--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:39:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplO/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -603.41 -606.69
2 -603.43 -606.48
--------------------------------------
TOTAL -603.42 -606.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884346 0.087811 0.349787 1.447047 0.851087 1243.05 1372.03 1.000
r(A<->C){all} 0.161795 0.019550 0.000101 0.445047 0.124325 171.04 200.58 1.005
r(A<->G){all} 0.169363 0.020978 0.000061 0.468438 0.130141 159.96 165.42 1.000
r(A<->T){all} 0.173305 0.021172 0.000287 0.466521 0.135033 131.47 192.24 1.000
r(C<->G){all} 0.167415 0.019454 0.000005 0.461365 0.131933 302.20 386.76 1.016
r(C<->T){all} 0.168054 0.019995 0.000007 0.459478 0.129286 157.81 266.83 1.001
r(G<->T){all} 0.160068 0.018868 0.000002 0.443485 0.124643 223.99 257.23 1.000
pi(A){all} 0.253257 0.000444 0.211013 0.292368 0.253071 1179.97 1192.86 1.000
pi(C){all} 0.267374 0.000428 0.226649 0.307353 0.267136 1093.70 1145.50 1.000
pi(G){all} 0.291612 0.000456 0.249537 0.331716 0.291285 1202.18 1278.85 1.000
pi(T){all} 0.187756 0.000351 0.152591 0.225858 0.187032 1501.00 1501.00 1.000
alpha{1,2} 0.413763 0.240434 0.000227 1.390792 0.244296 1232.55 1240.69 1.000
alpha{3} 0.467090 0.235466 0.000312 1.463892 0.301254 1307.83 1333.39 1.000
pinvar{all} 0.996365 0.000018 0.988505 0.999999 0.997777 1163.02 1185.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -585.739168
Model 2: PositiveSelection -585.739109
Model 0: one-ratio -585.739109
Model 7: beta -585.739259
Model 8: beta&w>1 -585.739108
Model 0 vs 1 1.1799999992945231E-4
Model 2 vs 1 1.1799999992945231E-4
Model 8 vs 7 3.019999999196443E-4
>C1
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C2
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C3
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C4
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C5
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C6
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
C1 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C2 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C3 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C4 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C5 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C6 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
**************************************************
C1 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C2 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C3 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C4 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C5 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C6 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
**************************************************
C1 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C2 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C3 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C4 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C5 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C6 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 146 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 146 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4380]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4380]--->[4380]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.679 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C2 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C3 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C4 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C5 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
C6 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
**************************************************
C1 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C2 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C3 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C4 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C5 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
C6 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
**************************************************
C1 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C2 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C3 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C4 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C5 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
C6 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C2 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C3 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C4 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C5 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
C6 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
**************************************************
C1 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C2 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C3 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C4 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C5 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
C6 ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
**************************************************
C1 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C2 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C3 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C4 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C5 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
C6 GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
**************************************************
C1 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C2 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C3 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C4 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C5 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
C6 GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
**************************************************
C1 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C2 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C3 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C4 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C5 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
C6 GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
**************************************************
C1 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C2 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C3 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C4 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C5 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
C6 GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
**************************************************
C1 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C2 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C3 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C4 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C5 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
C6 AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
**************************************************
C1 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C2 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C3 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C4 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C5 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
C6 GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
**************************************************
C1 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C2 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C3 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C4 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C5 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
C6 ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
**************************************
>C1
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C2
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C3
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C4
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C5
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C6
GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC
ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC
GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG
GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG
GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC
GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG
AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT
GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC
ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>C1
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C2
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C3
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C4
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C5
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
>C6
VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 438 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790315
Setting output file names to "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 200923194
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0793890995
