927) -- 0:00:35

      Average standard deviation of split frequencies: 0.011139

      430500 -- [-605.670] (-603.466) (-608.773) (-602.902) * [-607.478] (-603.359) (-603.718) (-605.303) -- 0:00:35
      431000 -- (-605.818) (-602.083) [-602.394] (-605.663) * [-604.233] (-603.052) (-610.614) (-605.581) -- 0:00:35
      431500 -- [-606.145] (-602.891) (-609.349) (-604.354) * (-603.460) (-602.855) [-606.404] (-606.636) -- 0:00:35
      432000 -- (-604.804) (-605.743) (-606.826) [-606.808] * (-604.239) (-603.528) (-604.716) [-603.233] -- 0:00:35
      432500 -- (-604.878) [-602.988] (-606.101) (-603.284) * [-603.510] (-602.270) (-608.863) (-602.346) -- 0:00:35
      433000 -- [-604.571] (-604.221) (-608.813) (-603.583) * [-602.888] (-605.296) (-604.182) (-602.687) -- 0:00:35
      433500 -- (-602.810) (-602.484) [-603.505] (-603.066) * [-602.579] (-602.968) (-605.149) (-602.594) -- 0:00:35
      434000 -- (-606.191) (-602.026) (-602.757) [-603.081] * [-604.845] (-604.158) (-604.418) (-603.375) -- 0:00:35
      434500 -- [-603.655] (-604.403) (-604.533) (-603.402) * (-603.474) (-605.806) (-603.822) [-605.014] -- 0:00:35
      435000 -- (-606.126) (-606.380) (-602.201) [-603.008] * [-602.212] (-603.302) (-603.714) (-602.398) -- 0:00:35

      Average standard deviation of split frequencies: 0.011512

      435500 -- (-603.997) (-605.253) [-607.500] (-603.242) * [-605.239] (-603.151) (-602.580) (-602.764) -- 0:00:34
      436000 -- (-602.172) [-603.297] (-602.448) (-606.672) * (-602.207) (-602.347) [-602.609] (-602.267) -- 0:00:34
      436500 -- (-604.299) (-605.051) [-602.558] (-603.371) * (-602.188) (-602.959) [-604.515] (-602.670) -- 0:00:34
      437000 -- [-606.310] (-606.286) (-606.483) (-603.312) * (-603.912) [-603.127] (-602.303) (-606.267) -- 0:00:34
      437500 -- (-605.840) (-603.277) (-602.710) [-604.691] * [-603.750] (-602.899) (-603.098) (-604.436) -- 0:00:34
      438000 -- (-602.417) (-605.249) [-601.844] (-606.859) * (-604.617) (-605.095) (-602.875) [-604.379] -- 0:00:34
      438500 -- (-603.392) (-603.900) [-602.473] (-603.620) * (-602.077) [-603.625] (-605.489) (-603.735) -- 0:00:34
      439000 -- [-603.377] (-604.499) (-603.746) (-604.429) * [-604.100] (-603.778) (-602.126) (-603.293) -- 0:00:34
      439500 -- (-603.626) (-603.451) (-603.470) [-603.903] * (-602.363) (-603.466) (-607.217) [-604.618] -- 0:00:34
      440000 -- (-606.496) (-602.246) [-608.288] (-603.457) * [-603.549] (-605.635) (-611.467) (-604.354) -- 0:00:34

      Average standard deviation of split frequencies: 0.010949

      440500 -- (-604.423) [-603.668] (-605.335) (-603.888) * (-604.932) [-607.982] (-603.007) (-606.808) -- 0:00:34
      441000 -- [-604.271] (-602.543) (-604.264) (-605.336) * [-603.559] (-602.561) (-607.913) (-604.461) -- 0:00:34
      441500 -- (-606.496) (-602.424) (-603.236) [-607.401] * (-606.939) (-612.839) [-604.370] (-603.737) -- 0:00:34
      442000 -- (-604.323) (-605.187) (-602.796) [-603.735] * (-604.050) [-605.393] (-604.522) (-604.795) -- 0:00:34
      442500 -- (-603.932) (-610.631) (-603.586) [-604.166] * (-604.724) [-604.305] (-604.898) (-604.002) -- 0:00:34
      443000 -- (-605.108) [-604.139] (-604.809) (-603.519) * (-608.587) (-603.088) [-603.402] (-602.957) -- 0:00:33
      443500 -- [-602.028] (-605.666) (-603.037) (-608.145) * [-603.645] (-605.164) (-607.805) (-606.732) -- 0:00:33
      444000 -- [-603.150] (-603.411) (-608.020) (-605.620) * (-608.764) (-605.291) (-603.186) [-605.859] -- 0:00:33
      444500 -- [-602.794] (-603.910) (-606.493) (-604.750) * [-602.248] (-603.493) (-602.811) (-604.499) -- 0:00:33
      445000 -- [-603.238] (-605.154) (-605.250) (-608.916) * (-603.857) (-603.042) (-603.292) [-605.250] -- 0:00:33

      Average standard deviation of split frequencies: 0.010570

      445500 -- (-604.226) (-604.263) (-605.853) [-607.156] * (-606.512) (-603.206) (-603.517) [-603.280] -- 0:00:34
      446000 -- [-604.246] (-607.418) (-609.240) (-603.804) * (-606.237) (-604.577) (-602.253) [-603.118] -- 0:00:34
      446500 -- [-603.888] (-608.034) (-604.813) (-604.788) * (-601.989) (-602.666) [-602.249] (-606.760) -- 0:00:34
      447000 -- [-603.417] (-607.329) (-605.970) (-602.452) * (-603.707) (-602.642) [-603.249] (-604.666) -- 0:00:34
      447500 -- (-602.880) (-607.156) [-604.208] (-603.562) * [-606.701] (-605.897) (-603.918) (-602.335) -- 0:00:34
      448000 -- (-608.269) [-605.651] (-606.067) (-607.675) * (-606.267) (-607.911) [-606.794] (-604.056) -- 0:00:34
      448500 -- (-607.981) (-606.055) (-603.626) [-603.604] * (-606.810) [-605.084] (-605.162) (-606.098) -- 0:00:34
      449000 -- [-609.926] (-609.974) (-605.094) (-602.152) * (-605.760) (-606.038) [-602.453] (-603.451) -- 0:00:34
      449500 -- (-608.814) [-602.323] (-602.362) (-602.087) * (-609.378) [-606.946] (-602.824) (-604.086) -- 0:00:34
      450000 -- (-603.545) [-604.337] (-603.384) (-602.898) * (-603.777) (-604.390) [-603.322] (-604.158) -- 0:00:34

      Average standard deviation of split frequencies: 0.010153

      450500 -- (-602.785) (-604.248) [-604.778] (-609.519) * (-604.833) (-607.318) (-603.759) [-605.466] -- 0:00:34
      451000 -- (-602.308) (-604.614) (-604.489) [-606.526] * [-602.073] (-604.165) (-607.734) (-604.550) -- 0:00:34
      451500 -- (-604.952) (-605.843) (-603.484) [-604.394] * [-602.718] (-605.190) (-604.889) (-602.878) -- 0:00:34
      452000 -- (-604.764) [-604.185] (-603.178) (-605.299) * [-602.967] (-602.413) (-602.607) (-602.925) -- 0:00:33
      452500 -- (-606.971) (-603.585) (-603.571) [-603.063] * [-602.606] (-606.155) (-603.497) (-604.033) -- 0:00:33
      453000 -- (-606.354) (-603.132) (-604.842) [-602.645] * (-604.339) (-603.496) (-602.628) [-603.156] -- 0:00:33
      453500 -- [-602.855] (-603.364) (-607.424) (-603.810) * (-604.292) (-608.078) (-603.844) [-603.139] -- 0:00:33
      454000 -- (-606.369) (-605.275) [-603.234] (-606.630) * [-602.379] (-606.417) (-604.706) (-605.780) -- 0:00:33
      454500 -- (-602.426) (-602.197) (-603.323) [-607.119] * (-610.437) (-605.154) [-603.694] (-604.446) -- 0:00:33
      455000 -- (-602.493) (-602.723) [-606.278] (-604.109) * (-608.063) [-605.310] (-602.911) (-606.522) -- 0:00:33

      Average standard deviation of split frequencies: 0.009973

      455500 -- [-603.992] (-606.401) (-609.683) (-602.716) * [-602.170] (-602.670) (-603.684) (-605.741) -- 0:00:33
      456000 -- (-610.641) [-602.722] (-609.812) (-606.875) * (-602.810) (-604.559) [-605.397] (-605.084) -- 0:00:33
      456500 -- (-603.097) (-604.932) (-603.322) [-607.225] * (-602.261) (-615.262) [-606.586] (-607.016) -- 0:00:33
      457000 -- [-603.580] (-605.270) (-604.031) (-605.399) * (-604.201) [-606.792] (-602.812) (-606.911) -- 0:00:33
      457500 -- (-608.796) (-606.420) [-602.961] (-604.732) * (-608.714) (-612.378) (-603.610) [-602.741] -- 0:00:33
      458000 -- [-602.867] (-604.195) (-605.828) (-603.959) * [-605.923] (-605.432) (-603.096) (-606.198) -- 0:00:33
      458500 -- [-603.656] (-603.707) (-604.405) (-604.933) * (-607.140) [-605.167] (-602.486) (-604.378) -- 0:00:33
      459000 -- [-603.424] (-605.213) (-603.812) (-605.683) * (-603.257) (-602.925) (-608.169) [-603.323] -- 0:00:33
      459500 -- [-604.527] (-605.403) (-602.857) (-603.381) * [-603.047] (-605.893) (-604.484) (-603.781) -- 0:00:32
      460000 -- (-607.164) (-603.987) (-602.801) [-604.380] * (-603.896) (-602.991) (-603.308) [-603.806] -- 0:00:32

      Average standard deviation of split frequencies: 0.010105

      460500 -- (-609.813) (-606.021) (-603.666) [-605.185] * (-609.473) (-602.776) (-603.416) [-604.556] -- 0:00:32
      461000 -- (-604.831) (-604.163) [-604.217] (-604.145) * (-606.943) (-603.103) (-603.517) [-604.662] -- 0:00:32
      461500 -- (-604.959) [-603.084] (-603.766) (-602.792) * (-605.672) [-603.375] (-606.853) (-603.904) -- 0:00:32
      462000 -- (-604.161) (-605.259) (-603.808) [-604.547] * (-604.414) [-603.747] (-604.619) (-605.819) -- 0:00:33
      462500 -- (-603.728) [-605.290] (-603.402) (-605.795) * (-608.072) (-605.578) [-604.076] (-606.535) -- 0:00:33
      463000 -- (-605.037) (-604.205) (-602.460) [-603.665] * (-608.535) (-605.616) [-606.371] (-604.280) -- 0:00:33
      463500 -- (-604.700) (-603.572) (-602.104) [-602.761] * (-602.891) [-603.027] (-604.726) (-602.274) -- 0:00:33
      464000 -- [-603.768] (-602.984) (-603.344) (-605.899) * (-604.786) (-603.916) [-602.723] (-606.655) -- 0:00:33
      464500 -- (-605.818) (-603.461) (-605.595) [-602.051] * [-603.157] (-602.464) (-604.035) (-603.925) -- 0:00:33
      465000 -- (-603.509) (-609.391) [-604.037] (-602.199) * (-603.551) [-603.341] (-608.057) (-604.096) -- 0:00:33

      Average standard deviation of split frequencies: 0.010473

      465500 -- (-608.908) (-602.842) (-604.112) [-602.518] * [-605.987] (-602.852) (-603.451) (-604.791) -- 0:00:33
      466000 -- [-603.899] (-604.153) (-604.487) (-603.506) * (-604.508) (-603.226) (-607.153) [-604.124] -- 0:00:33
      466500 -- (-606.512) (-603.954) [-602.953] (-605.163) * (-605.449) [-602.553] (-602.452) (-603.069) -- 0:00:33
      467000 -- (-606.228) [-603.214] (-606.784) (-603.626) * (-605.451) [-604.768] (-603.916) (-605.387) -- 0:00:33
      467500 -- (-605.753) (-602.362) [-604.915] (-603.876) * (-602.400) (-605.037) (-602.650) [-603.126] -- 0:00:33
      468000 -- [-602.628] (-607.636) (-603.628) (-602.776) * (-604.487) (-602.406) [-605.985] (-607.003) -- 0:00:32
      468500 -- (-602.434) [-603.344] (-605.729) (-605.830) * (-609.175) [-604.822] (-604.232) (-608.189) -- 0:00:32
      469000 -- [-603.052] (-604.655) (-604.383) (-602.537) * (-607.464) [-605.290] (-605.650) (-602.896) -- 0:00:32
      469500 -- (-604.867) (-603.852) (-608.153) [-603.941] * (-605.555) [-605.678] (-606.271) (-604.415) -- 0:00:32
      470000 -- [-603.207] (-607.725) (-603.500) (-603.081) * (-610.926) [-603.988] (-602.927) (-603.060) -- 0:00:32