Seed = 709819965
Swapseed = 1579790315
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -980.265000 -- -24.965149
Chain 2 -- -980.265000 -- -24.965149
Chain 3 -- -980.265000 -- -24.965149
Chain 4 -- -980.265000 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -980.264944 -- -24.965149
Chain 2 -- -980.265000 -- -24.965149
Chain 3 -- -980.264944 -- -24.965149
Chain 4 -- -980.264944 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-980.265] (-980.265) (-980.265) (-980.265) * [-980.265] (-980.265) (-980.265) (-980.265)
500 -- (-612.362) [-614.911] (-617.202) (-613.274) * [-618.244] (-608.696) (-614.677) (-609.146) -- 0:00:00
1000 -- (-615.175) [-612.662] (-617.601) (-609.740) * [-614.019] (-611.515) (-610.437) (-617.035) -- 0:00:00
1500 -- (-618.024) [-613.586] (-610.180) (-609.521) * (-611.985) (-613.614) [-612.658] (-613.951) -- 0:00:00
2000 -- (-608.654) (-612.808) [-613.871] (-616.933) * [-610.438] (-613.521) (-608.374) (-617.456) -- 0:00:00
2500 -- (-611.159) [-606.492] (-611.225) (-610.984) * (-613.611) [-610.368] (-616.933) (-609.300) -- 0:00:00
3000 -- (-618.409) (-612.713) (-608.338) [-612.180] * (-606.834) (-612.645) (-611.718) [-612.029] -- 0:00:00
3500 -- (-611.483) (-614.860) [-608.026] (-609.626) * (-614.840) (-613.085) [-616.002] (-611.289) -- 0:00:00
4000 -- (-616.525) (-611.046) [-612.390] (-608.572) * (-617.820) (-609.848) (-615.756) [-612.107] -- 0:00:00
4500 -- [-611.175] (-608.567) (-610.452) (-613.950) * [-612.083] (-619.719) (-616.158) (-617.800) -- 0:00:00
5000 -- (-616.694) (-614.390) [-613.533] (-620.411) * (-614.305) (-612.474) [-622.604] (-613.915) -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- [-610.007] (-609.406) (-613.723) (-612.336) * (-611.206) (-616.072) [-610.831] (-612.091) -- 0:00:00
6000 -- (-614.591) (-623.165) [-610.473] (-618.735) * (-611.326) (-610.238) [-610.053] (-620.504) -- 0:00:00
6500 -- (-613.701) (-611.282) [-613.789] (-617.777) * (-615.207) (-610.540) [-613.032] (-618.081) -- 0:00:00
7000 -- (-612.051) [-613.765] (-614.651) (-616.041) * (-619.024) (-612.407) (-615.309) [-614.432] -- 0:00:00
7500 -- (-616.263) (-610.165) [-621.958] (-621.194) * (-614.019) (-620.814) [-611.241] (-619.099) -- 0:00:00
8000 -- [-615.948] (-614.129) (-620.903) (-612.261) * (-615.881) (-614.131) (-610.813) [-621.921] -- 0:02:04
8500 -- (-605.092) [-612.224] (-608.582) (-614.846) * (-615.575) (-617.407) (-609.677) [-613.650] -- 0:01:56
9000 -- (-605.321) (-615.105) [-614.035] (-609.900) * (-611.492) [-614.244] (-614.654) (-607.670) -- 0:01:50
9500 -- [-603.815] (-618.723) (-609.692) (-612.163) * (-604.694) [-615.063] (-611.727) (-613.008) -- 0:01:44
10000 -- [-606.402] (-615.131) (-617.249) (-617.339) * (-604.043) (-613.660) [-620.651] (-604.481) -- 0:01:39
Average standard deviation of split frequencies: 0.058926
10500 -- [-605.612] (-624.535) (-620.643) (-608.841) * [-602.831] (-610.154) (-623.241) (-605.169) -- 0:01:34
11000 -- (-604.114) [-609.113] (-608.413) (-612.479) * (-602.983) (-608.229) [-607.291] (-602.532) -- 0:01:29
11500 -- (-607.012) (-611.958) (-611.592) [-610.609] * (-604.008) (-612.913) [-612.673] (-603.275) -- 0:01:25
12000 -- [-605.748] (-623.049) (-614.827) (-614.707) * (-605.283) (-609.404) (-621.055) [-603.708] -- 0:01:22
12500 -- (-602.246) (-608.222) (-615.292) [-613.868] * (-604.236) (-611.090) (-622.876) [-604.363] -- 0:01:19
13000 -- (-604.671) (-606.632) (-616.578) [-613.392] * (-602.313) [-609.368] (-615.772) (-604.698) -- 0:01:15
13500 -- [-603.071] (-612.503) (-612.377) (-609.783) * (-607.179) [-604.710] (-604.222) (-604.086) -- 0:01:13
14000 -- (-603.253) [-615.612] (-616.349) (-614.411) * (-607.940) (-606.958) (-603.886) [-604.163] -- 0:01:10
14500 -- (-606.925) (-617.946) [-614.672] (-616.613) * [-607.310] (-607.255) (-604.898) (-602.976) -- 0:01:07
15000 -- [-603.774] (-613.140) (-614.021) (-612.679) * (-605.668) [-603.727] (-605.208) (-604.521) -- 0:01:05
Average standard deviation of split frequencies: 0.053033
15500 -- (-602.567) (-613.364) (-613.242) [-616.177] * [-603.072] (-608.861) (-606.540) (-602.168) -- 0:01:03
16000 -- [-603.439] (-608.035) (-609.302) (-616.337) * [-602.212] (-603.598) (-603.957) (-603.919) -- 0:01:01
16500 -- (-603.031) (-622.076) (-614.215) [-609.457] * [-602.938] (-606.352) (-607.142) (-602.769) -- 0:00:59
17000 -- (-603.042) (-610.973) [-611.032] (-611.038) * (-603.041) (-603.196) [-602.047] (-602.926) -- 0:00:57
17500 -- (-607.104) [-611.742] (-613.451) (-612.742) * (-603.274) (-603.388) (-605.894) [-606.098] -- 0:00:56
18000 -- (-602.619) [-612.624] (-618.305) (-615.436) * (-611.058) [-606.054] (-604.567) (-604.762) -- 0:00:54
18500 -- (-603.277) (-608.943) [-615.822] (-616.849) * [-606.221] (-604.932) (-611.192) (-609.312) -- 0:00:53
19000 -- [-604.075] (-613.081) (-614.928) (-609.131) * (-608.553) (-603.338) [-605.892] (-611.415) -- 0:00:51
19500 -- [-605.603] (-617.995) (-612.600) (-618.389) * [-604.863] (-605.594) (-606.361) (-604.827) -- 0:00:50
20000 -- (-603.218) (-611.373) [-613.982] (-615.824) * (-604.311) (-603.346) [-606.695] (-603.012) -- 0:00:49
Average standard deviation of split frequencies: 0.062094
20500 -- [-602.818] (-616.811) (-614.691) (-622.107) * [-606.043] (-602.947) (-609.102) (-603.529) -- 0:00:47
21000 -- (-607.001) (-617.132) [-619.788] (-612.521) * (-606.171) [-602.051] (-604.764) (-604.387) -- 0:00:46
21500 -- (-606.756) (-622.070) [-607.551] (-609.748) * (-603.788) [-602.620] (-610.390) (-604.407) -- 0:00:45
22000 -- (-610.003) (-603.411) (-608.643) [-611.017] * [-602.827] (-604.181) (-605.483) (-605.714) -- 0:00:44
22500 -- (-604.012) (-607.880) [-605.002] (-618.203) * (-607.575) (-606.829) (-606.173) [-602.480] -- 0:00:43
23000 -- (-606.101) (-603.195) (-603.447) [-618.485] * (-604.736) (-604.195) (-607.692) [-604.843] -- 0:00:42
23500 -- (-603.768) (-603.962) (-603.485) [-614.593] * [-608.528] (-604.517) (-607.793) (-603.717) -- 0:00:41
24000 -- [-604.497] (-604.930) (-602.772) (-622.281) * (-607.344) (-606.388) [-604.726] (-604.629) -- 0:00:40
24500 -- [-602.591] (-605.251) (-602.540) (-610.285) * (-606.477) (-605.762) [-605.818] (-605.267) -- 0:00:39
25000 -- (-603.544) [-604.279] (-602.633) (-614.852) * (-606.094) (-602.724) [-603.755] (-606.750) -- 0:01:18
Average standard deviation of split frequencies: 0.046759
25500 -- (-606.831) (-607.279) (-606.832) [-612.328] * (-604.276) (-608.561) [-606.325] (-602.163) -- 0:01:16
26000 -- [-605.585] (-602.397) (-602.915) (-619.739) * (-603.564) (-603.818) (-603.522) [-602.377] -- 0:01:14
26500 -- [-606.266] (-604.931) (-604.398) (-609.747) * (-603.957) (-604.735) [-603.504] (-604.352) -- 0:01:13
27000 -- [-603.593] (-603.329) (-607.374) (-623.470) * (-602.721) (-606.186) [-602.129] (-608.101) -- 0:01:12
27500 -- [-604.015] (-604.171) (-606.311) (-635.569) * (-602.383) (-608.280) (-602.883) [-603.455] -- 0:01:10
28000 -- (-604.867) (-604.064) (-605.251) [-621.353] * (-603.375) [-603.889] (-607.267) (-605.717) -- 0:01:09
28500 -- (-606.219) (-603.396) (-603.194) [-608.466] * (-603.396) (-602.767) [-606.261] (-605.594) -- 0:01:08
29000 -- [-605.284] (-603.273) (-603.628) (-609.691) * (-604.518) (-605.731) [-604.469] (-604.021) -- 0:01:06
29500 -- (-603.884) [-603.949] (-603.284) (-617.705) * (-605.093) (-606.185) (-604.489) [-606.356] -- 0:01:05
30000 -- (-606.759) (-602.736) (-609.946) [-609.839] * (-602.373) (-605.651) [-605.088] (-603.781) -- 0:01:04
Average standard deviation of split frequencies: 0.044498
30500 -- [-606.685] (-603.937) (-606.947) (-610.980) * [-604.192] (-606.226) (-605.956) (-604.384) -- 0:01:03
31000 -- (-603.876) [-603.655] (-606.042) (-616.612) * (-601.961) (-609.766) (-604.561) [-603.595] -- 0:01:02
31500 -- (-608.751) (-605.324) (-604.413) [-616.788] * [-602.893] (-604.654) (-604.991) (-605.230) -- 0:01:01
32000 -- (-606.407) (-605.968) [-604.438] (-609.565) * (-603.076) [-608.098] (-606.384) (-617.619) -- 0:01:00
32500 -- [-605.865] (-604.463) (-602.881) (-614.393) * (-602.397) [-603.776] (-603.230) (-608.268) -- 0:00:59
33000 -- (-604.306) [-602.507] (-603.253) (-615.426) * (-603.538) (-602.572) (-605.067) [-604.081] -- 0:00:58
33500 -- (-602.245) (-601.955) (-604.224) [-610.578] * (-603.550) (-604.715) (-603.481) [-602.434] -- 0:00:57
34000 -- (-604.219) (-602.799) (-608.834) [-610.682] * (-604.222) (-606.512) (-607.397) [-604.342] -- 0:00:56
34500 -- (-603.886) [-603.326] (-604.478) (-619.104) * (-607.058) (-604.968) (-602.900) [-606.597] -- 0:00:55
35000 -- (-603.496) (-604.043) (-603.627) [-614.284] * (-605.640) [-603.563] (-604.936) (-606.780) -- 0:00:55
Average standard deviation of split frequencies: 0.034459
35500 -- (-602.497) (-602.376) [-603.436] (-617.210) * (-608.324) (-606.679) (-604.758) [-603.624] -- 0:00:54
36000 -- (-603.562) (-610.596) (-603.632) [-609.156] * (-606.279) (-603.801) (-602.288) [-602.491] -- 0:00:53
36500 -- (-606.027) [-602.797] (-603.875) (-617.495) * (-605.786) (-605.289) (-604.060) [-602.480] -- 0:00:52
37000 -- (-604.061) (-607.461) (-602.930) [-620.879] * (-603.714) [-606.666] (-604.649) (-606.181) -- 0:00:52
37500 -- (-608.208) (-606.337) (-602.678) [-614.476] * (-602.496) [-606.465] (-605.674) (-602.487) -- 0:00:51
38000 -- (-606.171) (-607.865) [-603.398] (-612.508) * (-603.661) (-609.812) (-605.414) [-603.194] -- 0:00:50
38500 -- (-605.403) [-603.835] (-601.841) (-611.888) * (-604.812) [-606.853] (-606.682) (-606.146) -- 0:00:49
39000 -- [-602.163] (-603.211) (-605.493) (-612.763) * [-603.726] (-603.828) (-604.304) (-606.778) -- 0:00:49
39500 -- (-603.556) (-602.820) (-603.308) [-608.806] * (-603.993) (-602.908) (-605.037) [-602.893] -- 0:00:48
40000 -- (-603.696) [-603.644] (-604.494) (-609.716) * (-602.820) [-602.497] (-604.168) (-604.377) -- 0:00:48
Average standard deviation of split frequencies: 0.043927
40500 -- [-605.810] (-605.329) (-606.807) (-612.120) * (-602.542) (-604.914) [-602.883] (-605.389) -- 0:00:47
41000 -- (-602.755) (-602.798) [-605.047] (-611.886) * (-603.543) [-604.505] (-602.800) (-602.859) -- 0:00:46
41500 -- (-604.483) [-602.255] (-605.119) (-612.020) * (-602.618) [-607.142] (-605.707) (-602.957) -- 0:00:46
42000 -- (-609.408) [-601.894] (-604.358) (-618.568) * (-604.292) (-602.830) (-604.534) [-603.742] -- 0:01:08
42500 -- (-607.204) [-604.013] (-602.700) (-624.973) * (-605.369) [-603.996] (-604.312) (-604.770) -- 0:01:07
43000 -- (-604.974) (-604.337) (-607.510) [-614.294] * (-607.441) (-604.129) (-604.702) [-604.452] -- 0:01:06
43500 -- (-604.104) (-604.395) [-604.013] (-624.512) * (-607.817) (-608.417) (-605.490) [-605.643] -- 0:01:05
44000 -- [-602.937] (-603.704) (-607.528) (-616.907) * [-605.994] (-603.162) (-608.761) (-603.949) -- 0:01:05
44500 -- [-602.402] (-604.151) (-602.690) (-606.006) * [-602.796] (-610.051) (-604.998) (-603.502) -- 0:01:04
45000 -- (-605.454) (-607.293) (-602.565) [-607.169] * [-603.213] (-604.343) (-604.879) (-603.163) -- 0:01:03
Average standard deviation of split frequencies: 0.042855
45500 -- [-603.997] (-606.574) (-602.542) (-605.941) * (-602.971) (-602.045) [-603.426] (-603.696) -- 0:01:02
46000 -- [-602.117] (-604.043) (-606.969) (-604.976) * [-602.898] (-603.059) (-606.409) (-604.220) -- 0:01:02
46500 -- (-602.698) [-603.989] (-605.572) (-603.603) * (-602.400) (-603.906) [-602.819] (-604.426) -- 0:01:01
47000 -- [-601.997] (-605.347) (-603.638) (-608.159) * [-603.520] (-609.162) (-604.642) (-603.150) -- 0:01:00
47500 -- [-603.849] (-602.897) (-603.839) (-608.149) * (-604.645) (-603.180) [-603.932] (-605.376) -- 0:01:00
48000 -- (-602.833) (-602.894) (-603.638) [-603.748] * (-604.401) (-603.362) [-607.632] (-605.135) -- 0:00:59
48500 -- [-602.330] (-604.020) (-603.884) (-604.671) * (-602.691) (-607.219) [-604.675] (-605.463) -- 0:00:58
49000 -- (-604.937) (-603.711) [-605.071] (-604.261) * (-606.509) [-602.650] (-602.813) (-602.954) -- 0:00:58
49500 -- [-602.692] (-606.277) (-604.999) (-606.363) * (-606.092) (-603.214) (-605.086) [-602.657] -- 0:00:57
50000 -- (-601.928) [-605.025] (-605.024) (-605.780) * [-603.933] (-603.694) (-607.164) (-602.859) -- 0:00:57
Average standard deviation of split frequencies: 0.042291
50500 -- [-602.329] (-603.979) (-606.310) (-604.587) * (-605.599) (-603.117) [-603.083] (-602.695) -- 0:00:56
51000 -- [-604.265] (-606.634) (-602.952) (-605.850) * (-606.759) (-602.309) [-606.351] (-604.194) -- 0:00:55
51500 -- [-602.696] (-604.575) (-602.396) (-602.810) * [-605.310] (-602.678) (-603.208) (-603.432) -- 0:00:55
52000 -- [-603.446] (-604.195) (-605.954) (-606.895) * (-601.914) [-602.678] (-603.389) (-604.943) -- 0:00:54
52500 -- (-603.672) (-603.980) [-605.978] (-603.699) * (-603.263) (-605.127) (-602.791) [-603.259] -- 0:00:54
53000 -- (-604.222) [-603.380] (-604.350) (-604.294) * (-602.845) (-607.276) (-604.672) [-603.710] -- 0:00:53
53500 -- (-604.519) (-602.460) [-605.031] (-604.254) * (-602.843) (-605.433) [-605.730] (-602.229) -- 0:00:53
54000 -- (-605.493) (-603.177) [-603.126] (-607.108) * [-603.449] (-602.568) (-605.605) (-602.490) -- 0:00:52
54500 -- [-603.778] (-604.654) (-602.972) (-603.733) * (-604.398) (-603.504) (-602.902) [-602.556] -- 0:00:52
55000 -- (-603.687) (-604.829) (-605.822) [-603.506] * [-605.518] (-603.482) (-604.642) (-602.604) -- 0:00:51
Average standard deviation of split frequencies: 0.035444
55500 -- (-605.459) (-603.604) (-606.871) [-603.909] * (-605.596) (-602.909) [-606.411] (-603.258) -- 0:00:51
56000 -- (-603.871) (-605.445) (-604.265) [-603.621] * [-603.780] (-604.219) (-605.693) (-602.300) -- 0:00:50
56500 -- (-606.892) [-605.959] (-602.616) (-603.637) * (-603.550) [-603.553] (-604.857) (-603.904) -- 0:00:50
57000 -- (-604.639) (-605.040) (-605.361) [-605.072] * (-605.192) (-602.635) [-606.199] (-612.042) -- 0:00:49
57500 -- (-603.285) (-604.538) [-603.857] (-602.499) * (-603.215) (-603.730) [-605.868] (-608.191) -- 0:00:49
58000 -- (-606.290) (-603.844) (-602.166) [-604.473] * (-603.283) (-607.120) [-605.954] (-604.269) -- 0:00:48
58500 -- (-606.059) (-605.767) (-604.268) [-602.391] * [-603.215] (-602.008) (-606.776) (-602.282) -- 0:01:04
59000 -- (-602.831) (-604.465) [-602.960] (-603.356) * (-603.287) (-604.695) (-607.306) [-603.573] -- 0:01:03
59500 -- (-603.928) (-604.380) (-602.750) [-603.702] * (-603.782) (-606.886) [-604.736] (-606.413) -- 0:01:03
60000 -- (-603.228) (-603.605) (-606.297) [-603.420] * (-603.473) [-607.235] (-603.571) (-604.044) -- 0:01:02
Average standard deviation of split frequencies: 0.030673
60500 -- (-606.793) [-605.227] (-606.650) (-602.586) * (-603.226) (-604.909) [-602.604] (-604.980) -- 0:01:02
61000 -- (-603.472) [-605.339] (-606.869) (-602.991) * (-603.658) (-606.520) (-604.658) [-604.075] -- 0:01:01
61500 -- (-605.826) [-603.492] (-608.035) (-603.672) * (-604.139) (-602.721) (-602.688) [-604.114] -- 0:01:01
62000 -- (-602.351) (-602.860) (-605.212) [-604.465] * (-605.260) (-603.517) [-602.916] (-602.020) -- 0:01:00
62500 -- [-603.848] (-603.484) (-605.118) (-605.628) * (-606.248) (-602.654) (-603.648) [-602.533] -- 0:01:00
63000 -- (-602.995) (-602.728) (-605.118) [-604.861] * [-604.170] (-603.351) (-601.924) (-603.337) -- 0:00:59
63500 -- (-602.944) (-604.844) (-603.428) [-607.497] * (-603.336) (-604.351) (-607.784) [-605.016] -- 0:00:58
64000 -- (-607.341) (-604.421) (-604.498) [-602.482] * [-604.610] (-603.829) (-609.004) (-603.081) -- 0:00:58
64500 -- (-606.226) (-602.701) (-604.472) [-604.196] * (-606.651) (-602.828) (-607.626) [-607.904] -- 0:00:58
65000 -- (-603.891) [-604.149] (-605.531) (-604.570) * (-607.766) (-607.331) [-605.593] (-608.053) -- 0:00:57
Average standard deviation of split frequencies: 0.026784
65500 -- [-603.341] (-604.925) (-602.490) (-603.405) * (-605.127) (-608.126) (-605.482) [-602.382] -- 0:00:57
66000 -- (-606.549) (-605.545) [-602.722] (-605.980) * [-602.093] (-606.005) (-609.567) (-603.737) -- 0:00:56
66500 -- (-604.587) (-602.856) [-605.926] (-604.441) * [-602.364] (-614.656) (-607.687) (-603.509) -- 0:00:56
67000 -- (-607.101) (-604.168) (-602.734) [-604.107] * (-603.311) (-606.279) (-606.366) [-603.046] -- 0:00:55
67500 -- (-604.657) [-604.154] (-603.620) (-603.716) * [-602.455] (-611.054) (-607.706) (-605.887) -- 0:00:55
68000 -- (-603.267) [-602.457] (-605.340) (-609.291) * [-605.264] (-605.155) (-611.518) (-605.767) -- 0:00:54
68500 -- [-602.732] (-605.408) (-603.399) (-605.150) * [-604.392] (-605.883) (-606.692) (-604.261) -- 0:00:54
69000 -- (-605.657) (-608.175) (-608.918) [-603.490] * (-603.887) [-603.156] (-603.762) (-608.465) -- 0:00:53
69500 -- (-604.044) (-605.519) (-608.706) [-605.320] * (-602.815) (-606.045) [-603.273] (-603.417) -- 0:00:53
70000 -- (-606.123) (-605.547) [-604.582] (-603.361) * (-602.505) (-602.722) (-605.903) [-605.425] -- 0:00:53
Average standard deviation of split frequencies: 0.028439
70500 -- (-602.199) (-606.618) (-605.267) [-603.611] * (-602.821) [-603.059] (-604.491) (-603.323) -- 0:00:52
71000 -- [-606.296] (-603.614) (-606.844) (-602.490) * (-606.067) [-602.824] (-603.920) (-603.098) -- 0:00:52
71500 -- (-605.784) [-603.161] (-608.056) (-602.645) * (-607.278) (-604.995) (-604.324) [-604.598] -- 0:00:51
72000 -- [-606.033] (-603.761) (-607.091) (-607.391) * (-605.679) (-606.647) [-605.493] (-605.809) -- 0:00:51
72500 -- (-605.390) [-604.081] (-603.848) (-604.023) * (-606.450) (-603.224) (-607.436) [-604.305] -- 0:00:51
73000 -- (-606.854) [-601.969] (-602.598) (-604.268) * [-604.842] (-604.926) (-608.072) (-603.414) -- 0:00:50
73500 -- (-607.513) [-604.665] (-602.460) (-605.696) * (-602.016) [-603.029] (-604.432) (-605.402) -- 0:00:50
74000 -- (-606.740) (-605.800) [-605.743] (-602.432) * [-604.412] (-603.124) (-604.835) (-603.040) -- 0:00:50
74500 -- (-602.824) (-605.221) (-606.399) [-606.507] * [-603.621] (-603.746) (-606.949) (-607.251) -- 0:00:49
75000 -- (-603.315) (-602.415) [-604.108] (-610.936) * (-606.474) [-604.342] (-603.711) (-605.770) -- 0:00:49
Average standard deviation of split frequencies: 0.031944
75500 -- (-604.095) (-608.764) [-606.248] (-605.892) * (-605.780) (-604.813) [-603.648] (-605.235) -- 0:01:01
76000 -- (-602.503) [-606.907] (-603.279) (-608.915) * (-605.578) (-609.007) [-604.457] (-606.034) -- 0:01:00
76500 -- (-604.446) [-603.592] (-603.183) (-604.152) * [-605.591] (-609.040) (-604.596) (-603.690) -- 0:01:00
77000 -- (-603.148) [-603.375] (-603.357) (-602.867) * (-608.285) (-605.969) [-602.200] (-608.424) -- 0:00:59
77500 -- (-603.751) (-606.839) (-606.437) [-602.519] * (-603.696) (-604.514) (-606.135) [-604.447] -- 0:00:59
78000 -- (-602.705) (-602.620) (-604.676) [-603.997] * (-605.719) (-607.334) (-602.370) [-604.476] -- 0:00:59