      Average standard deviation of split frequencies: 0.010782

      470500 -- (-603.637) [-602.048] (-606.276) (-603.773) * (-603.620) (-603.599) [-605.455] (-603.979) -- 0:00:32
      471000 -- (-603.628) [-601.951] (-602.057) (-605.309) * (-606.776) (-604.687) [-602.940] (-602.553) -- 0:00:32
      471500 -- (-604.790) (-603.623) [-604.430] (-603.587) * (-606.937) [-604.121] (-602.632) (-604.571) -- 0:00:32
      472000 -- (-602.931) (-603.082) [-602.254] (-604.279) * [-605.327] (-602.631) (-605.102) (-602.979) -- 0:00:32
      472500 -- (-603.387) (-605.478) (-601.918) [-603.700] * (-606.563) (-604.305) (-602.131) [-604.555] -- 0:00:32
      473000 -- (-602.644) (-602.666) (-603.253) [-604.720] * (-605.907) (-607.546) (-607.386) [-604.820] -- 0:00:32
      473500 -- [-603.703] (-601.721) (-604.026) (-604.188) * [-607.358] (-604.047) (-607.943) (-606.321) -- 0:00:32
      474000 -- [-603.387] (-603.288) (-603.541) (-608.799) * (-602.595) (-602.571) (-604.665) [-603.694] -- 0:00:32
      474500 -- (-611.141) (-603.018) [-604.276] (-604.262) * [-603.968] (-602.801) (-604.641) (-609.744) -- 0:00:32
      475000 -- (-607.375) (-603.746) (-605.119) [-604.698] * (-605.871) (-605.225) (-604.752) [-603.986] -- 0:00:32

      Average standard deviation of split frequencies: 0.011010

      475500 -- (-608.025) (-603.895) [-603.166] (-604.348) * (-606.052) (-604.442) (-604.898) [-609.819] -- 0:00:31
      476000 -- (-606.801) (-604.592) [-605.767] (-602.165) * (-602.233) (-603.544) [-603.744] (-602.097) -- 0:00:31
      476500 -- (-603.293) (-603.494) [-603.646] (-603.820) * [-602.391] (-603.322) (-602.328) (-603.025) -- 0:00:31
      477000 -- [-606.583] (-606.550) (-603.609) (-604.129) * (-603.899) (-604.871) (-603.852) [-607.027] -- 0:00:31
      477500 -- (-604.060) [-607.638] (-602.830) (-603.436) * (-606.872) [-602.298] (-605.661) (-604.476) -- 0:00:31
      478000 -- (-604.506) (-603.449) (-603.296) [-602.228] * (-604.404) (-604.982) [-603.865] (-603.144) -- 0:00:31
      478500 -- (-602.698) (-606.101) (-604.747) [-604.110] * (-605.785) (-604.443) [-603.144] (-608.095) -- 0:00:31
      479000 -- (-602.475) [-605.032] (-604.922) (-604.632) * (-603.090) (-604.070) [-603.644] (-605.355) -- 0:00:32
      479500 -- (-603.730) (-603.742) [-605.294] (-604.849) * [-604.603] (-604.707) (-603.370) (-602.696) -- 0:00:32
      480000 -- (-603.330) (-607.219) (-604.150) [-602.214] * (-611.230) (-603.415) (-603.075) [-608.262] -- 0:00:32

      Average standard deviation of split frequencies: 0.010327

      480500 -- (-605.285) (-606.534) (-604.745) [-602.604] * (-606.044) (-602.532) [-604.040] (-603.973) -- 0:00:32
      481000 -- (-602.962) (-602.853) (-607.455) [-606.437] * [-608.617] (-613.958) (-602.673) (-602.462) -- 0:00:32
      481500 -- [-606.960] (-602.995) (-607.643) (-604.502) * (-606.169) [-604.862] (-602.495) (-606.447) -- 0:00:32
      482000 -- [-601.887] (-602.643) (-607.020) (-606.709) * (-603.159) (-604.520) (-605.369) [-606.394] -- 0:00:32
      482500 -- (-605.769) (-605.310) [-604.795] (-607.134) * (-602.176) (-603.894) [-604.601] (-603.429) -- 0:00:32
      483000 -- (-603.365) [-605.157] (-603.567) (-604.633) * [-603.837] (-602.239) (-605.112) (-605.338) -- 0:00:32
      483500 -- (-604.629) [-604.254] (-605.907) (-602.931) * (-604.571) (-605.607) (-605.666) [-605.082] -- 0:00:32
      484000 -- (-604.498) (-604.561) [-604.605] (-604.207) * (-603.330) (-611.625) [-605.843] (-603.205) -- 0:00:31
      484500 -- (-603.600) (-605.304) [-605.358] (-604.469) * [-604.671] (-605.579) (-605.177) (-603.475) -- 0:00:31
      485000 -- (-603.462) (-605.151) (-604.798) [-604.140] * (-603.957) (-603.682) (-602.140) [-607.206] -- 0:00:31

      Average standard deviation of split frequencies: 0.010441

      485500 -- (-603.316) (-603.485) (-604.166) [-604.856] * (-603.440) (-607.119) [-602.652] (-604.251) -- 0:00:31
      486000 -- [-604.259] (-605.516) (-604.146) (-606.027) * (-603.676) (-602.607) [-603.630] (-602.717) -- 0:00:31
      486500 -- [-603.977] (-605.054) (-602.184) (-606.227) * (-603.550) (-604.628) [-606.014] (-603.736) -- 0:00:31
      487000 -- [-604.550] (-602.671) (-607.360) (-605.483) * (-611.547) [-603.142] (-603.052) (-607.133) -- 0:00:31
      487500 -- (-603.674) (-602.687) (-607.067) [-606.358] * (-604.110) [-604.413] (-604.025) (-603.686) -- 0:00:31
      488000 -- (-603.720) (-604.719) (-605.176) [-604.833] * (-604.630) (-603.980) (-604.282) [-603.929] -- 0:00:31
      488500 -- (-605.270) (-607.507) [-602.919] (-613.226) * [-602.808] (-605.519) (-604.856) (-605.732) -- 0:00:31
      489000 -- (-604.866) (-603.704) (-604.069) [-606.524] * (-605.049) (-602.432) (-603.771) [-603.856] -- 0:00:31
      489500 -- [-607.068] (-602.495) (-605.965) (-605.907) * [-603.309] (-602.547) (-602.703) (-603.459) -- 0:00:31
      490000 -- (-603.523) (-602.104) [-603.507] (-605.309) * (-602.109) (-606.075) (-602.812) [-602.261] -- 0:00:31

      Average standard deviation of split frequencies: 0.010173

      490500 -- [-604.451] (-604.175) (-602.886) (-604.967) * (-604.194) (-605.419) (-602.212) [-602.712] -- 0:00:31
      491000 -- [-608.425] (-608.434) (-603.312) (-611.922) * (-604.189) (-602.074) [-603.853] (-604.836) -- 0:00:31
      491500 -- (-605.394) [-602.735] (-606.309) (-608.044) * (-603.774) (-606.182) (-610.109) [-602.562] -- 0:00:31
      492000 -- (-609.045) (-606.914) (-604.541) [-603.880] * (-603.451) (-604.586) (-602.897) [-605.351] -- 0:00:30
      492500 -- (-605.165) (-603.443) (-605.697) [-602.950] * (-603.148) (-603.512) [-603.473] (-603.932) -- 0:00:30
      493000 -- (-604.356) (-605.027) (-605.339) [-603.275] * (-602.442) (-608.565) [-602.580] (-604.695) -- 0:00:30
      493500 -- (-607.624) [-604.157] (-603.880) (-605.134) * (-604.431) [-608.565] (-606.214) (-604.663) -- 0:00:30
      494000 -- (-604.325) (-605.274) [-607.478] (-602.707) * (-602.706) (-607.368) [-602.368] (-604.599) -- 0:00:30
      494500 -- (-607.417) (-605.984) (-603.092) [-604.722] * (-602.644) (-605.946) (-603.864) [-603.144] -- 0:00:30
      495000 -- [-605.649] (-605.467) (-603.642) (-603.662) * (-605.704) (-604.743) (-609.216) [-605.438] -- 0:00:30

      Average standard deviation of split frequencies: 0.010063

      495500 -- [-605.915] (-603.542) (-603.239) (-603.569) * (-604.316) [-604.643] (-606.051) (-605.766) -- 0:00:30
      496000 -- (-607.870) [-603.319] (-604.120) (-602.571) * [-602.555] (-603.239) (-608.670) (-602.834) -- 0:00:31
      496500 -- (-604.477) (-605.404) [-603.592] (-602.454) * (-603.378) [-603.303] (-606.858) (-605.439) -- 0:00:31
      497000 -- (-605.267) [-605.035] (-604.999) (-602.920) * [-603.576] (-606.375) (-605.912) (-604.920) -- 0:00:31
      497500 -- (-604.235) (-603.771) (-603.694) [-601.892] * (-606.706) [-603.549] (-604.068) (-603.602) -- 0:00:31
      498000 -- (-604.233) [-603.787] (-605.233) (-604.973) * (-604.207) (-607.152) [-602.880] (-604.615) -- 0:00:31
      498500 -- (-604.867) (-604.151) (-604.091) [-606.042] * (-605.029) [-605.955] (-602.629) (-607.891) -- 0:00:31
      499000 -- [-602.339] (-604.256) (-607.752) (-607.512) * [-605.226] (-608.196) (-603.283) (-603.741) -- 0:00:31
      499500 -- (-605.259) (-604.732) (-604.889) [-603.683] * (-602.914) [-603.003] (-609.108) (-606.088) -- 0:00:31
      500000 -- (-606.122) (-603.017) (-602.082) [-608.810] * (-604.180) [-604.393] (-603.937) (-603.259) -- 0:00:31

      Average standard deviation of split frequencies: 0.009748

      500500 -- (-607.130) (-602.411) (-604.115) [-603.229] * (-603.916) [-603.532] (-602.615) (-602.943) -- 0:00:30
      501000 -- [-607.152] (-609.991) (-606.961) (-602.975) * (-606.835) (-603.895) [-602.892] (-602.081) -- 0:00:30
      501500 -- (-604.399) [-603.846] (-606.735) (-603.166) * (-604.717) [-602.781] (-605.235) (-603.689) -- 0:00:30
      502000 -- (-603.852) (-602.933) (-604.343) [-604.115] * [-603.832] (-605.034) (-603.795) (-605.630) -- 0:00:30
      502500 -- [-603.715] (-603.746) (-604.459) (-603.506) * (-603.892) (-604.698) [-604.068] (-604.135) -- 0:00:30
      503000 -- (-606.899) [-603.817] (-604.111) (-604.356) * [-605.505] (-603.427) (-605.343) (-604.984) -- 0:00:30
      503500 -- [-603.850] (-603.836) (-604.072) (-604.017) * (-604.823) (-602.839) (-603.457) [-605.446] -- 0:00:30
      504000 -- (-604.689) [-604.425] (-602.661) (-606.440) * (-604.562) (-607.479) (-601.905) [-602.248] -- 0:00:30
      504500 -- (-603.679) (-605.141) [-603.167] (-606.587) * (-604.952) (-607.891) (-602.664) [-603.168] -- 0:00:30
      505000 -- (-602.269) (-606.453) [-603.951] (-602.599) * (-605.432) (-602.480) [-604.527] (-610.029) -- 0:00:30

      Average standard deviation of split frequencies: 0.009590

      505500 -- (-602.834) [-604.332] (-603.510) (-602.955) * (-605.036) [-603.138] (-609.183) (-604.281) -- 0:00:30
      506000 -- (-603.379) (-607.980) (-604.113) [-601.938] * (-605.004) [-603.212] (-604.348) (-605.548) -- 0:00:30
      506500 -- (-606.155) (-602.856) (-603.561) [-603.226] * (-603.995) (-609.803) (-604.763) [-603.453] -- 0:00:30
      507000 -- (-604.640) (-603.950) [-603.125] (-602.962) * (-604.650) (-605.717) [-602.935] (-606.130) -- 0:00:30
      507500 -- [-604.654] (-603.194) (-603.823) (-604.458) * [-602.489] (-603.963) (-603.130) (-605.110) -- 0:00:30
      508000 -- (-603.636) [-602.027] (-603.177) (-602.587) * (-602.942) (-609.635) (-602.119) [-603.538] -- 0:00:30
      508500 -- (-603.294) (-604.011) (-604.556) [-606.504] * [-605.660] (-608.686) (-602.204) (-602.229) -- 0:00:29
      509000 -- (-603.732) (-606.560) [-602.676] (-603.672) * (-605.977) [-603.909] (-605.259) (-603.835) -- 0:00:29
      509500 -- (-602.178) [-604.145] (-602.373) (-604.246) * [-603.169] (-605.457) (-602.329) (-605.053) -- 0:00:29
      510000 -- [-602.630] (-603.201) (-603.179) (-604.695) * (-607.432) (-603.002) (-605.022) [-602.269] -- 0:00:29