78500 -- [-603.453] (-602.539) (-605.365) (-604.050) * [-604.856] (-606.550) (-602.239) (-604.174) -- 0:00:58
79000 -- (-605.631) (-606.122) (-605.610) [-603.039] * (-603.693) (-606.840) [-604.562] (-605.930) -- 0:00:58
79500 -- (-604.143) (-603.832) [-604.478] (-602.656) * (-604.394) (-602.612) (-604.515) [-608.798] -- 0:00:57
80000 -- (-602.512) (-603.139) [-604.421] (-602.599) * (-601.982) (-603.668) [-603.411] (-605.380) -- 0:00:57
Average standard deviation of split frequencies: 0.028384
80500 -- [-602.831] (-604.207) (-603.644) (-608.498) * (-602.246) (-602.536) (-608.698) [-604.307] -- 0:00:57
81000 -- (-602.231) [-607.628] (-604.367) (-605.830) * [-604.053] (-604.677) (-604.997) (-604.143) -- 0:00:56
81500 -- (-603.605) (-602.997) (-605.433) [-603.770] * (-605.591) (-603.749) (-605.204) [-608.376] -- 0:00:56
82000 -- [-603.660] (-603.116) (-605.369) (-606.800) * [-604.059] (-604.465) (-605.551) (-603.020) -- 0:00:55
82500 -- (-604.730) [-606.655] (-603.554) (-605.773) * (-605.219) (-609.689) (-605.318) [-605.999] -- 0:00:55
83000 -- [-603.643] (-604.681) (-605.762) (-602.564) * [-604.426] (-608.342) (-604.229) (-606.258) -- 0:00:55
83500 -- (-603.473) (-605.456) (-607.943) [-601.971] * [-603.518] (-603.984) (-605.751) (-604.322) -- 0:00:54
84000 -- (-605.558) (-603.665) (-605.278) [-602.017] * (-602.622) (-603.858) (-603.494) [-606.363] -- 0:00:54
84500 -- (-603.580) (-604.227) (-605.612) [-602.738] * [-603.433] (-606.504) (-602.428) (-603.614) -- 0:00:54
85000 -- (-602.398) (-609.778) [-603.725] (-605.725) * [-603.805] (-607.116) (-603.831) (-605.424) -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-607.480) [-609.222] (-602.965) (-606.491) * (-602.209) [-604.833] (-601.772) (-605.476) -- 0:00:53
86000 -- (-605.550) (-607.703) [-602.576] (-605.110) * (-604.489) (-604.595) (-602.586) [-603.668] -- 0:00:53
86500 -- (-607.248) [-606.982] (-603.486) (-608.129) * [-603.058] (-606.136) (-603.563) (-602.199) -- 0:00:52
87000 -- (-606.967) (-604.182) (-603.211) [-609.249] * (-606.174) (-604.554) (-607.264) [-603.354] -- 0:00:52
87500 -- (-608.493) (-603.323) [-602.563] (-604.952) * [-607.907] (-603.913) (-604.574) (-602.614) -- 0:00:52
88000 -- (-608.471) (-602.569) [-604.036] (-610.036) * (-609.978) (-603.503) [-604.358] (-605.411) -- 0:00:51
88500 -- (-604.548) [-602.080] (-605.603) (-603.171) * (-604.833) (-603.170) (-603.556) [-607.889] -- 0:00:51
89000 -- [-604.629] (-606.974) (-604.011) (-602.329) * (-602.996) (-605.069) [-602.639] (-602.855) -- 0:00:51
89500 -- (-605.619) (-603.018) [-602.431] (-602.065) * (-602.842) (-604.743) [-602.511] (-606.566) -- 0:00:50
90000 -- (-606.358) (-602.259) (-604.963) [-602.907] * [-603.973] (-604.548) (-605.038) (-603.093) -- 0:00:50
Average standard deviation of split frequencies: 0.025997
90500 -- (-609.950) (-603.501) (-604.992) [-613.251] * (-606.359) (-604.195) (-607.091) [-602.102] -- 0:00:50
91000 -- (-604.080) (-604.567) (-602.408) [-604.347] * [-605.206] (-603.694) (-605.632) (-602.691) -- 0:00:49
91500 -- (-604.731) (-603.816) (-602.254) [-602.779] * [-603.690] (-602.923) (-603.746) (-606.796) -- 0:00:49
92000 -- (-604.156) [-603.724] (-603.307) (-603.812) * (-605.943) (-603.482) [-603.508] (-602.653) -- 0:00:59
92500 -- [-603.821] (-603.608) (-602.171) (-607.049) * (-602.006) (-603.396) [-603.589] (-605.338) -- 0:00:58
93000 -- (-609.618) (-604.958) (-602.765) [-604.271] * [-603.354] (-602.736) (-605.645) (-604.015) -- 0:00:58
93500 -- (-606.136) (-605.500) (-608.272) [-603.519] * (-604.500) (-602.945) (-605.142) [-606.749] -- 0:00:58
94000 -- (-603.739) (-603.389) (-605.416) [-603.524] * (-605.035) (-603.942) [-604.185] (-603.441) -- 0:00:57
94500 -- (-606.744) [-606.972] (-602.643) (-607.898) * (-603.955) [-603.548] (-606.958) (-605.018) -- 0:00:57
95000 -- [-604.521] (-606.291) (-613.246) (-607.720) * (-603.890) [-609.418] (-603.304) (-606.234) -- 0:00:57
Average standard deviation of split frequencies: 0.027124
95500 -- [-603.529] (-607.205) (-603.697) (-607.743) * (-604.499) (-606.157) [-604.922] (-607.022) -- 0:00:56
96000 -- (-603.098) [-604.023] (-606.004) (-604.131) * (-603.048) (-605.537) (-606.300) [-603.436] -- 0:00:56
96500 -- [-604.560] (-605.055) (-604.748) (-605.634) * (-604.444) (-606.922) [-602.396] (-603.850) -- 0:00:56
97000 -- (-606.041) (-603.492) [-602.316] (-604.807) * (-602.726) (-602.900) (-603.135) [-604.108] -- 0:00:55
97500 -- (-607.034) (-605.389) (-604.101) [-602.958] * (-606.763) (-605.128) (-603.658) [-606.533] -- 0:00:55
98000 -- (-604.597) [-605.950] (-606.115) (-604.621) * (-604.193) [-601.965] (-603.855) (-603.768) -- 0:00:55
98500 -- (-604.728) [-603.499] (-607.081) (-605.801) * (-603.273) [-606.332] (-604.968) (-602.972) -- 0:00:54
99000 -- (-603.441) (-605.161) [-606.598] (-604.044) * (-603.690) (-604.155) (-610.052) [-604.260] -- 0:00:54
99500 -- (-607.384) [-605.988] (-605.220) (-603.761) * (-604.415) [-604.994] (-609.725) (-602.695) -- 0:00:54
100000 -- (-606.218) (-607.889) (-605.682) [-606.304] * (-606.483) (-607.891) (-607.261) [-604.444] -- 0:00:54
Average standard deviation of split frequencies: 0.032567
100500 -- (-607.430) [-604.277] (-603.804) (-604.279) * (-602.448) (-605.351) (-612.136) [-606.069] -- 0:00:53
101000 -- (-604.036) (-604.952) [-604.370] (-604.413) * [-602.772] (-604.124) (-603.079) (-606.711) -- 0:00:53
101500 -- (-607.706) (-606.911) [-603.795] (-604.554) * [-603.852] (-605.448) (-602.820) (-605.579) -- 0:00:53
102000 -- (-608.126) (-603.532) [-603.067] (-602.470) * (-602.920) (-602.347) (-603.607) [-605.032] -- 0:00:52
102500 -- (-604.873) [-602.064] (-602.025) (-604.514) * (-603.910) (-605.466) (-606.438) [-605.235] -- 0:00:52
103000 -- [-603.901] (-604.550) (-604.026) (-602.976) * (-605.353) (-606.344) (-605.677) [-602.602] -- 0:00:52
103500 -- (-604.430) [-605.591] (-601.823) (-604.442) * (-606.134) (-605.204) [-603.852] (-604.619) -- 0:00:51
104000 -- (-606.020) (-606.094) (-601.862) [-604.669] * (-608.582) (-602.616) (-606.642) [-602.793] -- 0:00:51
104500 -- [-604.521] (-605.004) (-603.094) (-601.923) * (-605.154) [-602.786] (-604.962) (-604.895) -- 0:00:51
105000 -- (-606.308) [-602.237] (-603.121) (-607.470) * (-602.585) (-602.927) [-602.763] (-606.262) -- 0:00:51
Average standard deviation of split frequencies: 0.031711
105500 -- [-605.219] (-601.819) (-603.042) (-603.506) * (-602.426) (-604.170) [-603.419] (-609.812) -- 0:00:50
106000 -- (-608.984) [-601.983] (-602.254) (-602.459) * (-603.636) (-605.239) [-604.246] (-604.120) -- 0:00:50
106500 -- [-603.787] (-602.268) (-604.330) (-602.397) * (-602.986) (-608.311) (-602.697) [-605.340] -- 0:00:50
107000 -- [-604.335] (-602.127) (-605.116) (-609.449) * (-606.928) (-605.497) (-605.408) [-603.782] -- 0:00:50
107500 -- [-603.433] (-603.957) (-605.111) (-610.048) * [-602.110] (-608.979) (-607.094) (-604.983) -- 0:00:49
108000 -- (-605.644) [-603.937] (-605.296) (-610.440) * (-602.764) (-605.024) [-604.652] (-602.395) -- 0:00:49
108500 -- (-606.614) (-607.940) (-602.896) [-601.874] * (-604.495) [-604.453] (-608.353) (-607.094) -- 0:00:49
109000 -- (-607.740) (-606.551) [-602.563] (-603.204) * (-603.381) (-605.092) (-606.190) [-604.253] -- 0:00:57
109500 -- [-605.405] (-605.999) (-603.274) (-607.128) * (-603.138) (-604.284) [-605.616] (-603.798) -- 0:00:56
110000 -- [-605.135] (-606.831) (-605.877) (-605.367) * (-602.924) [-602.286] (-602.019) (-604.783) -- 0:00:56
Average standard deviation of split frequencies: 0.031238
110500 -- [-602.360] (-604.011) (-602.789) (-604.856) * [-603.692] (-603.786) (-602.019) (-606.611) -- 0:00:56
111000 -- (-602.028) (-603.539) (-607.106) [-602.161] * [-605.002] (-603.172) (-601.822) (-604.634) -- 0:00:56
111500 -- (-603.988) [-606.879] (-605.163) (-604.624) * [-607.778] (-604.839) (-607.282) (-603.655) -- 0:00:55
112000 -- (-602.308) (-602.570) (-603.301) [-604.465] * (-604.614) [-603.939] (-606.993) (-604.444) -- 0:00:55
112500 -- (-603.061) [-605.681] (-602.770) (-603.677) * (-605.830) (-603.844) (-602.428) [-606.031] -- 0:00:55
113000 -- (-603.654) (-603.006) (-602.022) [-605.137] * (-605.131) (-603.479) (-605.059) [-602.893] -- 0:00:54
113500 -- (-607.904) (-603.859) (-605.757) [-603.800] * (-604.485) (-602.519) [-604.572] (-604.980) -- 0:00:54
114000 -- (-604.588) [-604.631] (-606.729) (-613.310) * (-606.310) (-603.753) (-607.586) [-602.670] -- 0:00:54
114500 -- (-605.068) [-602.764] (-608.973) (-603.649) * (-605.268) [-601.904] (-607.264) (-604.874) -- 0:00:54
115000 -- (-604.342) [-603.227] (-604.374) (-606.704) * (-604.574) (-603.517) (-602.511) [-604.600] -- 0:00:53
Average standard deviation of split frequencies: 0.033478
115500 -- (-602.635) (-606.411) [-603.828] (-603.697) * (-607.532) [-603.609] (-608.852) (-607.061) -- 0:00:53
116000 -- (-607.283) [-606.155] (-603.821) (-602.980) * (-603.010) [-603.752] (-603.828) (-602.048) -- 0:00:53
116500 -- (-604.912) [-603.143] (-606.228) (-604.134) * (-602.826) (-603.456) [-603.407] (-605.365) -- 0:00:53
117000 -- (-608.342) [-603.107] (-607.151) (-608.035) * (-604.708) (-606.281) (-605.004) [-605.933] -- 0:00:52
117500 -- [-603.162] (-609.278) (-605.630) (-604.912) * [-604.715] (-610.467) (-604.121) (-604.192) -- 0:00:52
118000 -- (-603.311) [-603.606] (-602.676) (-605.187) * (-606.522) (-605.807) [-604.458] (-603.743) -- 0:00:52
118500 -- [-603.084] (-606.238) (-609.265) (-603.004) * (-604.018) (-607.037) [-605.959] (-604.343) -- 0:00:52
119000 -- (-604.637) (-604.867) (-606.222) [-602.367] * (-606.765) (-602.435) (-606.329) [-604.150] -- 0:00:51
119500 -- (-604.244) [-602.185] (-602.597) (-605.045) * [-605.995] (-604.523) (-606.198) (-605.173) -- 0:00:51
120000 -- (-606.733) [-603.768] (-604.253) (-606.335) * (-606.234) [-602.931] (-605.074) (-608.262) -- 0:00:51
Average standard deviation of split frequencies: 0.032621
120500 -- [-602.959] (-604.222) (-603.744) (-606.174) * (-603.232) [-605.204] (-606.993) (-606.659) -- 0:00:51
121000 -- (-605.533) (-604.507) [-604.408] (-603.011) * [-603.609] (-603.109) (-603.319) (-607.191) -- 0:00:50
121500 -- (-603.138) (-604.232) (-602.681) [-603.437] * (-607.025) (-603.102) (-604.088) [-604.117] -- 0:00:50
122000 -- [-603.852] (-604.718) (-603.016) (-605.932) * (-611.784) (-602.620) (-602.964) [-605.879] -- 0:00:50
122500 -- [-604.336] (-604.294) (-602.778) (-603.637) * (-606.345) (-603.161) (-602.896) [-605.074] -- 0:00:50
123000 -- (-603.327) (-603.189) (-602.641) [-602.880] * (-607.687) (-605.908) (-604.772) [-602.332] -- 0:00:49
123500 -- [-602.201] (-606.679) (-603.953) (-604.525) * (-604.136) (-607.324) (-604.579) [-604.972] -- 0:00:49
124000 -- [-602.818] (-603.463) (-603.869) (-602.455) * (-602.120) [-603.455] (-604.643) (-604.565) -- 0:00:49
124500 -- (-606.903) (-604.571) [-605.190] (-602.633) * (-603.759) (-605.743) [-603.776] (-603.297) -- 0:00:49
125000 -- (-603.491) [-603.657] (-603.904) (-603.758) * (-605.895) [-604.525] (-603.850) (-603.646) -- 0:00:49
Average standard deviation of split frequencies: 0.029080
125500 -- (-604.290) (-608.231) [-604.673] (-602.207) * (-603.275) (-604.452) [-603.894] (-602.950) -- 0:00:55
126000 -- (-604.096) (-603.588) (-606.179) [-604.280] * (-607.231) (-603.561) (-602.006) [-607.624] -- 0:00:55
126500 -- (-603.674) [-602.590] (-606.433) (-605.484) * (-604.069) [-603.101] (-604.542) (-606.695) -- 0:00:55
127000 -- (-603.954) [-601.901] (-602.806) (-606.296) * [-602.965] (-603.422) (-604.125) (-602.181) -- 0:00:54
127500 -- [-606.161] (-602.182) (-604.423) (-603.013) * [-603.306] (-604.694) (-610.864) (-603.386) -- 0:00:54
128000 -- (-604.221) [-603.997] (-605.111) (-604.054) * (-602.711) (-606.598) [-604.542] (-604.664) -- 0:00:54
128500 -- (-603.938) (-607.028) [-604.542] (-607.712) * (-602.786) (-604.477) [-602.724] (-603.959) -- 0:00:54
129000 -- (-603.978) (-608.709) [-603.473] (-607.449) * (-604.633) (-602.941) (-603.436) [-602.236] -- 0:00:54
129500 -- (-604.873) (-603.107) (-602.309) [-604.875] * (-609.836) (-605.162) (-606.790) [-604.582] -- 0:00:53
130000 -- (-602.950) (-606.521) (-602.419) [-602.596] * (-607.715) [-601.892] (-607.977) (-605.295) -- 0:00:53
Average standard deviation of split frequencies: 0.030124
130500 -- [-602.412] (-604.125) (-605.259) (-604.728) * (-605.512) (-607.079) [-606.482] (-605.904) -- 0:00:53
131000 -- [-602.540] (-603.189) (-602.806) (-608.451) * (-603.640) [-603.461] (-605.313) (-606.120) -- 0:00:53
131500 -- (-602.868) (-603.231) [-603.354] (-607.588) * [-602.915] (-603.046) (-602.553) (-605.684) -- 0:00:52
132000 -- [-605.478] (-603.370) (-603.149) (-608.310) * (-605.576) (-602.217) [-603.794] (-605.997) -- 0:00:52
132500 -- (-602.718) (-608.441) [-603.811] (-604.615) * [-602.684] (-603.453) (-603.612) (-603.352) -- 0:00:52
133000 -- [-602.656] (-603.560) (-604.739) (-602.999) * [-602.904] (-605.836) (-609.427) (-602.253) -- 0:00:52
133500 -- (-602.620) (-602.412) (-603.459) [-608.648] * [-603.157] (-603.500) (-606.974) (-603.239) -- 0:00:51
134000 -- (-603.432) [-602.933] (-604.678) (-602.453) * (-603.058) (-603.471) (-605.584) [-602.530] -- 0:00:51
134500 -- (-605.065) [-603.681] (-602.856) (-604.742) * (-602.249) (-605.072) (-609.379) [-603.803] -- 0:00:51
135000 -- (-605.502) (-603.769) [-605.044] (-605.093) * (-603.335) [-604.935] (-605.038) (-604.340) -- 0:00:51
Average standard deviation of split frequencies: 0.031196
135500 -- (-603.426) [-605.227] (-604.988) (-607.278) * (-603.800) (-603.382) (-603.382) [-604.871] -- 0:00:51
136000 -- [-604.065] (-607.053) (-603.415) (-607.915) * (-603.262) [-609.975] (-603.680) (-604.458) -- 0:00:50
136500 -- [-602.878] (-603.563) (-602.803) (-605.172) * [-606.043] (-607.720) (-603.842) (-602.614) -- 0:00:50
137000 -- (-603.989) (-605.802) [-604.126] (-602.794) * (-605.635) [-606.228] (-604.236) (-610.748) -- 0:00:50
137500 -- [-602.595] (-602.190) (-606.803) (-603.940) * (-604.881) [-608.562] (-604.206) (-603.804) -- 0:00:50
138000 -- (-603.250) (-605.509) [-602.982] (-606.842) * (-605.470) (-603.925) (-604.036) [-603.208] -- 0:00:49
138500 -- (-603.510) [-602.489] (-604.618) (-604.156) * (-604.503) [-605.133] (-605.151) (-604.796) -- 0:00:49
139000 -- (-609.400) [-602.393] (-605.847) (-608.875) * [-606.212] (-603.355) (-604.716) (-602.464) -- 0:00:49
139500 -- (-605.751) [-603.908] (-608.073) (-611.495) * [-602.265] (-602.644) (-604.982) (-604.545) -- 0:00:49
140000 -- (-610.253) (-603.493) (-607.944) [-604.770] * (-602.297) (-607.627) [-604.608] (-607.056) -- 0:00:49
Average standard deviation of split frequencies: 0.029103
140500 -- [-606.790] (-606.848) (-608.435) (-604.164) * [-603.094] (-604.933) (-604.543) (-605.038) -- 0:00:48
141000 -- (-607.685) (-606.032) (-602.460) [-603.954] * [-605.072] (-603.487) (-604.194) (-606.729) -- 0:00:48
141500 -- (-605.816) (-606.678) [-604.924] (-604.212) * (-603.077) (-604.100) [-603.956] (-605.059) -- 0:00:48
142000 -- [-602.627] (-603.800) (-602.733) (-603.394) * (-604.270) (-604.397) [-604.858] (-603.174) -- 0:00:54
142500 -- (-602.926) (-610.397) (-602.196) [-603.599] * (-603.662) [-603.186] (-602.437) (-607.778) -- 0:00:54
143000 -- (-606.922) (-604.553) (-602.566) [-605.179] * [-602.092] (-603.503) (-602.816) (-604.847) -- 0:00:53
143500 -- (-608.543) [-604.188] (-602.277) (-606.620) * [-602.261] (-605.485) (-604.770) (-603.616) -- 0:00:53
144000 -- (-603.762) [-607.787] (-605.176) (-606.076) * [-604.576] (-605.258) (-609.602) (-605.111) -- 0:00:53
144500 -- (-603.733) (-603.517) [-602.942] (-603.253) * (-604.260) [-604.278] (-606.472) (-607.090) -- 0:00:53
145000 -- [-604.887] (-603.076) (-605.620) (-603.448) * [-602.382] (-605.643) (-603.210) (-604.109) -- 0:00:53
Average standard deviation of split frequencies: 0.026292
145500 -- (-605.801) (-602.924) [-604.731] (-602.717) * (-605.111) [-604.473] (-607.022) (-606.303) -- 0:00:52
146000 -- [-606.658] (-603.066) (-605.054) (-604.260) * [-605.566] (-604.269) (-607.953) (-604.093) -- 0:00:52
146500 -- [-604.392] (-603.877) (-604.324) (-602.551) * (-602.829) (-602.859) (-602.377) [-604.207] -- 0:00:52
147000 -- (-606.758) [-603.729] (-608.640) (-605.055) * (-605.663) [-605.075] (-602.964) (-605.085) -- 0:00:52
147500 -- (-604.201) [-603.199] (-607.286) (-607.025) * (-603.394) [-605.838] (-606.122) (-606.509) -- 0:00:52
148000 -- (-602.846) (-602.779) (-605.243) [-603.617] * (-603.717) (-607.234) (-604.900) [-607.917] -- 0:00:51
148500 -- (-605.336) (-604.499) (-608.282) [-604.518] * (-604.514) (-604.310) [-603.304] (-607.417) -- 0:00:51
149000 -- (-603.599) (-604.694) (-605.466) [-604.704] * (-604.843) (-603.044) [-603.081] (-609.684) -- 0:00:51
149500 -- (-604.999) [-602.962] (-607.777) (-604.998) * (-606.463) (-604.864) [-603.780] (-606.126) -- 0:00:51
150000 -- (-604.577) (-606.017) [-606.457] (-606.143) * [-602.666] (-606.661) (-605.451) (-606.158) -- 0:00:51
Average standard deviation of split frequencies: 0.025969
150500 -- (-604.613) (-608.788) (-603.063) [-603.740] * [-602.476] (-606.138) (-603.510) (-607.809) -- 0:00:50
151000 -- [-605.116] (-603.001) (-603.553) (-602.222) * [-606.354] (-603.170) (-604.750) (-606.831) -- 0:00:50
151500 -- (-607.551) [-603.507] (-608.629) (-602.784) * (-604.657) (-604.880) [-603.703] (-610.127) -- 0:00:50
152000 -- (-607.420) (-603.473) [-603.562] (-607.441) * (-603.155) [-606.225] (-602.412) (-607.656) -- 0:00:50
152500 -- (-604.210) (-602.536) (-603.785) [-606.847] * (-605.521) [-603.302] (-602.196) (-606.674) -- 0:00:50
153000 -- [-606.133] (-604.024) (-606.618) (-603.946) * (-602.691) [-606.663] (-602.223) (-607.055) -- 0:00:49
153500 -- (-604.457) (-604.595) (-604.610) [-602.343] * [-604.716] (-604.440) (-602.098) (-603.693) -- 0:00:49
154000 -- (-605.999) [-605.698] (-609.068) (-603.557) * (-605.010) (-604.244) [-601.776] (-603.505) -- 0:00:49
154500 -- (-606.158) [-604.001] (-604.949) (-602.002) * [-602.740] (-603.235) (-602.322) (-604.254) -- 0:00:49
155000 -- [-603.155] (-602.665) (-604.195) (-603.707) * [-604.399] (-603.488) (-603.194) (-603.719) -- 0:00:49
Average standard deviation of split frequencies: 0.030067
155500 -- (-603.513) [-604.775] (-603.993) (-606.940) * [-604.419] (-605.424) (-603.524) (-607.333) -- 0:00:48
156000 -- (-603.209) [-604.241] (-602.495) (-602.139) * [-603.958] (-603.758) (-607.221) (-606.660) -- 0:00:48
156500 -- (-603.012) (-604.441) (-603.096) [-602.515] * (-604.916) (-603.885) [-607.927] (-604.793) -- 0:00:48
157000 -- (-606.122) (-604.130) [-604.870] (-602.889) * [-605.167] (-605.083) (-603.528) (-602.911) -- 0:00:48
157500 -- [-603.099] (-614.133) (-606.028) (-603.110) * (-606.683) (-602.420) [-602.603] (-605.749) -- 0:00:53