      Average standard deviation of split frequencies: 0.009991

      510500 -- (-603.755) [-602.357] (-604.464) (-605.433) * (-604.889) (-605.796) [-603.857] (-604.759) -- 0:00:29
      511000 -- (-603.574) (-603.034) [-604.484] (-603.817) * [-607.402] (-603.763) (-610.177) (-605.851) -- 0:00:29
      511500 -- [-603.942] (-603.137) (-604.062) (-603.287) * (-603.132) [-604.607] (-603.213) (-605.692) -- 0:00:29
      512000 -- (-602.365) [-603.746] (-601.918) (-603.466) * (-603.820) (-602.977) [-602.638] (-605.270) -- 0:00:29
      512500 -- (-605.825) [-602.525] (-602.407) (-603.876) * [-604.799] (-603.518) (-604.006) (-604.089) -- 0:00:30
      513000 -- [-606.656] (-602.665) (-602.052) (-606.542) * (-602.316) [-604.845] (-603.817) (-603.965) -- 0:00:30
      513500 -- (-603.110) (-602.765) [-604.058] (-602.920) * (-603.170) (-604.491) [-602.365] (-603.649) -- 0:00:30
      514000 -- [-608.847] (-602.931) (-602.945) (-603.232) * (-605.456) (-608.610) [-603.026] (-602.730) -- 0:00:30
      514500 -- (-606.214) (-604.803) (-606.459) [-602.453] * (-604.013) [-603.243] (-604.006) (-602.688) -- 0:00:30
      515000 -- (-607.399) [-603.989] (-603.809) (-603.454) * (-604.165) [-602.771] (-605.439) (-604.775) -- 0:00:30

      Average standard deviation of split frequencies: 0.010103

      515500 -- (-604.400) [-603.101] (-602.015) (-603.001) * [-603.768] (-602.713) (-603.700) (-603.791) -- 0:00:30
      516000 -- [-604.506] (-603.984) (-602.521) (-602.732) * (-603.225) [-604.517] (-605.730) (-603.901) -- 0:00:30
      516500 -- (-604.528) [-603.606] (-604.558) (-603.801) * (-603.372) (-605.293) [-605.573] (-603.521) -- 0:00:29
      517000 -- (-603.481) [-603.723] (-604.342) (-603.367) * (-608.199) [-607.102] (-605.506) (-606.910) -- 0:00:29
      517500 -- (-602.435) (-604.555) [-603.344] (-602.661) * (-603.626) (-603.829) (-608.256) [-603.628] -- 0:00:29
      518000 -- (-605.425) (-605.191) (-603.442) [-604.633] * [-605.351] (-603.905) (-603.079) (-603.085) -- 0:00:29
      518500 -- (-603.873) (-602.146) [-603.751] (-604.942) * (-610.250) [-603.288] (-602.261) (-604.777) -- 0:00:29
      519000 -- (-602.526) (-603.981) (-602.224) [-603.742] * (-608.149) [-606.097] (-609.982) (-602.946) -- 0:00:29
      519500 -- (-605.333) (-604.904) [-603.913] (-605.106) * [-605.250] (-605.996) (-609.009) (-602.132) -- 0:00:29
      520000 -- [-608.744] (-604.867) (-605.265) (-602.899) * (-603.095) [-605.757] (-604.684) (-603.249) -- 0:00:29

      Average standard deviation of split frequencies: 0.010016

      520500 -- [-604.021] (-602.833) (-603.934) (-604.019) * [-603.003] (-610.840) (-604.395) (-602.861) -- 0:00:29
      521000 -- (-605.846) (-604.692) [-602.730] (-603.623) * [-602.437] (-603.393) (-603.764) (-606.181) -- 0:00:29
      521500 -- (-604.802) [-604.673] (-602.806) (-609.942) * (-603.986) (-604.752) (-603.038) [-603.578] -- 0:00:29
      522000 -- [-603.311] (-602.082) (-604.545) (-604.176) * [-602.331] (-603.528) (-604.232) (-603.767) -- 0:00:29
      522500 -- (-602.338) [-604.536] (-606.175) (-608.216) * (-606.897) [-604.572] (-603.839) (-603.383) -- 0:00:29
      523000 -- (-602.274) (-605.117) [-603.228] (-602.882) * [-602.917] (-603.191) (-603.506) (-604.991) -- 0:00:29
      523500 -- (-604.854) [-605.183] (-604.845) (-602.808) * (-604.699) (-604.796) [-602.420] (-603.795) -- 0:00:29
      524000 -- (-603.372) [-605.337] (-605.198) (-604.337) * (-603.377) [-609.916] (-607.277) (-603.247) -- 0:00:29
      524500 -- [-603.784] (-605.726) (-604.168) (-603.669) * [-603.343] (-609.455) (-612.072) (-603.439) -- 0:00:29
      525000 -- (-603.963) [-604.173] (-603.171) (-602.244) * (-602.664) [-609.960] (-605.165) (-604.482) -- 0:00:28

      Average standard deviation of split frequencies: 0.010642

      525500 -- (-606.837) [-604.490] (-603.697) (-607.524) * (-602.567) (-603.369) (-606.565) [-602.634] -- 0:00:28
      526000 -- (-606.919) (-604.182) [-602.788] (-605.281) * (-602.930) (-604.550) (-603.580) [-604.899] -- 0:00:28
      526500 -- (-604.816) (-603.224) (-603.243) [-608.527] * (-604.369) (-603.544) (-607.304) [-603.478] -- 0:00:28
      527000 -- (-605.173) [-612.362] (-604.125) (-605.325) * (-605.533) [-605.633] (-603.069) (-608.938) -- 0:00:28
      527500 -- (-609.881) [-604.058] (-606.315) (-605.904) * (-603.325) (-606.664) [-603.496] (-605.610) -- 0:00:28
      528000 -- [-603.149] (-605.009) (-602.820) (-602.608) * (-607.730) [-602.753] (-605.885) (-605.436) -- 0:00:28
      528500 -- (-607.331) (-603.517) [-602.703] (-603.784) * (-605.854) (-602.021) [-606.759] (-602.767) -- 0:00:28
      529000 -- [-602.524] (-603.315) (-602.945) (-602.346) * [-605.201] (-602.479) (-603.706) (-604.385) -- 0:00:29
      529500 -- (-607.066) (-605.616) (-605.123) [-603.929] * (-604.309) (-612.953) [-602.923] (-603.106) -- 0:00:29
      530000 -- [-605.572] (-603.740) (-604.761) (-602.358) * (-603.556) (-609.862) [-603.095] (-603.861) -- 0:00:29

      Average standard deviation of split frequencies: 0.010438

      530500 -- (-606.008) (-604.334) [-606.152] (-602.874) * (-607.637) (-610.233) [-602.635] (-606.065) -- 0:00:29
      531000 -- (-604.361) [-603.810] (-605.508) (-612.024) * (-605.218) [-603.585] (-606.073) (-604.565) -- 0:00:29
      531500 -- (-603.057) (-605.822) [-603.985] (-606.159) * (-604.101) [-602.468] (-605.234) (-605.749) -- 0:00:29
      532000 -- [-603.819] (-606.396) (-603.649) (-603.824) * (-603.926) (-604.329) [-603.861] (-603.257) -- 0:00:29
      532500 -- (-605.390) (-605.882) (-603.936) [-605.505] * (-605.096) (-603.492) (-603.800) [-602.685] -- 0:00:28
      533000 -- (-604.875) [-603.652] (-604.362) (-603.696) * (-604.222) (-603.343) (-608.412) [-602.908] -- 0:00:28
      533500 -- (-605.531) (-604.779) [-604.081] (-605.502) * (-604.220) (-603.967) [-605.004] (-602.380) -- 0:00:28
      534000 -- (-606.568) (-611.429) [-602.094] (-605.170) * (-602.611) (-607.636) [-605.352] (-603.301) -- 0:00:28
      534500 -- [-602.882] (-602.714) (-603.460) (-604.567) * (-602.786) (-605.867) [-603.399] (-606.113) -- 0:00:28
      535000 -- (-604.547) [-602.256] (-603.767) (-603.170) * (-605.335) (-604.155) [-604.717] (-604.404) -- 0:00:28

      Average standard deviation of split frequencies: 0.009894

      535500 -- (-607.203) [-602.122] (-601.969) (-606.333) * (-606.621) (-607.222) (-604.956) [-602.637] -- 0:00:28
      536000 -- (-604.758) [-602.443] (-606.568) (-608.371) * (-608.866) [-604.454] (-604.411) (-602.517) -- 0:00:28
      536500 -- (-603.545) [-603.331] (-606.805) (-604.151) * (-603.770) [-603.850] (-603.409) (-604.789) -- 0:00:28
      537000 -- (-607.281) (-603.081) [-602.148] (-603.998) * (-603.579) [-605.851] (-602.877) (-604.765) -- 0:00:28
      537500 -- (-605.087) (-607.716) [-603.331] (-605.499) * (-603.305) (-607.847) [-603.949] (-602.662) -- 0:00:28
      538000 -- (-606.942) (-609.118) (-604.580) [-606.055] * [-602.877] (-605.758) (-607.184) (-605.262) -- 0:00:28
      538500 -- (-603.658) [-602.444] (-604.553) (-604.373) * [-604.551] (-606.592) (-603.676) (-604.555) -- 0:00:28
      539000 -- (-607.624) [-605.632] (-603.786) (-604.814) * (-603.482) [-604.175] (-602.699) (-604.703) -- 0:00:28
      539500 -- (-606.729) [-608.295] (-604.322) (-602.446) * (-602.366) [-605.289] (-605.061) (-602.729) -- 0:00:28
      540000 -- (-606.673) (-602.336) [-606.325] (-603.303) * (-602.903) (-606.669) (-605.266) [-602.699] -- 0:00:28

      Average standard deviation of split frequencies: 0.009863

      540500 -- (-603.645) (-605.301) [-604.051] (-603.331) * (-602.368) (-602.889) [-604.736] (-607.046) -- 0:00:28
      541000 -- [-602.590] (-604.350) (-605.027) (-603.522) * [-602.329] (-603.334) (-602.744) (-605.230) -- 0:00:27
      541500 -- [-604.968] (-603.874) (-604.778) (-604.181) * (-605.538) (-606.595) (-606.294) [-605.037] -- 0:00:27
      542000 -- (-603.087) (-604.570) [-604.323] (-604.423) * [-604.308] (-605.782) (-606.541) (-605.575) -- 0:00:27
      542500 -- (-604.629) [-603.797] (-606.462) (-603.488) * (-605.607) (-603.468) (-604.125) [-605.449] -- 0:00:27
      543000 -- [-604.288] (-603.773) (-607.269) (-602.702) * (-602.313) (-602.272) [-603.351] (-605.159) -- 0:00:27
      543500 -- (-604.999) (-604.451) [-608.741] (-604.154) * [-604.211] (-605.346) (-603.098) (-605.077) -- 0:00:27
      544000 -- (-608.506) [-603.836] (-605.681) (-604.592) * (-605.894) [-604.369] (-604.482) (-607.491) -- 0:00:27
      544500 -- (-606.178) (-604.482) [-604.005] (-607.203) * [-605.166] (-602.503) (-605.387) (-606.403) -- 0:00:27
      545000 -- (-606.885) (-606.397) [-608.058] (-603.920) * (-603.930) [-608.861] (-604.881) (-606.114) -- 0:00:27

      Average standard deviation of split frequencies: 0.009700

      545500 -- [-603.567] (-607.789) (-604.839) (-604.172) * [-603.079] (-609.468) (-603.139) (-607.726) -- 0:00:28
      546000 -- (-605.180) [-606.157] (-602.173) (-603.695) * (-603.729) (-606.090) (-604.009) [-602.818] -- 0:00:28
      546500 -- [-605.569] (-606.182) (-602.466) (-603.045) * (-606.384) (-609.085) [-602.745] (-603.326) -- 0:00:28
      547000 -- (-610.064) (-605.343) (-603.007) [-602.274] * [-603.560] (-606.909) (-605.092) (-603.263) -- 0:00:28
      547500 -- (-612.878) (-603.548) [-606.277] (-607.834) * (-602.058) (-602.812) (-603.584) [-602.537] -- 0:00:28
      548000 -- (-609.356) [-606.212] (-604.313) (-603.343) * (-603.921) (-605.527) [-604.145] (-603.128) -- 0:00:28
      548500 -- (-603.718) [-605.695] (-602.855) (-603.260) * (-603.969) (-603.268) (-606.511) [-602.194] -- 0:00:27
      549000 -- (-603.715) (-604.143) (-604.505) [-603.765] * [-604.725] (-605.326) (-603.403) (-605.361) -- 0:00:27
      549500 -- (-603.614) (-602.899) (-606.352) [-605.278] * (-604.300) (-607.331) [-605.330] (-603.848) -- 0:00:27
      550000 -- (-606.721) (-603.527) (-609.063) [-603.842] * (-604.368) (-606.789) (-604.328) [-604.018] -- 0:00:27