158000 -- (-607.592) (-615.905) (-606.585) [-603.508] * [-602.974] (-602.572) (-602.169) (-603.047) -- 0:00:53
158500 -- [-602.620] (-612.807) (-603.575) (-603.076) * (-602.267) (-604.171) (-603.090) [-604.944] -- 0:00:53
159000 -- [-605.692] (-610.521) (-602.952) (-603.157) * (-605.965) [-604.759] (-604.687) (-610.262) -- 0:00:52
159500 -- [-603.651] (-607.855) (-606.389) (-602.748) * [-603.765] (-605.630) (-604.519) (-609.564) -- 0:00:52
160000 -- (-606.489) (-604.875) (-605.120) [-603.787] * (-602.245) (-603.653) (-602.506) [-605.363] -- 0:00:52
Average standard deviation of split frequencies: 0.026406
160500 -- (-607.612) (-604.113) [-602.756] (-601.917) * (-607.987) (-604.362) (-603.971) [-606.461] -- 0:00:52
161000 -- [-605.876] (-603.601) (-602.624) (-602.256) * (-603.198) (-604.118) [-604.502] (-607.997) -- 0:00:52
161500 -- (-603.505) (-603.563) [-603.551] (-602.751) * (-603.774) (-603.796) (-603.270) [-606.878] -- 0:00:51
162000 -- (-603.544) (-603.544) [-603.875] (-602.550) * (-604.657) (-607.000) [-603.741] (-603.609) -- 0:00:51
162500 -- (-603.629) (-603.968) (-603.874) [-604.245] * [-605.120] (-611.220) (-603.135) (-604.327) -- 0:00:51
163000 -- (-603.120) [-603.333] (-605.374) (-605.639) * [-602.503] (-603.995) (-604.224) (-602.636) -- 0:00:51
163500 -- (-604.102) (-602.484) (-602.825) [-602.762] * [-604.704] (-603.242) (-606.546) (-606.726) -- 0:00:51
164000 -- (-602.837) (-602.320) [-604.059] (-602.788) * [-605.865] (-602.831) (-604.424) (-605.686) -- 0:00:50
164500 -- (-603.839) (-605.193) (-602.686) [-605.980] * [-603.684] (-603.477) (-604.846) (-602.135) -- 0:00:50
165000 -- (-603.438) (-605.280) (-604.693) [-605.114] * (-603.878) (-603.561) [-606.743] (-603.822) -- 0:00:50
Average standard deviation of split frequencies: 0.023286
165500 -- (-603.984) (-604.031) [-602.856] (-604.045) * (-605.341) (-604.645) [-603.845] (-603.299) -- 0:00:50
166000 -- [-604.492] (-602.644) (-604.962) (-605.502) * [-602.178] (-603.267) (-605.943) (-604.541) -- 0:00:50
166500 -- [-603.825] (-603.744) (-602.265) (-603.147) * [-604.780] (-605.448) (-602.970) (-605.025) -- 0:00:50
167000 -- (-603.542) [-604.209] (-606.725) (-604.068) * [-603.102] (-605.266) (-603.042) (-604.686) -- 0:00:49
167500 -- [-603.742] (-603.474) (-602.598) (-607.151) * (-606.491) [-603.665] (-603.784) (-604.110) -- 0:00:49
168000 -- [-605.964] (-603.504) (-603.658) (-604.118) * [-604.456] (-604.030) (-604.711) (-606.382) -- 0:00:49
168500 -- (-609.688) (-603.963) [-602.681] (-602.385) * (-605.372) [-604.761] (-606.865) (-603.386) -- 0:00:49
169000 -- (-606.181) (-604.843) [-602.308] (-605.163) * (-604.060) (-604.733) (-604.427) [-604.167] -- 0:00:49
169500 -- [-603.742] (-605.057) (-605.372) (-602.487) * (-606.277) [-604.393] (-603.483) (-603.861) -- 0:00:48
170000 -- [-602.868] (-604.916) (-605.694) (-604.310) * [-607.322] (-602.927) (-608.209) (-605.160) -- 0:00:53
Average standard deviation of split frequencies: 0.022097
170500 -- [-602.605] (-605.858) (-602.958) (-602.556) * (-606.607) (-607.502) [-603.576] (-604.348) -- 0:00:53
171000 -- (-603.063) (-605.732) (-603.399) [-604.882] * [-607.515] (-604.774) (-605.014) (-608.173) -- 0:00:53
171500 -- [-603.522] (-603.533) (-603.336) (-604.406) * [-603.972] (-603.610) (-601.905) (-607.729) -- 0:00:53
172000 -- [-604.939] (-603.401) (-604.397) (-604.511) * [-605.208] (-606.342) (-602.068) (-602.733) -- 0:00:52
172500 -- (-605.226) [-605.215] (-603.232) (-602.978) * [-605.502] (-604.832) (-604.069) (-602.721) -- 0:00:52
173000 -- (-606.251) (-611.127) [-602.589] (-604.173) * (-604.345) (-602.373) [-603.178] (-602.508) -- 0:00:52
173500 -- [-606.398] (-604.399) (-602.652) (-602.289) * (-602.620) (-603.321) (-605.752) [-603.459] -- 0:00:52
174000 -- (-606.091) [-602.283] (-602.906) (-601.805) * (-605.787) [-604.459] (-603.691) (-604.615) -- 0:00:52
174500 -- (-604.757) [-605.328] (-603.751) (-602.551) * [-604.663] (-603.158) (-605.104) (-606.433) -- 0:00:52
175000 -- (-605.335) (-602.079) [-605.359] (-605.164) * (-604.223) (-607.203) (-604.734) [-606.042] -- 0:00:51
Average standard deviation of split frequencies: 0.019686
175500 -- (-602.524) (-603.417) [-603.154] (-603.543) * (-603.065) [-604.802] (-603.569) (-604.773) -- 0:00:51
176000 -- (-608.228) (-603.872) [-606.905] (-602.787) * (-607.200) (-603.197) [-605.020] (-604.538) -- 0:00:51
176500 -- [-608.617] (-602.395) (-605.596) (-603.187) * (-604.912) [-604.761] (-602.203) (-603.076) -- 0:00:51
177000 -- (-605.551) [-603.079] (-602.612) (-603.530) * [-606.283] (-604.153) (-605.257) (-602.356) -- 0:00:51
177500 -- [-604.624] (-604.524) (-605.273) (-604.585) * [-602.881] (-603.041) (-610.185) (-603.022) -- 0:00:50
178000 -- [-603.495] (-602.591) (-606.494) (-607.389) * (-606.735) (-603.632) (-611.288) [-602.904] -- 0:00:50
178500 -- (-603.235) (-606.514) [-604.854] (-609.478) * (-604.829) (-603.168) (-610.013) [-604.186] -- 0:00:50
179000 -- (-607.285) (-602.591) (-605.610) [-604.915] * (-604.578) (-603.843) (-603.869) [-603.522] -- 0:00:50
179500 -- (-605.195) (-604.136) (-602.697) [-602.867] * (-604.438) (-608.064) (-605.325) [-602.249] -- 0:00:50
180000 -- [-603.991] (-604.270) (-604.285) (-606.717) * (-603.575) [-602.702] (-603.377) (-603.509) -- 0:00:50
Average standard deviation of split frequencies: 0.019961
180500 -- (-610.102) (-604.334) [-603.346] (-603.605) * (-603.427) (-605.277) [-603.173] (-604.027) -- 0:00:49
181000 -- (-605.775) (-603.999) (-603.975) [-603.274] * [-603.936] (-603.873) (-607.617) (-610.076) -- 0:00:49
181500 -- (-604.464) (-603.093) (-605.324) [-602.388] * (-603.828) (-603.226) [-602.871] (-605.588) -- 0:00:49
182000 -- (-604.712) (-603.785) [-604.196] (-604.735) * (-602.015) [-603.023] (-602.850) (-603.879) -- 0:00:49
182500 -- (-603.755) (-604.387) [-603.603] (-602.529) * [-602.777] (-606.643) (-603.084) (-604.653) -- 0:00:49
183000 -- [-602.208] (-602.285) (-605.818) (-604.903) * (-606.775) (-602.723) [-607.131] (-606.286) -- 0:00:53
183500 -- (-604.937) (-602.371) [-602.354] (-604.609) * (-603.912) (-602.914) (-605.774) [-604.429] -- 0:00:53
184000 -- [-604.473] (-603.422) (-602.450) (-602.840) * [-603.258] (-603.387) (-603.317) (-604.854) -- 0:00:53
184500 -- (-603.614) (-607.095) (-604.086) [-603.864] * (-604.904) (-604.678) [-603.388] (-605.354) -- 0:00:53
185000 -- [-602.951] (-607.180) (-606.512) (-604.346) * (-602.292) (-602.607) [-603.647] (-604.377) -- 0:00:52
Average standard deviation of split frequencies: 0.020402
185500 -- (-605.198) (-605.571) [-607.256] (-603.020) * (-603.168) (-602.918) (-603.479) [-604.720] -- 0:00:52
186000 -- (-606.618) (-605.023) [-603.858] (-606.500) * (-608.629) [-603.698] (-603.852) (-602.899) -- 0:00:52
186500 -- (-602.295) [-603.286] (-604.625) (-605.200) * [-603.240] (-604.928) (-603.291) (-603.156) -- 0:00:52
187000 -- (-607.768) (-603.892) [-603.004] (-604.816) * (-603.860) [-603.836] (-602.037) (-603.213) -- 0:00:52
187500 -- (-604.851) (-605.737) (-605.603) [-606.719] * (-605.235) (-602.665) (-602.050) [-602.821] -- 0:00:52
188000 -- [-605.786] (-603.188) (-604.284) (-602.760) * (-605.053) (-604.683) (-603.122) [-602.747] -- 0:00:51
188500 -- (-603.505) (-605.360) [-602.613] (-603.565) * (-602.723) (-604.384) [-605.977] (-605.061) -- 0:00:51
189000 -- (-603.426) (-605.076) (-605.874) [-604.404] * [-603.819] (-605.178) (-602.652) (-604.964) -- 0:00:51
189500 -- (-604.759) (-605.524) [-604.251] (-603.782) * (-603.346) [-602.404] (-603.893) (-606.831) -- 0:00:51
190000 -- [-604.088] (-605.119) (-604.975) (-604.256) * (-605.126) [-603.693] (-602.957) (-604.387) -- 0:00:51
Average standard deviation of split frequencies: 0.022252
190500 -- (-606.209) (-606.987) (-603.159) [-606.644] * (-603.214) [-606.226] (-604.001) (-607.289) -- 0:00:50
191000 -- (-607.943) (-606.918) (-606.530) [-603.843] * [-604.320] (-605.907) (-603.062) (-606.977) -- 0:00:50
191500 -- (-605.156) [-601.959] (-604.689) (-604.774) * (-603.400) (-604.324) (-605.609) [-602.048] -- 0:00:50
192000 -- [-603.131] (-606.904) (-605.036) (-606.595) * (-603.071) (-603.228) (-603.596) [-602.631] -- 0:00:50
192500 -- [-603.065] (-605.496) (-603.711) (-605.252) * (-604.028) (-602.732) (-603.547) [-606.724] -- 0:00:50
193000 -- (-602.701) (-602.538) [-605.231] (-602.922) * (-602.172) [-604.832] (-604.183) (-601.967) -- 0:00:50
193500 -- (-604.317) (-604.130) (-602.597) [-604.477] * (-605.243) [-603.637] (-604.583) (-602.000) -- 0:00:50
194000 -- (-610.779) (-606.704) (-605.398) [-603.267] * (-603.587) [-603.790] (-604.148) (-607.598) -- 0:00:49
194500 -- (-606.316) [-604.924] (-604.401) (-607.865) * (-607.093) [-603.300] (-602.827) (-608.187) -- 0:00:49
195000 -- [-604.487] (-603.437) (-608.055) (-602.734) * (-603.315) (-606.220) (-603.349) [-607.232] -- 0:00:49
Average standard deviation of split frequencies: 0.021526
195500 -- (-605.606) (-605.173) (-603.441) [-602.673] * [-602.680] (-607.702) (-602.655) (-605.517) -- 0:00:53
196000 -- (-607.015) (-604.172) (-603.765) [-605.856] * (-603.771) (-605.315) (-604.625) [-605.550] -- 0:00:53
196500 -- [-605.567] (-604.890) (-609.308) (-602.662) * (-602.677) (-607.152) [-603.320] (-603.835) -- 0:00:53
197000 -- (-602.182) (-604.580) [-603.628] (-602.616) * [-603.107] (-603.683) (-605.790) (-605.124) -- 0:00:52