      Average standard deviation of split frequencies: 0.008935

      550500 -- [-602.511] (-604.821) (-605.971) (-605.455) * (-602.772) [-603.299] (-603.581) (-602.772) -- 0:00:27
      551000 -- (-604.081) (-604.543) [-610.065] (-603.202) * [-603.812] (-602.868) (-611.314) (-604.515) -- 0:00:27
      551500 -- (-603.171) (-604.619) (-608.320) [-603.711] * (-604.228) (-604.053) [-602.079] (-605.830) -- 0:00:27
      552000 -- (-602.772) [-602.776] (-608.238) (-604.001) * (-604.935) (-604.183) [-602.235] (-605.630) -- 0:00:27
      552500 -- (-604.528) (-605.171) [-602.050] (-604.417) * [-602.749] (-603.786) (-604.191) (-603.494) -- 0:00:27
      553000 -- (-602.815) (-605.676) [-605.320] (-603.578) * (-602.979) (-603.893) [-608.179] (-606.534) -- 0:00:27
      553500 -- (-604.685) (-608.710) (-605.360) [-602.947] * [-607.526] (-603.669) (-606.495) (-603.988) -- 0:00:27
      554000 -- (-602.795) (-603.617) (-604.570) [-604.906] * (-603.263) (-607.229) [-606.933] (-603.395) -- 0:00:27
      554500 -- [-603.175] (-605.625) (-605.282) (-617.290) * (-603.680) (-604.673) (-607.449) [-604.854] -- 0:00:27
      555000 -- (-602.826) [-607.588] (-605.262) (-605.144) * (-606.682) [-605.048] (-606.338) (-608.376) -- 0:00:27

      Average standard deviation of split frequencies: 0.009114

      555500 -- (-606.497) (-606.244) [-602.618] (-603.044) * (-608.969) (-606.438) (-608.910) [-603.855] -- 0:00:27
      556000 -- (-604.485) (-608.161) [-602.314] (-605.894) * [-606.920] (-604.069) (-604.447) (-606.008) -- 0:00:27
      556500 -- (-608.725) [-606.572] (-607.444) (-603.098) * (-605.343) (-609.050) [-604.834] (-605.043) -- 0:00:27
      557000 -- (-607.622) (-603.187) (-602.545) [-605.773] * (-606.153) (-601.886) (-605.827) [-607.660] -- 0:00:27
      557500 -- [-603.220] (-606.418) (-604.364) (-603.194) * (-603.807) (-601.961) [-605.576] (-606.936) -- 0:00:26
      558000 -- (-604.831) (-603.919) (-602.632) [-605.212] * (-605.943) [-605.023] (-602.525) (-603.509) -- 0:00:26
      558500 -- [-607.173] (-604.890) (-602.683) (-603.371) * (-604.769) [-602.995] (-604.049) (-603.760) -- 0:00:26
      559000 -- [-604.956] (-605.095) (-601.959) (-605.974) * [-604.465] (-605.017) (-604.273) (-602.466) -- 0:00:26
      559500 -- (-605.101) [-605.550] (-603.337) (-603.146) * (-603.477) [-604.159] (-606.295) (-603.852) -- 0:00:26
      560000 -- (-604.996) (-604.226) (-602.663) [-604.807] * (-603.660) [-603.415] (-603.960) (-605.431) -- 0:00:26

      Average standard deviation of split frequencies: 0.008856

      560500 -- (-606.526) (-608.249) (-603.127) [-603.674] * [-606.443] (-603.533) (-606.214) (-604.716) -- 0:00:26
      561000 -- (-605.077) [-603.970] (-602.065) (-603.160) * [-604.203] (-606.727) (-605.991) (-605.677) -- 0:00:26
      561500 -- (-607.485) (-603.206) [-602.187] (-602.772) * (-604.247) (-603.601) [-605.011] (-603.857) -- 0:00:26
      562000 -- (-605.455) (-602.580) (-602.130) [-605.129] * (-603.681) (-603.727) (-604.950) [-601.788] -- 0:00:26
      562500 -- [-603.729] (-602.945) (-604.082) (-605.999) * (-602.072) (-603.586) [-605.634] (-603.879) -- 0:00:27
      563000 -- [-602.843] (-606.874) (-607.370) (-609.305) * (-602.515) [-608.459] (-606.306) (-604.012) -- 0:00:27
      563500 -- [-604.091] (-607.195) (-604.434) (-603.949) * (-603.167) (-604.465) [-606.113] (-604.695) -- 0:00:27
      564000 -- [-602.954] (-602.345) (-608.323) (-602.423) * [-602.956] (-605.977) (-602.800) (-603.404) -- 0:00:27
      564500 -- [-606.686] (-602.773) (-604.865) (-604.738) * (-606.346) (-603.503) [-607.914] (-605.269) -- 0:00:27
      565000 -- (-604.567) [-602.711] (-609.465) (-604.671) * (-604.529) [-604.623] (-606.364) (-607.337) -- 0:00:26

      Average standard deviation of split frequencies: 0.008939

      565500 -- (-603.493) (-604.421) (-606.415) [-603.857] * (-603.601) (-602.413) (-605.157) [-602.793] -- 0:00:26
      566000 -- [-602.662] (-606.568) (-602.105) (-604.563) * (-605.599) (-603.950) [-605.667] (-603.499) -- 0:00:26
      566500 -- (-603.765) [-605.494] (-602.538) (-604.960) * (-605.161) [-603.752] (-607.837) (-608.980) -- 0:00:26
      567000 -- (-602.844) (-603.199) [-602.729] (-603.102) * (-603.975) (-605.969) [-604.700] (-604.689) -- 0:00:26
      567500 -- (-604.152) [-603.893] (-602.012) (-607.199) * [-602.669] (-604.097) (-603.169) (-604.842) -- 0:00:26
      568000 -- (-605.195) (-604.290) [-605.551] (-602.820) * (-601.835) [-604.613] (-602.583) (-606.577) -- 0:00:26
      568500 -- [-603.062] (-607.067) (-603.304) (-602.294) * (-607.564) (-602.238) (-602.774) [-603.323] -- 0:00:26
      569000 -- (-605.248) (-604.940) [-607.521] (-607.084) * (-605.453) [-602.620] (-602.525) (-603.709) -- 0:00:26
      569500 -- (-603.305) [-602.501] (-605.996) (-605.434) * (-603.887) (-602.891) (-604.324) [-602.863] -- 0:00:26
      570000 -- [-604.752] (-602.496) (-604.258) (-602.656) * (-604.880) [-601.929] (-605.785) (-604.033) -- 0:00:26

      Average standard deviation of split frequencies: 0.008591

      570500 -- (-609.185) (-605.541) [-604.196] (-604.781) * (-602.679) (-602.701) [-601.969] (-606.394) -- 0:00:26
      571000 -- (-607.525) (-602.942) [-602.905] (-604.805) * [-603.505] (-604.105) (-602.729) (-604.667) -- 0:00:26
      571500 -- [-607.060] (-602.423) (-603.505) (-604.715) * (-602.127) (-604.325) (-602.516) [-605.359] -- 0:00:26
      572000 -- (-607.953) (-604.459) [-603.040] (-606.379) * [-605.021] (-604.946) (-603.351) (-606.637) -- 0:00:26
      572500 -- [-603.090] (-605.712) (-603.310) (-607.737) * (-603.487) [-604.753] (-604.907) (-603.753) -- 0:00:26
      573000 -- [-602.097] (-603.985) (-603.509) (-602.495) * (-607.454) (-603.236) (-607.206) [-603.771] -- 0:00:26
      573500 -- (-603.256) [-606.044] (-605.000) (-602.502) * (-603.289) (-604.101) [-603.820] (-604.452) -- 0:00:26
      574000 -- [-602.295] (-603.628) (-604.759) (-607.018) * (-604.651) (-606.686) (-606.257) [-602.833] -- 0:00:25
      574500 -- [-604.758] (-604.297) (-607.019) (-615.066) * (-604.576) (-602.853) (-604.566) [-603.091] -- 0:00:25
      575000 -- [-603.209] (-603.331) (-602.391) (-602.926) * [-603.024] (-603.629) (-602.593) (-604.760) -- 0:00:25

      Average standard deviation of split frequencies: 0.008457

      575500 -- [-603.484] (-609.081) (-604.946) (-604.109) * (-605.477) [-602.908] (-603.093) (-603.865) -- 0:00:25
      576000 -- (-604.270) [-602.479] (-603.704) (-605.491) * [-602.259] (-602.318) (-602.562) (-607.760) -- 0:00:25
      576500 -- (-606.017) (-603.184) [-603.438] (-604.232) * (-604.346) (-605.432) [-605.062] (-604.450) -- 0:00:25
      577000 -- (-605.546) [-605.000] (-602.939) (-608.234) * [-602.181] (-604.197) (-603.504) (-604.342) -- 0:00:25
      577500 -- (-604.893) (-603.714) [-602.188] (-604.727) * [-602.959] (-605.836) (-607.123) (-604.033) -- 0:00:25
      578000 -- [-602.425] (-602.674) (-603.344) (-608.895) * [-607.032] (-608.365) (-603.300) (-604.976) -- 0:00:25
      578500 -- (-603.961) (-603.218) [-603.726] (-612.328) * (-607.609) [-607.146] (-602.306) (-606.843) -- 0:00:25
      579000 -- (-606.651) (-602.231) [-604.504] (-603.012) * (-605.120) (-604.057) [-602.466] (-605.936) -- 0:00:25
      579500 -- [-602.934] (-602.037) (-605.025) (-603.963) * (-602.360) [-603.397] (-602.361) (-602.949) -- 0:00:26
      580000 -- (-602.786) (-605.213) (-604.630) [-604.618] * (-602.112) (-606.354) [-604.276] (-605.391) -- 0:00:26

      Average standard deviation of split frequencies: 0.008660

      580500 -- (-604.500) (-602.994) [-603.146] (-604.066) * (-604.324) [-609.202] (-604.244) (-611.814) -- 0:00:26
      581000 -- (-604.489) (-602.879) [-603.899] (-603.071) * (-603.241) (-606.574) [-604.684] (-604.471) -- 0:00:25
      581500 -- (-602.942) [-603.150] (-603.670) (-604.114) * (-602.179) [-604.814] (-605.076) (-604.698) -- 0:00:25
      582000 -- (-603.197) (-603.564) (-605.428) [-605.446] * (-603.601) (-602.469) (-604.900) [-607.327] -- 0:00:25
      582500 -- [-604.683] (-603.115) (-602.688) (-603.427) * (-603.941) [-603.900] (-604.355) (-606.171) -- 0:00:25
      583000 -- [-607.482] (-603.308) (-602.179) (-602.552) * (-604.393) (-602.238) [-602.616] (-605.187) -- 0:00:25
      583500 -- (-604.684) (-607.854) (-602.087) [-603.505] * (-603.232) [-603.135] (-605.624) (-603.076) -- 0:00:25
      584000 -- (-605.914) (-607.302) (-605.879) [-602.652] * [-604.145] (-602.949) (-603.612) (-603.228) -- 0:00:25
      584500 -- (-604.946) (-611.184) [-603.247] (-602.433) * (-603.476) (-603.035) (-603.703) [-604.279] -- 0:00:25
      585000 -- (-605.458) (-604.613) [-604.087] (-602.472) * (-603.595) (-603.925) (-603.629) [-603.995] -- 0:00:25

      Average standard deviation of split frequencies: 0.008195

      585500 -- [-603.665] (-602.411) (-605.469) (-603.386) * (-604.005) (-605.798) [-606.636] (-604.235) -- 0:00:25
      586000 -- (-604.664) [-602.415] (-606.141) (-604.284) * (-604.716) (-604.124) (-609.219) [-605.772] -- 0:00:25
      586500 -- (-603.094) [-602.459] (-603.110) (-603.750) * [-606.741] (-604.331) (-605.209) (-605.159) -- 0:00:25
      587000 -- [-602.637] (-602.354) (-606.082) (-609.065) * (-604.776) [-605.089] (-603.228) (-604.891) -- 0:00:25
      587500 -- (-602.770) [-603.421] (-603.754) (-603.925) * (-604.962) (-603.963) (-602.993) [-602.474] -- 0:00:25
      588000 -- (-604.030) [-606.440] (-606.276) (-604.834) * (-607.859) (-604.402) (-603.095) [-603.666] -- 0:00:25
      588500 -- (-602.597) (-605.671) (-603.940) [-602.610] * [-606.794] (-602.561) (-603.672) (-606.346) -- 0:00:25
      589000 -- (-602.348) (-602.209) (-602.897) [-602.625] * (-604.626) (-607.224) [-602.844] (-604.484) -- 0:00:25
      589500 -- (-604.477) (-603.156) [-603.511] (-603.698) * (-602.411) (-606.228) (-605.141) [-607.020] -- 0:00:25
      590000 -- [-602.763] (-602.825) (-604.646) (-606.451) * [-605.861] (-610.440) (-603.306) (-602.800) -- 0:00:25

      Average standard deviation of split frequencies: 0.008480

      590500 -- (-605.199) (-602.618) (-603.580) [-604.062] * (-603.772) (-608.497) (-605.577) [-604.315] -- 0:00:24
      591000 -- (-604.711) (-602.929) (-604.971) [-602.392] * [-605.330] (-604.060) (-605.294) (-603.444) -- 0:00:24
      591500 -- (-609.614) (-602.466) (-604.470) [-602.704] * (-610.349) (-604.844) (-604.779) [-603.334] -- 0:00:24
      592000 -- (-605.810) [-602.894] (-604.144) (-603.497) * (-604.153) (-603.126) [-603.860] (-603.949) -- 0:00:24
      592500 -- (-606.990) (-604.925) [-603.533] (-607.085) * [-602.317] (-602.782) (-601.830) (-603.265) -- 0:00:24
      593000 -- (-605.067) (-603.574) (-604.079) [-606.402] * (-603.163) [-603.751] (-605.539) (-602.162) -- 0:00:24
      593500 -- [-604.327] (-607.167) (-603.501) (-603.589) * [-607.185] (-606.548) (-603.293) (-606.869) -- 0:00:24
      594000 -- [-602.501] (-605.993) (-604.406) (-602.765) * (-603.737) [-607.239] (-603.268) (-604.565) -- 0:00:24
      594500 -- [-603.468] (-604.020) (-605.130) (-604.107) * [-602.724] (-602.722) (-603.230) (-604.107) -- 0:00:24
      595000 -- (-605.642) (-606.871) (-607.714) [-604.895] * [-604.078] (-607.084) (-602.498) (-603.277) -- 0:00:24

      Average standard deviation of split frequencies: 0.008602

      595500 -- (-605.071) [-610.531] (-604.422) (-602.901) * (-602.541) (-606.679) (-603.965) [-602.502] -- 0:00:24
      596000 -- [-602.813] (-605.081) (-604.460) (-602.837) * (-603.151) [-608.751] (-602.798) (-607.209) -- 0:00:24
      596500 -- (-604.937) [-605.652] (-603.790) (-603.133) * (-605.452) [-606.973] (-606.800) (-602.708) -- 0:00:25
      597000 -- (-604.009) (-606.374) (-604.546) [-602.454] * (-604.212) [-603.743] (-605.305) (-602.039) -- 0:00:24
      597500 -- [-605.638] (-605.566) (-603.189) (-604.389) * (-602.316) (-603.371) [-603.037] (-606.375) -- 0:00:24
      598000 -- [-602.088] (-606.671) (-607.015) (-606.740) * (-605.061) (-604.075) [-602.205] (-604.085) -- 0:00:24
      598500 -- (-602.016) (-605.900) [-603.488] (-604.171) * (-604.362) (-607.767) [-604.128] (-606.693) -- 0:00:24
      599000 -- (-602.791) (-603.904) (-603.823) [-604.212] * (-603.288) (-605.600) [-602.966] (-605.127) -- 0:00:24
      599500 -- (-604.573) (-607.043) [-603.852] (-604.786) * (-606.591) (-606.507) (-603.601) [-605.188] -- 0:00:24
      600000 -- (-604.423) (-605.842) [-603.525] (-604.906) * (-605.858) [-611.429] (-604.289) (-603.992) -- 0:00:24

      Average standard deviation of split frequencies: 0.008424

      600500 -- (-604.516) (-610.812) (-603.159) [-603.978] * (-602.809) [-604.349] (-604.529) (-605.168) -- 0:00:24
      601000 -- [-603.869] (-606.326) (-602.507) (-604.052) * (-605.152) [-603.739] (-604.983) (-603.828) -- 0:00:24
      601500 -- [-603.926] (-606.213) (-603.878) (-603.970) * (-601.967) [-603.003] (-611.859) (-604.587) -- 0:00:24
      602000 -- (-604.627) (-608.517) (-606.074) [-602.753] * (-603.871) [-604.471] (-606.016) (-604.123) -- 0:00:24
      602500 -- (-602.444) [-606.970] (-604.637) (-602.576) * (-603.444) [-604.132] (-604.728) (-604.607) -- 0:00:24
      603000 -- [-601.837] (-605.771) (-605.540) (-604.601) * (-605.626) (-602.239) [-604.906] (-604.924) -- 0:00:24
      603500 -- (-601.803) (-603.613) (-603.720) [-604.153] * (-602.966) [-603.788] (-602.541) (-603.708) -- 0:00:24
      604000 -- (-603.455) (-606.134) [-604.660] (-606.272) * (-604.249) (-603.150) [-606.400] (-602.587) -- 0:00:24
      604500 -- (-606.552) (-605.959) [-603.635] (-605.310) * (-606.759) (-604.817) (-605.237) [-602.261] -- 0:00:24
      605000 -- (-604.229) [-604.567] (-603.729) (-606.721) * (-604.067) (-606.036) [-609.907] (-602.398) -- 0:00:24

      Average standard deviation of split frequencies: 0.008246

      605500 -- (-602.713) (-602.918) (-603.640) [-605.999] * [-605.530] (-602.465) (-604.896) (-605.046) -- 0:00:24
      606000 -- (-602.030) [-603.796] (-610.248) (-603.214) * (-605.258) (-603.129) (-603.299) [-603.164] -- 0:00:24
      606500 -- [-605.329] (-604.167) (-603.980) (-602.897) * (-604.402) (-603.131) (-604.534) [-603.044] -- 0:00:24
      607000 -- (-608.400) [-602.882] (-606.936) (-604.486) * (-603.474) [-605.006] (-604.825) (-602.654) -- 0:00:23
      607500 -- (-604.132) (-608.047) (-606.500) [-603.368] * [-603.738] (-603.846) (-604.035) (-607.581) -- 0:00:23
      608000 -- (-604.832) (-602.759) (-601.994) [-602.995] * [-603.541] (-602.510) (-605.627) (-607.234) -- 0:00:23
      608500 -- (-604.894) (-603.214) (-602.691) [-604.247] * (-602.959) (-602.424) (-605.330) [-604.462] -- 0:00:23
      609000 -- [-603.183] (-605.634) (-605.564) (-603.453) * (-606.346) (-606.247) (-605.852) [-604.030] -- 0:00:23
      609500 -- (-602.924) (-603.529) [-602.861] (-602.349) * (-604.943) [-602.162] (-602.993) (-606.603) -- 0:00:23
      610000 -- (-605.270) [-603.548] (-602.555) (-604.137) * (-609.085) (-602.241) [-602.189] (-603.505) -- 0:00:23

      Average standard deviation of split frequencies: 0.007874

      610500 -- (-604.775) (-605.051) (-602.873) [-605.986] * (-603.369) [-602.330] (-604.167) (-605.167) -- 0:00:23
      611000 -- (-607.027) (-612.540) [-604.280] (-604.102) * (-602.325) (-602.594) [-604.137] (-603.300) -- 0:00:23
      611500 -- (-604.013) (-607.989) [-602.562] (-606.653) * [-603.903] (-602.437) (-605.897) (-605.600) -- 0:00:23
      612000 -- (-605.015) (-607.203) (-603.542) [-601.744] * (-606.274) (-603.653) [-602.714] (-610.615) -- 0:00:23
      612500 -- (-605.982) (-603.856) (-602.602) [-602.594] * (-606.619) (-602.560) [-605.109] (-605.329) -- 0:00:23
      613000 -- [-604.591] (-604.942) (-604.712) (-602.008) * (-605.652) (-602.290) [-604.109] (-603.962) -- 0:00:23
      613500 -- (-602.303) [-604.275] (-609.468) (-602.485) * (-604.617) (-602.632) (-606.010) [-607.374] -- 0:00:23
      614000 -- (-604.057) [-606.681] (-605.497) (-606.343) * (-602.451) (-603.442) (-605.272) [-602.799] -- 0:00:23
      614500 -- (-604.084) (-603.224) (-604.750) [-603.946] * (-602.597) (-604.238) [-606.062] (-602.481) -- 0:00:23
      615000 -- (-603.849) (-603.124) (-602.737) [-603.798] * [-602.692] (-602.068) (-605.902) (-606.176) -- 0:00:23

      Average standard deviation of split frequencies: 0.007347

      615500 -- (-607.317) [-603.045] (-604.577) (-603.635) * [-602.182] (-605.433) (-602.168) (-603.500) -- 0:00:23
      616000 -- (-602.039) [-603.510] (-607.122) (-602.380) * (-602.323) [-605.240] (-603.776) (-603.856) -- 0:00:23
      616500 -- [-604.253] (-604.379) (-604.939) (-603.634) * (-602.286) (-606.459) [-603.491] (-603.676) -- 0:00:23
      617000 -- (-603.535) (-607.925) (-604.774) [-604.818] * (-604.070) (-603.779) [-602.105] (-605.982) -- 0:00:23
      617500 -- (-603.682) [-602.782] (-605.307) (-606.760) * [-604.457] (-605.692) (-602.769) (-603.433) -- 0:00:23
      618000 -- (-605.451) [-602.561] (-603.034) (-603.553) * (-607.214) (-606.020) (-605.597) [-604.022] -- 0:00:23
      618500 -- (-606.096) (-604.075) [-607.492] (-602.091) * (-604.208) (-605.065) (-605.052) [-603.266] -- 0:00:23
      619000 -- [-603.333] (-605.274) (-605.449) (-602.607) * (-607.360) (-607.099) (-607.490) [-605.415] -- 0:00:23
      619500 -- (-605.285) (-603.169) (-602.719) [-608.093] * (-602.586) (-603.733) (-608.723) [-603.896] -- 0:00:23
      620000 -- (-603.078) [-602.033] (-604.029) (-605.439) * (-603.542) (-603.821) [-603.027] (-602.608) -- 0:00:23

      Average standard deviation of split frequencies: 0.006836

      620500 -- (-602.977) [-605.958] (-606.442) (-608.017) * (-608.547) (-604.101) (-605.322) [-604.408] -- 0:00:23
      621000 -- [-602.046] (-605.909) (-601.848) (-608.607) * (-604.455) (-604.706) [-603.938] (-604.579) -- 0:00:23
      621500 -- [-605.536] (-608.391) (-602.096) (-602.570) * (-607.982) (-605.829) [-607.501] (-604.643) -- 0:00:23
      622000 -- (-603.013) (-605.024) (-602.068) [-602.583] * (-607.263) (-604.109) [-603.193] (-606.043) -- 0:00:23
      622500 -- (-605.825) (-602.625) (-606.351) [-602.577] * [-603.575] (-605.066) (-604.523) (-607.705) -- 0:00:23
      623000 -- (-608.479) (-604.636) [-605.056] (-604.210) * [-604.363] (-605.764) (-605.332) (-603.691) -- 0:00:22
      623500 -- (-603.633) (-603.351) [-604.233] (-606.834) * [-603.105] (-602.757) (-608.093) (-603.185) -- 0:00:22
      624000 -- (-605.713) (-602.770) (-605.767) [-603.857] * (-603.451) (-603.900) (-602.131) [-610.136] -- 0:00:22
      624500 -- (-605.073) [-603.958] (-605.689) (-603.692) * [-603.781] (-604.069) (-602.070) (-606.326) -- 0:00:22
      625000 -- (-603.698) [-604.301] (-606.510) (-604.504) * (-604.963) [-605.335] (-603.748) (-604.672) -- 0:00:22

      Average standard deviation of split frequencies: 0.007430

      625500 -- (-603.328) [-602.452] (-603.378) (-603.262) * (-611.488) (-602.422) (-604.155) [-603.794] -- 0:00:22
      626000 -- (-602.110) (-603.182) [-605.073] (-603.674) * (-607.506) [-602.601] (-602.221) (-606.394) -- 0:00:22
      626500 -- (-608.509) [-604.539] (-604.299) (-604.367) * (-605.826) [-602.790] (-602.434) (-606.323) -- 0:00:22
      627000 -- (-604.752) (-604.811) (-602.506) [-605.580] * [-604.888] (-605.128) (-605.431) (-602.709) -- 0:00:22
      627500 -- (-606.544) (-603.810) (-607.146) [-605.909] * (-605.246) [-603.693] (-607.051) (-602.644) -- 0:00:22
      628000 -- [-605.713] (-606.143) (-602.091) (-605.343) * [-605.058] (-605.207) (-604.484) (-604.199) -- 0:00:22
      628500 -- [-604.898] (-605.061) (-602.721) (-611.933) * (-604.654) (-608.282) (-605.671) [-605.011] -- 0:00:22
      629000 -- (-604.502) (-602.732) [-602.691] (-613.888) * [-602.805] (-603.782) (-604.444) (-602.591) -- 0:00:22
      629500 -- (-602.320) [-602.048] (-608.307) (-602.593) * (-602.482) (-606.386) [-606.737] (-608.617) -- 0:00:22
      630000 -- (-603.543) (-604.011) (-608.105) [-605.768] * [-603.828] (-602.262) (-605.866) (-606.197) -- 0:00:22

      Average standard deviation of split frequencies: 0.007425

      630500 -- (-608.149) (-603.762) [-603.995] (-602.291) * [-604.078] (-605.631) (-602.131) (-603.777) -- 0:00:22
      631000 -- (-603.054) (-606.568) (-603.098) [-603.574] * (-604.296) (-605.815) (-604.435) [-604.702] -- 0:00:22
      631500 -- (-607.404) (-605.361) [-605.702] (-603.161) * (-602.331) (-605.644) (-605.827) [-603.544] -- 0:00:22
      632000 -- (-606.759) (-604.240) [-603.482] (-604.642) * (-606.233) (-604.695) [-603.938] (-603.426) -- 0:00:22
      632500 -- (-604.198) [-603.941] (-603.971) (-603.761) * (-603.295) [-604.647] (-603.787) (-604.766) -- 0:00:22
      633000 -- (-607.905) [-603.589] (-603.853) (-601.989) * (-606.139) (-603.281) [-603.338] (-604.505) -- 0:00:22
      633500 -- (-604.478) (-603.203) [-606.180] (-603.070) * (-604.591) [-605.335] (-605.333) (-606.513) -- 0:00:22
      634000 -- (-603.767) (-604.630) (-606.099) [-603.231] * (-604.432) (-604.901) (-605.571) [-604.514] -- 0:00:22
      634500 -- (-602.794) (-604.564) (-605.859) [-603.253] * (-606.172) [-605.934] (-602.752) (-603.886) -- 0:00:22
      635000 -- [-602.486] (-605.261) (-603.540) (-603.006) * (-605.672) [-605.044] (-605.179) (-603.100) -- 0:00:22