197500 -- (-607.460) (-605.199) (-603.747) [-605.361] * (-602.315) (-605.182) [-603.502] (-611.433) -- 0:00:52
198000 -- (-606.711) (-603.011) (-606.217) [-603.619] * [-602.918] (-608.124) (-603.875) (-603.719) -- 0:00:52
198500 -- [-608.219] (-602.883) (-602.153) (-603.679) * (-603.334) (-603.045) (-603.342) [-603.046] -- 0:00:52
199000 -- (-607.981) [-602.993] (-603.217) (-607.234) * [-603.342] (-603.290) (-606.144) (-602.541) -- 0:00:52
199500 -- (-605.594) [-605.526] (-603.249) (-602.441) * (-610.749) [-605.475] (-603.740) (-603.199) -- 0:00:52
200000 -- (-605.194) (-604.726) (-603.339) [-603.480] * (-604.037) (-604.811) [-604.920] (-604.729) -- 0:00:51
Average standard deviation of split frequencies: 0.023121
200500 -- (-605.235) (-604.067) [-604.639] (-603.100) * (-605.688) [-602.685] (-605.753) (-603.199) -- 0:00:51
201000 -- (-604.050) (-603.104) [-605.374] (-604.389) * (-604.175) (-604.004) [-603.314] (-606.490) -- 0:00:51
201500 -- (-602.690) [-607.835] (-606.445) (-607.357) * (-606.396) (-604.801) [-603.966] (-603.774) -- 0:00:51
202000 -- (-604.027) (-602.547) (-611.917) [-605.399] * (-604.082) (-606.002) (-603.867) [-602.376] -- 0:00:51
202500 -- [-604.836] (-602.883) (-604.177) (-603.986) * [-604.604] (-606.391) (-606.819) (-602.335) -- 0:00:51
203000 -- (-605.468) (-607.588) (-603.856) [-603.892] * (-607.133) (-609.044) (-604.423) [-602.118] -- 0:00:51
203500 -- (-605.840) (-608.674) [-603.998] (-605.073) * [-605.868] (-603.035) (-603.631) (-602.470) -- 0:00:50
204000 -- [-605.260] (-603.623) (-604.985) (-604.221) * (-602.185) [-602.144] (-601.860) (-604.362) -- 0:00:50
204500 -- (-607.170) (-604.287) (-603.106) [-602.021] * (-602.333) [-601.993] (-603.420) (-603.877) -- 0:00:50
205000 -- (-608.809) [-606.832] (-603.660) (-602.215) * (-604.263) (-603.384) [-602.206] (-608.612) -- 0:00:50
Average standard deviation of split frequencies: 0.023913
205500 -- [-606.242] (-604.822) (-602.048) (-607.193) * [-604.602] (-603.027) (-606.996) (-604.235) -- 0:00:50
206000 -- (-605.692) (-604.384) (-603.046) [-603.898] * (-603.589) (-602.999) [-602.464] (-604.339) -- 0:00:50
206500 -- (-605.149) (-608.241) (-607.836) [-602.872] * (-603.267) [-602.023] (-604.253) (-605.970) -- 0:00:49
207000 -- (-602.357) (-609.863) (-604.452) [-604.481] * (-603.255) (-606.329) (-604.408) [-602.762] -- 0:00:49
207500 -- (-603.606) (-604.181) [-603.885] (-602.546) * (-603.574) [-606.309] (-603.784) (-603.282) -- 0:00:49
208000 -- (-604.725) (-603.700) (-608.022) [-602.680] * (-603.026) (-609.163) (-604.086) [-603.606] -- 0:00:49
208500 -- (-603.078) (-606.592) (-604.423) [-604.632] * (-602.886) (-610.294) (-602.786) [-605.270] -- 0:00:49
209000 -- (-605.532) (-605.901) (-602.741) [-611.069] * (-604.349) (-603.237) [-602.979] (-602.981) -- 0:00:49
209500 -- (-604.505) (-606.286) (-603.495) [-606.317] * [-602.703] (-603.204) (-605.536) (-603.620) -- 0:00:49
210000 -- (-604.555) (-603.108) [-604.662] (-606.292) * (-603.124) (-604.713) (-604.746) [-603.745] -- 0:00:48
Average standard deviation of split frequencies: 0.024261
210500 -- (-606.632) (-604.467) (-602.476) [-604.634] * (-602.763) (-603.197) (-602.479) [-604.851] -- 0:00:48
211000 -- (-604.581) (-603.473) [-603.321] (-602.942) * [-603.616] (-603.490) (-607.466) (-604.223) -- 0:00:48
211500 -- (-604.962) (-605.626) (-605.637) [-603.891] * (-604.370) (-604.586) [-604.218] (-604.803) -- 0:00:48
212000 -- [-604.815] (-608.885) (-604.682) (-605.244) * (-602.380) (-604.200) (-605.100) [-605.082] -- 0:00:52
212500 -- (-603.351) (-605.390) (-609.914) [-603.900] * [-603.720] (-604.349) (-604.890) (-609.823) -- 0:00:51
213000 -- (-606.822) (-604.889) [-606.794] (-606.101) * (-605.563) (-604.553) [-602.797] (-605.666) -- 0:00:51
213500 -- (-603.399) [-602.949] (-606.513) (-605.251) * (-607.760) (-603.708) (-605.014) [-605.575] -- 0:00:51
214000 -- [-606.021] (-603.508) (-605.051) (-603.521) * (-604.976) (-602.480) (-607.202) [-605.959] -- 0:00:51
214500 -- [-603.242] (-604.709) (-604.146) (-604.919) * (-610.435) [-603.219] (-606.145) (-606.067) -- 0:00:51
215000 -- [-605.437] (-608.542) (-609.208) (-603.892) * [-606.939] (-602.175) (-605.258) (-611.935) -- 0:00:51
Average standard deviation of split frequencies: 0.025500
215500 -- (-608.096) (-603.906) (-606.623) [-604.377] * (-605.039) (-603.557) [-605.540] (-611.085) -- 0:00:50
216000 -- (-605.479) (-604.051) [-602.818] (-603.335) * (-605.793) (-604.509) (-604.019) [-603.150] -- 0:00:50
216500 -- (-602.984) (-603.926) (-602.203) [-602.954] * (-607.041) [-602.891] (-604.476) (-606.748) -- 0:00:50
217000 -- (-603.870) (-602.731) [-605.569] (-604.331) * [-604.424] (-605.089) (-606.691) (-607.674) -- 0:00:50
217500 -- (-604.592) (-604.192) (-606.625) [-605.342] * (-606.286) (-602.767) (-606.034) [-607.491] -- 0:00:50
218000 -- (-603.112) (-606.646) (-606.513) [-605.068] * (-605.693) (-604.530) [-606.765] (-602.947) -- 0:00:50
218500 -- (-603.174) (-604.760) [-605.418] (-602.596) * (-602.983) (-607.545) [-606.041] (-603.061) -- 0:00:50
219000 -- [-605.906] (-605.050) (-605.914) (-603.790) * (-607.903) (-604.906) (-611.755) [-602.593] -- 0:00:49
219500 -- (-605.321) [-606.398] (-605.620) (-604.333) * (-605.597) [-602.318] (-612.934) (-604.452) -- 0:00:49
220000 -- (-605.749) (-606.429) (-604.015) [-604.741] * (-607.649) (-603.109) (-604.476) [-603.065] -- 0:00:49
Average standard deviation of split frequencies: 0.026535
220500 -- [-606.002] (-607.089) (-604.798) (-602.685) * [-606.305] (-605.170) (-604.731) (-608.107) -- 0:00:49
221000 -- (-604.959) (-606.833) [-602.500] (-602.542) * (-606.059) (-605.099) [-604.372] (-603.540) -- 0:00:49
221500 -- (-604.790) [-603.186] (-603.696) (-603.966) * (-602.761) (-602.706) [-605.264] (-603.367) -- 0:00:49
222000 -- (-603.793) (-607.241) (-602.217) [-604.469] * [-602.937] (-603.505) (-604.461) (-604.291) -- 0:00:49
222500 -- (-603.776) [-602.842] (-602.391) (-603.818) * (-604.606) (-605.737) [-604.402] (-602.854) -- 0:00:48
223000 -- (-602.884) (-604.023) [-603.446] (-607.272) * [-603.002] (-602.980) (-603.981) (-603.606) -- 0:00:48
223500 -- (-604.346) (-603.038) (-603.606) [-602.261] * [-604.205] (-602.818) (-604.182) (-602.073) -- 0:00:48
224000 -- [-602.838] (-602.561) (-605.796) (-604.566) * [-604.335] (-605.886) (-603.769) (-603.083) -- 0:00:48
224500 -- [-603.438] (-602.063) (-603.481) (-606.477) * (-608.966) (-604.199) (-604.890) [-602.113] -- 0:00:48
225000 -- (-603.902) (-605.050) (-603.772) [-606.215] * (-608.162) (-603.292) [-606.697] (-603.098) -- 0:00:48
Average standard deviation of split frequencies: 0.026282
225500 -- (-604.864) (-602.926) [-603.270] (-606.138) * [-603.963] (-604.437) (-603.086) (-604.300) -- 0:00:48
226000 -- (-606.354) (-603.685) (-603.925) [-603.755] * (-603.090) (-602.528) (-603.850) [-603.955] -- 0:00:47
226500 -- [-605.457] (-602.814) (-603.594) (-602.233) * [-602.800] (-607.884) (-605.519) (-601.738) -- 0:00:47
227000 -- (-604.782) (-606.643) [-603.750] (-603.088) * (-602.800) [-606.938] (-607.164) (-602.972) -- 0:00:47
227500 -- (-606.662) (-602.654) [-602.509] (-605.206) * (-603.584) [-603.792] (-607.463) (-603.244) -- 0:00:47
228000 -- [-603.914] (-605.411) (-605.210) (-604.751) * (-605.925) [-603.951] (-607.838) (-603.282) -- 0:00:47
228500 -- (-603.465) (-605.428) [-602.792] (-607.042) * (-607.655) (-603.685) (-606.599) [-603.803] -- 0:00:50
229000 -- (-605.770) (-603.685) (-603.408) [-604.057] * (-606.448) (-602.745) (-605.080) [-603.221] -- 0:00:50
229500 -- (-604.911) [-605.406] (-606.483) (-603.370) * (-609.047) (-602.422) [-605.082] (-606.681) -- 0:00:50
230000 -- (-604.654) (-605.035) (-606.292) [-605.925] * [-603.024] (-604.096) (-604.100) (-609.938) -- 0:00:50
Average standard deviation of split frequencies: 0.025600
230500 -- [-602.139] (-602.334) (-603.387) (-607.050) * (-606.915) (-604.951) (-605.766) [-604.447] -- 0:00:50
231000 -- (-604.127) (-603.984) (-603.212) [-604.616] * [-604.598] (-607.448) (-606.336) (-602.537) -- 0:00:49
231500 -- [-604.992] (-603.007) (-602.124) (-604.329) * (-602.391) (-610.729) (-602.666) [-602.403] -- 0:00:49
232000 -- [-603.429] (-605.745) (-604.194) (-605.424) * [-604.449] (-606.587) (-602.933) (-602.139) -- 0:00:49
232500 -- (-603.011) (-605.938) [-602.119] (-603.031) * (-603.948) [-602.236] (-607.745) (-605.820) -- 0:00:49
233000 -- (-602.879) (-607.725) [-602.746] (-605.284) * (-605.676) [-603.391] (-604.070) (-604.441) -- 0:00:49
233500 -- (-605.124) [-605.215] (-604.243) (-607.630) * (-604.088) (-605.283) [-603.329] (-610.954) -- 0:00:49
234000 -- (-603.878) (-604.906) [-603.058] (-607.267) * (-605.916) (-604.703) [-602.145] (-604.457) -- 0:00:49
234500 -- (-604.138) [-602.759] (-602.972) (-603.094) * (-607.112) [-603.923] (-602.588) (-603.135) -- 0:00:48
235000 -- [-604.114] (-603.855) (-605.994) (-602.694) * (-604.139) (-602.576) [-605.293] (-605.951) -- 0:00:48
Average standard deviation of split frequencies: 0.024706
235500 -- [-605.038] (-603.194) (-602.965) (-603.283) * [-604.720] (-604.432) (-603.204) (-605.638) -- 0:00:48
236000 -- [-603.700] (-602.491) (-607.004) (-603.637) * (-604.454) (-603.528) (-607.631) [-604.987] -- 0:00:48
236500 -- (-604.024) (-602.757) [-608.954] (-604.207) * (-604.339) (-605.116) [-603.963] (-605.030) -- 0:00:48