      Average standard deviation of split frequencies: 0.007560

      635500 -- (-604.606) [-602.582] (-610.859) (-605.246) * (-603.730) [-605.051] (-603.991) (-609.587) -- 0:00:22
      636000 -- (-605.760) [-603.901] (-609.080) (-603.424) * [-604.018] (-604.027) (-603.920) (-603.003) -- 0:00:22
      636500 -- [-605.304] (-605.299) (-611.747) (-605.824) * (-611.600) (-605.729) [-602.134] (-603.897) -- 0:00:22
      637000 -- (-605.218) [-606.186] (-603.227) (-603.895) * (-603.393) (-602.980) (-609.100) [-605.192] -- 0:00:22
      637500 -- (-606.996) (-603.942) [-603.700] (-604.973) * [-602.262] (-603.198) (-605.422) (-606.948) -- 0:00:22
      638000 -- (-610.799) (-603.362) [-602.826] (-602.804) * (-602.614) (-603.895) [-603.855] (-605.051) -- 0:00:22
      638500 -- (-602.243) (-602.027) [-602.641] (-604.531) * (-602.186) [-602.101] (-602.174) (-603.151) -- 0:00:22
      639000 -- (-606.533) [-606.080] (-603.037) (-602.492) * (-601.849) (-604.315) [-602.311] (-602.910) -- 0:00:22
      639500 -- [-604.613] (-605.433) (-604.325) (-604.551) * [-606.402] (-602.669) (-605.721) (-602.444) -- 0:00:21
      640000 -- (-604.319) (-604.307) [-604.650] (-606.996) * (-606.763) [-604.783] (-604.368) (-602.910) -- 0:00:21

      Average standard deviation of split frequencies: 0.008437

      640500 -- (-603.053) (-603.899) [-603.586] (-608.665) * (-602.892) [-603.235] (-605.121) (-602.665) -- 0:00:21
      641000 -- [-603.034] (-602.863) (-603.412) (-605.425) * (-604.092) (-602.216) (-605.400) [-602.807] -- 0:00:21
      641500 -- [-603.906] (-606.719) (-607.232) (-606.217) * (-602.754) (-602.466) [-606.477] (-604.208) -- 0:00:21
      642000 -- (-603.417) [-602.181] (-604.971) (-608.222) * (-603.438) [-606.631] (-603.389) (-606.542) -- 0:00:21
      642500 -- [-604.296] (-603.594) (-602.956) (-602.592) * [-604.618] (-606.273) (-604.505) (-603.193) -- 0:00:21
      643000 -- (-605.685) (-605.401) (-603.792) [-602.367] * [-603.370] (-602.706) (-606.645) (-602.270) -- 0:00:21
      643500 -- (-603.675) (-603.499) [-604.160] (-604.520) * (-605.504) (-604.705) (-607.114) [-602.983] -- 0:00:21
      644000 -- (-603.043) [-603.279] (-604.206) (-605.626) * (-605.112) (-604.131) (-604.014) [-603.592] -- 0:00:21
      644500 -- (-604.310) (-602.591) (-606.225) [-604.840] * (-604.153) [-603.557] (-606.356) (-603.339) -- 0:00:21
      645000 -- (-603.326) (-604.729) [-604.735] (-604.356) * (-603.756) [-610.746] (-602.362) (-603.903) -- 0:00:21

      Average standard deviation of split frequencies: 0.009000

      645500 -- [-603.946] (-602.734) (-603.694) (-605.196) * (-610.115) (-603.305) [-605.078] (-602.411) -- 0:00:21
      646000 -- [-602.830] (-605.100) (-605.861) (-605.215) * (-605.077) [-603.425] (-605.407) (-602.923) -- 0:00:21
      646500 -- (-603.000) (-607.109) (-606.073) [-604.058] * (-604.848) [-607.285] (-603.468) (-603.682) -- 0:00:21
      647000 -- (-602.895) [-601.811] (-603.948) (-603.193) * (-605.785) (-605.980) [-604.416] (-605.578) -- 0:00:21
      647500 -- (-604.813) [-603.548] (-602.901) (-605.458) * (-603.711) (-606.214) (-604.208) [-603.988] -- 0:00:21
      648000 -- [-605.535] (-604.772) (-605.156) (-603.636) * [-603.956] (-607.249) (-603.342) (-603.829) -- 0:00:21
      648500 -- (-606.161) (-605.198) (-605.523) [-604.721] * [-602.945] (-607.264) (-602.094) (-606.961) -- 0:00:21
      649000 -- (-603.452) (-603.095) [-602.798] (-602.245) * (-603.538) (-602.693) [-603.546] (-603.863) -- 0:00:21
      649500 -- (-602.606) (-603.577) (-602.982) [-601.912] * (-602.617) (-603.508) [-605.429] (-602.271) -- 0:00:21
      650000 -- (-604.549) (-603.255) [-602.716] (-604.278) * (-603.229) [-604.278] (-603.138) (-604.798) -- 0:00:21

      Average standard deviation of split frequencies: 0.009225

      650500 -- (-604.246) [-603.548] (-602.677) (-607.633) * (-603.559) (-604.536) [-604.442] (-608.781) -- 0:00:21
      651000 -- (-601.962) [-606.479] (-602.288) (-606.459) * (-603.943) [-604.713] (-606.768) (-605.190) -- 0:00:21
      651500 -- (-605.239) (-604.115) (-608.442) [-604.815] * (-604.278) (-605.226) [-605.222] (-603.169) -- 0:00:21
      652000 -- (-605.828) (-604.350) (-608.638) [-602.966] * (-604.117) (-603.794) (-603.759) [-602.480] -- 0:00:21
      652500 -- (-602.366) (-602.983) [-603.655] (-603.761) * (-604.058) (-603.229) (-604.541) [-604.252] -- 0:00:21
      653000 -- (-604.730) [-605.419] (-608.134) (-604.163) * (-605.538) (-604.959) [-603.370] (-606.454) -- 0:00:21
      653500 -- (-603.189) (-602.427) [-603.561] (-605.156) * (-604.927) (-602.734) [-606.863] (-603.511) -- 0:00:21
      654000 -- [-605.068] (-602.217) (-603.371) (-607.784) * (-604.932) [-603.999] (-603.650) (-602.908) -- 0:00:21
      654500 -- (-609.607) [-602.664] (-602.996) (-604.928) * [-602.359] (-605.504) (-603.435) (-603.238) -- 0:00:21
      655000 -- (-602.067) [-603.388] (-604.802) (-606.934) * (-602.175) [-604.845] (-603.564) (-602.621) -- 0:00:21

      Average standard deviation of split frequencies: 0.009581

      655500 -- (-605.186) (-603.379) [-604.463] (-603.025) * (-602.035) [-603.670] (-602.780) (-603.853) -- 0:00:21
      656000 -- (-604.897) (-603.283) (-608.913) [-603.601] * [-604.245] (-603.592) (-606.689) (-604.712) -- 0:00:20
      656500 -- [-605.686] (-604.580) (-609.015) (-604.378) * [-603.581] (-606.950) (-602.893) (-602.594) -- 0:00:20
      657000 -- [-604.412] (-602.545) (-602.823) (-603.004) * (-605.565) [-604.232] (-603.870) (-604.495) -- 0:00:20
      657500 -- (-607.070) (-603.302) [-603.566] (-603.355) * (-606.898) (-602.663) [-605.932] (-605.641) -- 0:00:20
      658000 -- (-604.405) (-602.502) (-604.341) [-602.860] * [-603.716] (-603.384) (-605.686) (-602.725) -- 0:00:20
      658500 -- (-602.274) [-602.594] (-605.833) (-603.997) * (-602.930) (-603.405) [-602.890] (-604.894) -- 0:00:20
      659000 -- (-601.851) [-604.581] (-605.274) (-603.429) * [-604.791] (-602.617) (-611.756) (-605.817) -- 0:00:20
      659500 -- (-603.271) (-608.585) (-604.656) [-604.157] * (-607.298) (-602.439) [-603.978] (-608.080) -- 0:00:20
      660000 -- (-609.527) (-605.217) (-602.230) [-602.843] * (-605.356) [-605.500] (-603.205) (-605.607) -- 0:00:20

      Average standard deviation of split frequencies: 0.009228

      660500 -- (-610.030) [-605.359] (-608.348) (-604.397) * (-604.074) [-603.133] (-605.286) (-604.084) -- 0:00:20
      661000 -- [-605.152] (-605.624) (-607.804) (-608.195) * (-606.341) (-603.594) [-602.510] (-604.798) -- 0:00:20
      661500 -- (-605.023) (-611.894) [-602.319] (-602.962) * [-604.537] (-604.418) (-604.048) (-604.283) -- 0:00:20
      662000 -- (-604.124) [-605.318] (-604.189) (-605.420) * (-605.563) (-604.160) [-605.247] (-603.642) -- 0:00:20
      662500 -- [-603.161] (-603.632) (-603.948) (-606.746) * (-606.054) [-603.194] (-605.024) (-604.488) -- 0:00:20
      663000 -- (-604.188) [-602.110] (-607.278) (-603.423) * [-603.180] (-603.856) (-603.015) (-604.263) -- 0:00:20
      663500 -- [-607.010] (-606.386) (-605.130) (-604.409) * (-604.313) (-603.609) [-602.609] (-608.300) -- 0:00:20
      664000 -- (-602.799) [-605.406] (-605.727) (-603.667) * (-603.590) (-602.287) [-602.105] (-604.530) -- 0:00:20
      664500 -- (-604.049) (-609.543) [-602.870] (-607.002) * (-602.548) (-605.760) [-602.080] (-604.376) -- 0:00:20
      665000 -- (-603.827) (-603.870) (-605.394) [-605.578] * (-602.500) (-603.735) (-603.077) [-603.517] -- 0:00:20

      Average standard deviation of split frequencies: 0.008918

      665500 -- [-604.365] (-603.966) (-608.648) (-606.762) * [-604.525] (-604.111) (-604.756) (-608.189) -- 0:00:20
      666000 -- (-604.011) (-605.240) (-607.651) [-602.557] * (-605.548) (-603.744) (-602.347) [-604.515] -- 0:00:20
      666500 -- (-602.987) (-602.912) (-603.371) [-604.282] * (-604.663) (-603.970) (-609.224) [-602.928] -- 0:00:20
      667000 -- (-602.987) (-604.623) [-604.465] (-602.032) * [-603.720] (-603.969) (-603.084) (-603.498) -- 0:00:20
      667500 -- [-602.167] (-604.458) (-604.808) (-603.058) * (-603.522) (-604.210) [-604.436] (-602.849) -- 0:00:20
      668000 -- (-608.249) (-604.960) [-603.453] (-602.003) * (-604.144) [-603.796] (-604.980) (-603.588) -- 0:00:20
      668500 -- (-604.449) (-608.980) [-604.187] (-602.733) * (-608.319) (-604.755) [-604.699] (-603.903) -- 0:00:20
      669000 -- [-604.906] (-607.848) (-605.107) (-604.729) * [-602.090] (-604.072) (-608.138) (-603.353) -- 0:00:20
      669500 -- (-606.584) [-604.579] (-608.704) (-603.733) * (-603.265) [-603.537] (-607.834) (-604.014) -- 0:00:20
      670000 -- [-602.636] (-604.791) (-604.609) (-603.054) * (-603.629) [-603.758] (-606.420) (-603.690) -- 0:00:20

      Average standard deviation of split frequencies: 0.008435

      670500 -- (-604.187) [-604.171] (-604.174) (-603.036) * (-604.935) (-605.100) (-607.225) [-602.677] -- 0:00:20
      671000 -- (-605.494) (-607.809) (-605.125) [-604.455] * [-602.673] (-602.623) (-604.216) (-602.958) -- 0:00:20
      671500 -- [-604.213] (-606.871) (-605.309) (-603.537) * (-602.683) (-603.981) (-603.769) [-603.396] -- 0:00:20
      672000 -- (-604.140) (-604.045) (-603.977) [-602.352] * [-603.138] (-606.535) (-607.470) (-604.260) -- 0:00:20
      672500 -- [-607.944] (-603.383) (-605.303) (-603.834) * (-603.366) (-604.306) (-605.286) [-602.952] -- 0:00:19
      673000 -- (-605.494) (-603.828) (-604.082) [-602.484] * (-604.978) [-603.304] (-603.714) (-603.352) -- 0:00:19
      673500 -- (-602.807) (-605.179) (-613.562) [-605.176] * (-604.375) [-602.083] (-603.170) (-604.764) -- 0:00:19
      674000 -- (-606.632) (-606.326) [-605.284] (-603.856) * [-605.599] (-602.769) (-605.892) (-603.253) -- 0:00:19
      674500 -- [-602.344] (-605.185) (-606.541) (-604.956) * (-603.533) (-602.819) [-605.093] (-603.553) -- 0:00:19
      675000 -- (-603.786) (-605.157) (-602.884) [-604.980] * (-606.206) [-602.441] (-605.391) (-603.048) -- 0:00:19

      Average standard deviation of split frequencies: 0.008461

      675500 -- (-603.610) (-606.618) (-606.095) [-604.656] * [-603.003] (-602.558) (-606.001) (-602.738) -- 0:00:19
      676000 -- (-603.289) (-603.720) [-602.701] (-602.378) * (-604.490) (-604.589) (-602.354) [-602.104] -- 0:00:19
      676500 -- [-604.379] (-602.595) (-604.212) (-604.271) * [-603.088] (-603.957) (-601.796) (-610.006) -- 0:00:19
      677000 -- (-603.141) (-603.523) (-604.213) [-604.115] * [-603.913] (-603.775) (-602.776) (-607.418) -- 0:00:19
      677500 -- (-602.931) (-604.573) [-603.257] (-602.294) * (-605.492) (-603.250) (-605.223) [-606.180] -- 0:00:19
      678000 -- (-604.759) (-605.120) (-603.355) [-603.076] * (-605.535) (-605.110) (-603.754) [-603.688] -- 0:00:19
      678500 -- (-603.815) (-606.204) (-604.030) [-603.436] * (-604.325) (-601.891) (-606.743) [-605.799] -- 0:00:19
      679000 -- (-603.636) [-604.200] (-603.260) (-606.279) * (-603.615) (-604.216) (-607.255) [-606.139] -- 0:00:19
      679500 -- (-608.041) (-604.172) [-602.507] (-605.241) * [-604.735] (-604.630) (-603.572) (-606.086) -- 0:00:19
      680000 -- (-604.585) (-605.340) (-604.664) [-605.498] * (-603.989) (-603.660) [-602.912] (-603.145) -- 0:00:19

      Average standard deviation of split frequencies: 0.008726

      680500 -- (-603.745) [-604.983] (-607.258) (-604.465) * [-603.150] (-602.522) (-607.660) (-603.847) -- 0:00:19
      681000 -- [-603.191] (-603.423) (-605.337) (-604.931) * (-607.351) (-602.107) [-604.811] (-604.597) -- 0:00:19
      681500 -- (-604.236) [-602.390] (-603.431) (-606.496) * (-609.467) (-602.890) (-606.760) [-602.212] -- 0:00:19
      682000 -- (-603.794) [-605.661] (-603.445) (-603.721) * (-605.699) [-605.142] (-607.046) (-602.175) -- 0:00:19
      682500 -- (-608.567) (-605.937) (-607.658) [-603.952] * [-604.690] (-604.861) (-602.661) (-603.665) -- 0:00:19
      683000 -- (-611.407) [-605.299] (-606.120) (-604.967) * (-604.537) [-603.119] (-604.946) (-604.560) -- 0:00:19
      683500 -- (-605.638) (-603.854) [-611.149] (-607.730) * (-603.740) (-605.245) (-605.377) [-604.612] -- 0:00:19
      684000 -- [-605.231] (-602.516) (-602.856) (-603.068) * (-603.843) (-605.596) (-606.180) [-604.045] -- 0:00:19
      684500 -- (-604.259) (-602.947) [-604.859] (-604.688) * (-602.876) (-603.723) [-603.907] (-604.312) -- 0:00:19
      685000 -- (-603.348) (-604.752) [-605.702] (-610.943) * (-604.304) [-604.366] (-606.931) (-608.363) -- 0:00:19

      Average standard deviation of split frequencies: 0.008842

      685500 -- (-604.544) (-605.456) (-603.414) [-607.485] * [-602.530] (-604.917) (-604.770) (-603.704) -- 0:00:19
      686000 -- (-604.046) (-602.901) (-603.870) [-604.136] * [-602.625] (-609.494) (-605.391) (-603.761) -- 0:00:19
      686500 -- (-603.585) (-602.411) (-604.972) [-604.067] * [-603.396] (-609.442) (-604.059) (-602.380) -- 0:00:19
      687000 -- (-606.598) (-603.836) (-603.050) [-602.372] * (-603.399) (-604.970) [-603.612] (-606.476) -- 0:00:19
      687500 -- (-608.646) (-603.580) [-603.052] (-605.048) * (-603.384) [-604.894] (-603.963) (-605.064) -- 0:00:19
      688000 -- [-606.738] (-603.574) (-603.039) (-604.023) * [-604.009] (-604.967) (-602.553) (-603.807) -- 0:00:19
      688500 -- [-601.923] (-602.436) (-602.615) (-604.722) * (-603.342) (-604.908) (-605.741) [-605.852] -- 0:00:19
      689000 -- [-602.476] (-604.782) (-603.684) (-605.279) * (-602.940) [-604.124] (-604.422) (-607.089) -- 0:00:18
      689500 -- [-602.974] (-603.821) (-603.654) (-604.403) * [-603.359] (-610.193) (-607.263) (-604.596) -- 0:00:18
      690000 -- (-605.366) [-603.525] (-604.517) (-602.257) * (-603.214) (-608.441) [-604.102] (-604.793) -- 0:00:18

      Average standard deviation of split frequencies: 0.008691

      690500 -- [-604.732] (-608.877) (-602.010) (-605.058) * [-602.621] (-606.339) (-603.600) (-605.386) -- 0:00:18
      691000 -- (-602.972) (-608.334) (-603.718) [-604.639] * (-602.631) (-604.428) [-603.520] (-602.590) -- 0:00:18
      691500 -- (-603.759) (-607.242) (-603.942) [-606.127] * (-606.770) [-602.373] (-603.719) (-604.268) -- 0:00:18
      692000 -- (-605.272) [-604.087] (-607.174) (-605.776) * [-609.858] (-602.621) (-602.831) (-604.102) -- 0:00:18
      692500 -- (-603.015) (-603.507) (-603.824) [-602.864] * (-609.530) [-602.647] (-606.660) (-603.417) -- 0:00:18
      693000 -- (-602.871) (-609.172) [-606.422] (-604.876) * (-605.517) [-603.389] (-602.017) (-604.313) -- 0:00:18
      693500 -- (-603.714) (-603.463) (-605.851) [-605.023] * (-603.335) (-609.089) [-602.329] (-607.077) -- 0:00:18
      694000 -- (-603.493) [-603.958] (-605.534) (-603.767) * (-606.315) (-606.297) [-602.594] (-603.240) -- 0:00:18
      694500 -- (-605.987) [-603.402] (-610.164) (-604.903) * (-606.731) (-605.037) (-603.839) [-606.100] -- 0:00:18
      695000 -- (-602.921) [-603.437] (-605.681) (-607.138) * (-606.614) (-607.311) [-603.938] (-605.271) -- 0:00:18

      Average standard deviation of split frequencies: 0.008940

      695500 -- [-603.383] (-605.711) (-604.526) (-606.509) * (-603.832) (-607.061) (-604.632) [-604.586] -- 0:00:18
      696000 -- [-603.213] (-607.881) (-602.625) (-602.716) * (-603.150) [-604.595] (-603.732) (-603.232) -- 0:00:18
      696500 -- [-603.256] (-608.165) (-603.605) (-603.051) * (-607.640) [-603.775] (-603.921) (-603.448) -- 0:00:18
      697000 -- [-602.624] (-605.554) (-605.199) (-604.065) * (-605.712) (-603.758) [-604.036] (-603.538) -- 0:00:18
      697500 -- (-602.920) (-605.046) (-607.592) [-605.661] * (-605.362) [-602.394] (-603.437) (-604.429) -- 0:00:18
      698000 -- (-606.948) [-602.505] (-604.877) (-608.432) * (-610.571) [-605.404] (-603.122) (-604.715) -- 0:00:18
      698500 -- (-603.789) (-604.350) (-604.520) [-601.952] * [-603.334] (-602.787) (-604.812) (-603.264) -- 0:00:18
      699000 -- (-605.163) (-607.127) (-607.541) [-604.437] * (-605.735) [-602.785] (-602.231) (-603.508) -- 0:00:18
      699500 -- (-604.267) [-604.716] (-602.347) (-603.613) * (-607.149) (-604.891) (-601.873) [-602.293] -- 0:00:18
      700000 -- (-604.748) [-601.891] (-604.224) (-603.026) * (-603.935) (-604.227) (-605.586) [-603.894] -- 0:00:18

      Average standard deviation of split frequencies: 0.008971

      700500 -- (-603.128) (-603.911) [-602.528] (-603.083) * (-604.641) (-603.013) (-602.672) [-606.017] -- 0:00:18
      701000 -- (-604.571) (-602.950) [-602.610] (-604.179) * (-602.330) [-603.367] (-603.587) (-605.095) -- 0:00:18
      701500 -- (-602.648) (-603.762) [-603.423] (-612.088) * (-605.357) (-602.993) [-602.886] (-604.174) -- 0:00:18
      702000 -- [-602.903] (-608.098) (-603.710) (-607.733) * (-605.556) (-606.646) [-605.525] (-603.616) -- 0:00:18
      702500 -- (-603.761) (-605.053) (-608.507) [-603.710] * (-603.826) (-602.824) [-602.826] (-602.486) -- 0:00:18
      703000 -- (-607.177) [-603.581] (-602.718) (-602.311) * (-604.501) [-604.286] (-602.128) (-602.455) -- 0:00:18
      703500 -- (-605.433) [-607.079] (-603.989) (-605.140) * (-603.919) (-603.564) (-605.404) [-607.135] -- 0:00:18
      704000 -- [-603.645] (-603.473) (-603.432) (-602.429) * (-603.857) (-603.435) [-605.614] (-608.093) -- 0:00:18
      704500 -- (-603.018) (-608.670) [-603.759] (-607.303) * (-603.505) [-602.431] (-605.337) (-606.756) -- 0:00:18
      705000 -- (-603.656) (-606.591) (-602.283) [-605.309] * (-602.948) (-602.697) [-603.226] (-606.955) -- 0:00:17

      Average standard deviation of split frequencies: 0.008903

      705500 -- (-602.217) (-602.686) (-605.818) [-602.049] * (-603.568) [-603.138] (-602.209) (-603.546) -- 0:00:17
      706000 -- (-603.011) (-603.097) [-603.376] (-604.897) * [-602.503] (-602.913) (-607.060) (-602.902) -- 0:00:17
      706500 -- [-608.508] (-604.407) (-602.556) (-609.782) * (-605.446) (-604.322) (-608.429) [-602.929] -- 0:00:17
      707000 -- (-606.587) (-602.877) (-602.534) [-603.794] * (-603.968) (-607.237) (-604.186) [-602.261] -- 0:00:17
      707500 -- (-604.509) (-605.564) (-606.941) [-603.514] * (-603.696) [-605.325] (-602.970) (-603.518) -- 0:00:17
      708000 -- (-604.657) (-606.307) (-605.960) [-603.754] * [-603.438] (-604.255) (-605.171) (-607.884) -- 0:00:17
      708500 -- (-605.840) [-605.425] (-607.225) (-604.680) * (-606.479) (-603.926) (-604.114) [-602.409] -- 0:00:17
      709000 -- (-610.615) [-606.324] (-606.170) (-603.637) * [-603.730] (-604.569) (-603.405) (-602.933) -- 0:00:17
      709500 -- (-605.327) [-605.820] (-602.569) (-604.465) * [-602.613] (-605.348) (-604.578) (-604.173) -- 0:00:17
      710000 -- (-605.525) (-607.608) [-602.141] (-604.720) * (-604.569) [-603.166] (-603.275) (-602.759) -- 0:00:17

      Average standard deviation of split frequencies: 0.009021

      710500 -- (-602.705) (-603.098) [-602.746] (-603.748) * (-609.250) (-608.237) [-602.179] (-602.497) -- 0:00:17
      711000 -- (-606.491) (-604.927) (-603.266) [-602.318] * [-607.129] (-602.295) (-605.113) (-602.345) -- 0:00:17
      711500 -- (-605.597) (-602.713) [-603.448] (-604.700) * (-602.402) (-603.406) (-605.123) [-602.713] -- 0:00:17
      712000 -- (-603.092) (-606.972) (-603.814) [-604.756] * [-603.651] (-604.997) (-602.838) (-605.108) -- 0:00:17
      712500 -- (-604.903) (-604.739) [-603.601] (-604.439) * [-602.369] (-603.726) (-604.525) (-605.977) -- 0:00:17
      713000 -- (-606.020) [-603.012] (-603.669) (-602.468) * (-603.441) [-603.822] (-605.859) (-604.613) -- 0:00:17
      713500 -- (-605.447) (-606.238) [-604.420] (-603.583) * (-604.458) (-606.939) [-603.042] (-606.936) -- 0:00:17
      714000 -- (-606.741) (-604.887) (-607.684) [-603.401] * (-602.518) [-604.810] (-606.098) (-604.443) -- 0:00:17
      714500 -- [-601.967] (-603.734) (-604.348) (-603.554) * (-604.383) [-604.302] (-603.889) (-603.292) -- 0:00:17
      715000 -- (-607.738) [-604.901] (-605.223) (-604.187) * (-603.000) (-602.881) (-606.261) [-602.841] -- 0:00:17

      Average standard deviation of split frequencies: 0.008971

      715500 -- (-605.974) (-605.156) (-602.394) [-606.945] * (-604.097) (-604.807) (-604.767) [-603.663] -- 0:00:17
      716000 -- (-605.310) (-605.393) [-603.724] (-607.235) * (-606.766) [-606.603] (-602.223) (-606.908) -- 0:00:17
      716500 -- (-606.382) [-603.447] (-602.330) (-608.369) * (-604.138) (-603.016) (-602.886) [-606.674] -- 0:00:17
      717000 -- (-608.371) (-604.559) [-603.055] (-603.341) * (-603.817) (-603.514) [-603.597] (-606.760) -- 0:00:17
      717500 -- (-610.417) [-603.601] (-605.344) (-608.032) * [-603.593] (-604.391) (-602.245) (-604.389) -- 0:00:17
      718000 -- (-605.734) [-604.749] (-604.648) (-605.612) * [-603.162] (-605.553) (-604.028) (-605.642) -- 0:00:17
      718500 -- (-605.490) (-603.599) (-603.587) [-605.023] * (-601.952) (-602.662) [-605.289] (-603.613) -- 0:00:17
      719000 -- (-606.059) (-606.478) (-611.247) [-602.801] * [-601.955] (-604.058) (-606.892) (-602.659) -- 0:00:17
      719500 -- (-606.666) [-607.030] (-607.715) (-604.838) * (-601.878) [-603.664] (-605.568) (-601.990) -- 0:00:17
      720000 -- (-606.673) (-606.948) (-603.572) [-603.820] * [-602.161] (-603.626) (-602.772) (-602.174) -- 0:00:17

      Average standard deviation of split frequencies: 0.008619

      720500 -- [-603.729] (-604.419) (-603.283) (-603.295) * (-602.458) [-606.317] (-602.867) (-602.411) -- 0:00:17
      721000 -- (-603.546) (-605.326) [-606.339] (-602.677) * (-603.471) (-607.345) (-602.870) [-604.436] -- 0:00:17
      721500 -- (-608.799) (-602.783) (-607.940) [-603.904] * (-602.721) (-605.547) [-604.425] (-603.458) -- 0:00:16
      722000 -- (-610.514) [-608.083] (-603.659) (-603.153) * (-602.683) (-604.706) [-607.938] (-603.819) -- 0:00:16
      722500 -- (-606.176) (-602.730) [-605.697] (-603.859) * (-609.730) (-604.740) [-602.982] (-603.097) -- 0:00:16
      723000 -- (-602.801) [-602.755] (-604.879) (-608.803) * (-609.455) [-602.749] (-607.219) (-603.423) -- 0:00:16
      723500 -- (-605.658) [-604.241] (-606.165) (-603.033) * (-605.992) (-604.700) [-605.423] (-603.748) -- 0:00:16
      724000 -- (-605.684) (-602.835) (-603.540) [-602.467] * (-605.481) (-605.870) (-604.042) [-604.055] -- 0:00:16
      724500 -- (-604.851) (-603.206) [-605.568] (-602.537) * (-605.629) [-604.479] (-603.449) (-605.593) -- 0:00:16
      725000 -- (-608.942) [-607.008] (-605.289) (-603.731) * (-607.563) (-603.484) [-606.764] (-604.474) -- 0:00:16

      Average standard deviation of split frequencies: 0.008594

      725500 -- (-605.207) (-603.858) [-606.419] (-606.088) * (-608.382) [-604.831] (-602.593) (-604.188) -- 0:00:16
      726000 -- [-603.180] (-603.489) (-604.276) (-605.726) * (-604.252) (-609.888) [-606.883] (-603.951) -- 0:00:16
      726500 -- (-605.104) [-604.213] (-604.709) (-605.350) * (-604.126) (-604.926) (-603.947) [-604.552] -- 0:00:16
      727000 -- [-604.319] (-606.773) (-607.733) (-608.867) * (-605.540) (-607.525) (-603.946) [-603.818] -- 0:00:16
      727500 -- [-603.856] (-604.563) (-605.520) (-607.746) * (-602.314) [-603.665] (-603.630) (-606.056) -- 0:00:16
      728000 -- (-604.722) (-606.958) [-603.865] (-605.236) * [-607.508] (-603.011) (-602.825) (-604.698) -- 0:00:16
      728500 -- (-605.798) [-609.191] (-606.834) (-604.506) * (-604.262) (-603.276) (-602.944) [-605.247] -- 0:00:16
      729000 -- (-603.757) (-607.599) [-602.852] (-605.427) * (-604.748) (-605.050) (-603.914) [-603.915] -- 0:00:16
      729500 -- (-604.020) [-604.927] (-604.392) (-604.197) * [-603.583] (-608.279) (-603.547) (-604.754) -- 0:00:16
      730000 -- (-604.908) [-607.993] (-607.253) (-604.168) * (-605.587) (-604.704) [-605.079] (-605.185) -- 0:00:16

      Average standard deviation of split frequencies: 0.009153

      730500 -- [-604.380] (-607.186) (-609.125) (-605.196) * (-601.869) (-604.499) [-604.126] (-604.286) -- 0:00:16
      731000 -- (-605.999) [-604.953] (-607.239) (-604.808) * (-602.722) [-602.419] (-603.995) (-604.782) -- 0:00:16
      731500 -- [-604.027] (-607.003) (-606.720) (-605.163) * (-602.039) [-602.676] (-604.045) (-605.210) -- 0:00:16
      732000 -- [-603.686] (-607.613) (-606.153) (-604.386) * (-602.421) [-602.194] (-607.094) (-603.066) -- 0:00:16
      732500 -- (-604.907) (-607.188) (-603.411) [-603.480] * (-603.448) (-608.464) (-605.142) [-605.384] -- 0:00:16
      733000 -- (-604.744) (-604.400) (-606.325) [-603.302] * (-603.373) [-602.855] (-604.133) (-609.624) -- 0:00:16
      733500 -- (-606.290) [-605.494] (-603.426) (-604.052) * [-603.165] (-604.674) (-604.847) (-605.247) -- 0:00:16
      734000 -- (-603.185) [-602.615] (-603.391) (-605.172) * (-603.893) [-608.765] (-602.454) (-605.513) -- 0:00:16
      734500 -- [-606.809] (-602.983) (-604.245) (-603.856) * [-604.791] (-610.191) (-604.416) (-602.644) -- 0:00:16
      735000 -- (-604.966) (-603.124) [-602.941] (-602.876) * (-605.516) (-606.030) (-602.748) [-602.729] -- 0:00:16

      Average standard deviation of split frequencies: 0.008967

      735500 -- [-605.545] (-606.367) (-603.282) (-603.629) * (-605.990) (-605.287) (-603.741) [-602.836] -- 0:00:16
      736000 -- (-608.277) [-603.602] (-603.613) (-604.482) * [-606.316] (-603.000) (-605.787) (-603.644) -- 0:00:16
      736500 -- (-604.699) [-603.993] (-603.605) (-603.777) * (-604.743) [-606.062] (-605.767) (-607.505) -- 0:00:16
      737000 -- (-604.634) (-603.060) [-606.959] (-603.922) * (-606.362) (-606.957) (-608.035) [-606.449] -- 0:00:16
      737500 -- (-603.239) [-606.060] (-608.633) (-609.529) * (-604.948) (-608.956) (-602.988) [-603.002] -- 0:00:16
      738000 -- [-602.662] (-606.696) (-605.511) (-602.598) * (-604.529) (-603.666) [-603.315] (-603.195) -- 0:00:15
      738500 -- [-602.849] (-605.990) (-604.244) (-603.128) * (-603.249) [-602.901] (-603.340) (-603.793) -- 0:00:15
      739000 -- (-605.669) (-603.412) [-606.232] (-604.816) * (-607.776) (-603.569) [-603.341] (-608.484) -- 0:00:15
      739500 -- (-603.034) (-605.680) [-604.098] (-604.795) * [-602.785] (-602.781) (-605.764) (-604.925) -- 0:00:15
      740000 -- [-606.328] (-605.062) (-610.124) (-607.600) * (-604.584) [-603.788] (-604.358) (-605.322) -- 0:00:15

      Average standard deviation of split frequencies: 0.008712

      740500 -- [-605.785] (-605.039) (-607.035) (-608.515) * (-605.342) (-605.922) [-602.503] (-605.308) -- 0:00:15
      741000 -- (-602.690) [-602.578] (-606.788) (-613.410) * (-604.250) [-603.238] (-610.327) (-604.989) -- 0:00:15
      741500 -- [-603.366] (-604.318) (-608.692) (-605.221) * [-601.861] (-604.075) (-606.378) (-605.759) -- 0:00:15
      742000 -- [-603.299] (-603.664) (-602.383) (-605.384) * (-601.961) (-602.383) [-604.404] (-605.969) -- 0:00:15
      742500 -- (-603.046) [-603.485] (-605.405) (-603.084) * (-603.941) [-602.844] (-604.126) (-606.973) -- 0:00:15
      743000 -- (-604.826) (-605.196) (-604.248) [-603.760] * (-603.705) (-603.486) (-603.281) [-603.875] -- 0:00:15
      743500 -- (-603.564) (-604.330) [-603.871] (-605.113) * [-602.558] (-603.612) (-603.006) (-605.197) -- 0:00:15
      744000 -- (-604.894) (-603.793) [-605.596] (-604.297) * [-606.319] (-602.844) (-604.039) (-604.219) -- 0:00:15
      744500 -- (-603.744) (-604.581) (-604.496) [-602.951] * (-605.121) (-604.948) [-603.211] (-609.039) -- 0:00:15
      745000 -- [-602.176] (-609.053) (-603.511) (-607.695) * (-604.932) (-607.076) [-603.685] (-602.205) -- 0:00:15

      Average standard deviation of split frequencies: 0.008531

      745500 -- (-609.718) (-603.990) [-603.630] (-603.701) * (-607.348) [-603.363] (-605.211) (-610.409) -- 0:00:15
      746000 -- (-606.652) (-603.663) [-603.244] (-605.618) * [-603.270] (-604.285) (-608.406) (-604.857) -- 0:00:15
      746500 -- (-607.602) [-602.827] (-602.801) (-602.626) * (-604.802) (-602.733) [-603.776] (-606.225) -- 0:00:15
      747000 -- (-603.975) [-605.027] (-602.945) (-602.339) * (-604.718) (-608.199) [-604.693] (-602.645) -- 0:00:15
      747500 -- (-603.468) (-606.212) (-603.449) [-602.574] * (-606.769) (-602.493) (-603.611) [-603.989] -- 0:00:15
      748000 -- (-606.901) [-602.640] (-603.902) (-603.141) * (-605.702) (-605.241) (-605.354) [-603.654] -- 0:00:15
      748500 -- [-604.104] (-602.633) (-606.900) (-602.880) * [-606.220] (-606.117) (-608.217) (-607.941) -- 0:00:15
      749000 -- (-605.766) [-605.626] (-604.415) (-603.587) * (-606.710) [-604.745] (-607.419) (-604.798) -- 0:00:15
      749500 -- (-604.909) (-603.460) (-603.562) [-605.024] * (-604.815) (-605.031) [-603.309] (-607.228) -- 0:00:15
      750000 -- (-607.889) (-604.225) [-603.863] (-603.491) * (-605.572) [-603.133] (-604.722) (-606.192) -- 0:00:15

      Average standard deviation of split frequencies: 0.008831

      750500 -- (-607.122) (-603.080) (-605.328) [-604.527] * (-608.429) (-608.123) (-603.419) [-604.516] -- 0:00:15
      751000 -- (-604.275) (-602.951) [-603.602] (-606.065) * (-607.758) (-605.800) [-602.295] (-606.178) -- 0:00:15
      751500 -- [-604.651] (-604.744) (-603.368) (-604.929) * (-607.412) (-602.066) [-602.467] (-604.307) -- 0:00:15
      752000 -- (-603.556) (-604.023) [-604.353] (-605.049) * (-603.760) (-602.411) [-602.853] (-606.501) -- 0:00:15
      752500 -- (-605.280) [-605.028] (-603.976) (-611.815) * (-602.416) [-602.535] (-606.955) (-607.952) -- 0:00:15
      753000 -- (-606.542) (-603.773) [-602.096] (-606.391) * (-605.040) (-603.701) [-606.738] (-608.979) -- 0:00:15
      753500 -- [-604.783] (-605.315) (-603.783) (-605.821) * (-603.292) (-602.175) (-603.278) [-606.055] -- 0:00:15
      754000 -- (-602.518) [-611.462] (-607.079) (-607.256) * (-604.673) [-602.134] (-605.132) (-604.315) -- 0:00:15
      754500 -- [-602.112] (-606.974) (-603.648) (-606.442) * (-606.593) [-602.615] (-606.277) (-605.553) -- 0:00:14
      755000 -- (-602.856) (-607.617) [-606.429] (-606.285) * (-603.752) [-603.306] (-606.943) (-604.220) -- 0:00:14

      Average standard deviation of split frequencies: 0.0