237000 -- (-604.950) [-603.214] (-608.818) (-603.700) * (-605.112) [-603.418] (-602.741) (-603.838) -- 0:00:48
237500 -- [-604.894] (-606.610) (-603.010) (-603.169) * (-605.643) [-603.498] (-602.205) (-607.773) -- 0:00:48
238000 -- (-604.067) (-606.711) (-602.659) [-605.912] * (-605.129) [-603.720] (-603.930) (-604.315) -- 0:00:48
238500 -- (-603.099) (-607.318) (-602.257) [-602.138] * (-602.851) (-604.877) (-606.201) [-605.926] -- 0:00:47
239000 -- (-605.426) [-603.635] (-606.199) (-608.446) * (-605.922) (-607.423) (-603.668) [-604.343] -- 0:00:47
239500 -- (-603.035) (-606.589) [-603.775] (-606.420) * [-604.600] (-609.465) (-603.315) (-605.799) -- 0:00:47
240000 -- (-604.416) (-612.677) (-606.399) [-603.847] * (-606.911) (-603.981) (-602.546) [-604.631] -- 0:00:47
Average standard deviation of split frequencies: 0.023093
240500 -- (-609.356) (-605.033) (-603.425) [-603.865] * (-604.722) (-603.743) [-605.254] (-604.622) -- 0:00:47
241000 -- (-606.224) (-604.127) [-605.794] (-607.874) * [-602.576] (-604.823) (-602.139) (-604.442) -- 0:00:47
241500 -- (-603.093) [-603.633] (-609.225) (-604.540) * (-603.601) [-603.264] (-603.743) (-603.033) -- 0:00:47
242000 -- (-606.381) (-604.055) [-605.780] (-604.626) * (-605.944) (-604.606) (-604.737) [-609.686] -- 0:00:46
242500 -- (-604.125) [-603.864] (-602.575) (-604.628) * (-604.915) [-605.738] (-602.772) (-606.995) -- 0:00:46
243000 -- [-602.441] (-606.347) (-602.522) (-603.856) * [-603.218] (-603.329) (-602.785) (-605.891) -- 0:00:46
243500 -- (-605.921) (-604.853) (-608.580) [-602.525] * (-602.955) [-607.674] (-607.980) (-604.849) -- 0:00:46
244000 -- (-603.129) (-604.817) (-605.746) [-605.468] * (-604.446) [-603.392] (-605.859) (-604.485) -- 0:00:46
244500 -- (-603.102) [-606.567] (-603.648) (-603.133) * (-604.675) [-604.130] (-606.462) (-602.193) -- 0:00:46
245000 -- (-603.241) [-603.751] (-603.738) (-602.875) * (-604.683) [-603.173] (-606.196) (-602.451) -- 0:00:46
Average standard deviation of split frequencies: 0.023096
245500 -- [-603.466] (-605.402) (-605.860) (-602.386) * (-604.842) (-602.871) [-603.524] (-603.392) -- 0:00:49
246000 -- [-608.874] (-604.853) (-604.195) (-602.595) * (-603.522) (-602.236) [-602.138] (-601.992) -- 0:00:49
246500 -- (-611.775) (-604.278) (-606.736) [-602.253] * (-603.295) (-602.826) [-602.800] (-603.893) -- 0:00:48
247000 -- [-603.596] (-605.870) (-605.442) (-605.412) * (-603.987) (-603.347) [-607.239] (-604.417) -- 0:00:48
247500 -- [-604.466] (-608.988) (-607.848) (-605.236) * (-604.645) (-602.893) (-605.394) [-605.194] -- 0:00:48
248000 -- (-606.081) (-603.913) (-606.393) [-602.702] * (-602.659) (-605.360) (-605.777) [-605.870] -- 0:00:48
248500 -- (-602.371) (-605.956) (-604.426) [-605.974] * [-603.299] (-603.346) (-603.292) (-603.354) -- 0:00:48
249000 -- (-602.750) (-604.070) (-603.196) [-608.891] * (-605.442) (-603.373) [-602.745] (-604.892) -- 0:00:48
249500 -- (-603.517) (-603.833) (-607.919) [-604.369] * (-605.781) (-605.640) [-603.853] (-605.437) -- 0:00:48
250000 -- (-605.255) (-604.044) [-602.246] (-604.548) * [-602.254] (-605.762) (-604.817) (-606.464) -- 0:00:48
Average standard deviation of split frequencies: 0.023925
250500 -- [-609.064] (-604.068) (-604.198) (-604.917) * (-603.409) (-603.598) [-603.437] (-604.094) -- 0:00:47
251000 -- (-608.341) (-602.542) (-604.940) [-604.152] * (-603.605) (-602.787) (-603.554) [-603.428] -- 0:00:47
251500 -- (-607.771) (-606.715) [-604.023] (-604.448) * [-602.515] (-603.167) (-604.166) (-605.336) -- 0:00:47
252000 -- [-603.261] (-603.672) (-603.968) (-604.375) * (-604.317) (-605.819) [-603.719] (-605.648) -- 0:00:47
252500 -- (-603.599) [-603.099] (-606.593) (-605.165) * (-605.769) [-605.122] (-603.590) (-606.427) -- 0:00:47
253000 -- (-603.516) [-603.935] (-605.250) (-602.385) * (-603.992) (-608.038) [-604.838] (-604.542) -- 0:00:47
253500 -- (-606.682) [-605.010] (-604.903) (-604.312) * (-603.918) [-604.285] (-602.596) (-603.956) -- 0:00:47
254000 -- (-604.404) [-603.286] (-602.463) (-602.911) * (-606.724) [-604.289] (-604.772) (-605.862) -- 0:00:46
254500 -- (-604.217) (-603.727) [-605.075] (-603.043) * (-605.473) (-604.978) (-605.512) [-605.207] -- 0:00:46
255000 -- [-604.823] (-603.731) (-603.202) (-605.251) * (-605.450) (-603.692) [-602.453] (-605.288) -- 0:00:46
Average standard deviation of split frequencies: 0.024041
255500 -- [-604.830] (-603.201) (-603.004) (-605.068) * (-603.908) (-602.446) [-603.168] (-606.778) -- 0:00:46
256000 -- (-602.910) (-608.387) (-605.049) [-606.193] * (-603.667) (-606.226) [-611.200] (-607.234) -- 0:00:46
256500 -- [-604.200] (-606.027) (-603.827) (-607.947) * [-602.600] (-602.718) (-605.441) (-603.880) -- 0:00:46
257000 -- (-609.627) (-606.170) (-604.343) [-603.755] * (-602.196) (-606.778) (-605.597) [-604.680] -- 0:00:46
257500 -- (-602.798) [-603.143] (-605.692) (-602.828) * [-604.175] (-607.456) (-606.994) (-602.963) -- 0:00:46
258000 -- (-606.050) (-603.556) (-606.004) [-604.407] * [-602.733] (-604.727) (-605.394) (-606.178) -- 0:00:46
258500 -- [-605.783] (-602.465) (-607.099) (-606.301) * (-603.745) (-604.797) [-606.434] (-605.934) -- 0:00:45
259000 -- (-603.510) [-602.348] (-602.739) (-605.185) * [-603.862] (-605.064) (-604.771) (-603.023) -- 0:00:45
259500 -- [-604.432] (-603.069) (-604.691) (-603.095) * [-604.817] (-602.626) (-607.751) (-605.972) -- 0:00:45
260000 -- (-604.200) (-603.031) [-603.279] (-603.813) * (-610.173) (-604.527) (-604.453) [-602.729] -- 0:00:45
Average standard deviation of split frequencies: 0.024113
260500 -- [-606.759] (-602.950) (-605.418) (-604.070) * (-603.025) (-608.264) [-603.775] (-604.295) -- 0:00:45
261000 -- (-604.715) [-604.188] (-604.546) (-605.910) * (-605.779) (-603.112) [-607.365] (-603.994) -- 0:00:45
261500 -- (-605.092) [-604.419] (-603.804) (-605.787) * [-602.618] (-602.493) (-606.440) (-607.587) -- 0:00:45
262000 -- (-603.680) (-603.122) (-604.587) [-605.103] * [-605.718] (-603.957) (-603.323) (-603.795) -- 0:00:45
262500 -- (-604.196) [-603.063] (-602.553) (-603.915) * [-608.023] (-607.574) (-602.092) (-603.217) -- 0:00:47
263000 -- (-603.787) (-603.640) (-603.705) [-604.698] * [-602.658] (-603.823) (-603.538) (-604.479) -- 0:00:47
263500 -- [-603.544] (-602.496) (-607.258) (-604.118) * [-604.028] (-603.005) (-602.916) (-603.252) -- 0:00:47
264000 -- (-604.232) [-602.162] (-603.325) (-609.709) * [-602.988] (-604.090) (-604.074) (-602.885) -- 0:00:47
264500 -- (-604.985) [-606.480] (-602.747) (-606.870) * [-604.585] (-603.364) (-604.646) (-602.986) -- 0:00:47
265000 -- [-603.363] (-602.638) (-603.203) (-604.945) * (-604.122) (-608.082) (-604.967) [-602.428] -- 0:00:47
Average standard deviation of split frequencies: 0.023412
265500 -- [-602.754] (-605.398) (-604.202) (-603.875) * (-606.001) (-605.054) (-602.208) [-604.299] -- 0:00:47
266000 -- (-603.374) (-605.916) (-602.939) [-602.281] * (-605.113) (-606.082) [-602.768] (-605.318) -- 0:00:46
266500 -- (-611.373) [-602.397] (-603.940) (-602.856) * (-603.038) (-602.447) (-604.685) [-603.360] -- 0:00:46
267000 -- (-611.322) (-602.219) [-603.149] (-602.745) * [-604.700] (-603.168) (-603.937) (-603.242) -- 0:00:46
267500 -- [-605.452] (-602.870) (-602.382) (-604.010) * (-606.072) (-608.156) [-605.761] (-602.636) -- 0:00:46
268000 -- (-605.561) (-602.794) (-603.720) [-602.994] * [-603.420] (-606.642) (-602.621) (-603.450) -- 0:00:46
268500 -- (-603.866) [-603.320] (-604.302) (-602.308) * (-605.728) [-603.447] (-602.324) (-603.896) -- 0:00:46
269000 -- [-604.160] (-603.671) (-605.735) (-604.249) * (-606.117) [-604.749] (-607.769) (-603.926) -- 0:00:46
269500 -- (-602.672) (-603.156) [-603.255] (-604.173) * (-605.887) (-605.307) (-603.098) [-604.168] -- 0:00:46
270000 -- (-607.015) (-604.624) [-604.956] (-604.629) * [-602.886] (-602.395) (-605.080) (-603.700) -- 0:00:45
Average standard deviation of split frequencies: 0.022183
270500 -- (-606.538) (-605.093) (-603.963) [-605.254] * (-602.275) (-608.883) [-609.154] (-608.337) -- 0:00:45
271000 -- (-602.474) (-602.693) [-606.962] (-602.020) * [-602.640] (-605.207) (-603.291) (-605.421) -- 0:00:45
271500 -- (-602.345) [-605.868] (-604.470) (-603.796) * (-603.998) (-602.849) (-602.877) [-602.881] -- 0:00:45
272000 -- (-604.348) (-602.996) (-604.536) [-602.985] * [-603.396] (-604.550) (-608.386) (-605.765) -- 0:00:45
272500 -- (-606.099) (-603.671) (-605.582) [-603.949] * (-603.038) [-604.573] (-604.724) (-602.985) -- 0:00:45
273000 -- (-603.340) [-603.212] (-602.522) (-606.270) * (-603.978) [-602.607] (-605.220) (-604.871) -- 0:00:45
273500 -- [-603.146] (-603.754) (-602.604) (-604.613) * (-605.538) (-603.180) [-603.769] (-602.620) -- 0:00:45
274000 -- (-603.277) (-603.193) (-602.647) [-606.453] * (-606.401) (-604.894) (-604.981) [-607.146] -- 0:00:45
274500 -- (-603.324) (-603.309) (-603.591) [-603.745] * (-604.988) [-603.640] (-606.204) (-605.866) -- 0:00:44
275000 -- (-603.282) (-607.761) (-605.529) [-603.074] * (-604.012) (-604.223) [-603.284] (-602.825) -- 0:00:44
Average standard deviation of split frequencies: 0.022204
275500 -- (-603.298) (-604.796) (-603.439) [-604.950] * (-604.541) (-606.234) (-605.798) [-603.411] -- 0:00:44
276000 -- (-603.170) (-604.273) [-604.862] (-603.784) * (-606.789) (-605.000) [-602.492] (-604.244) -- 0:00:44
276500 -- (-605.153) (-604.247) (-602.515) [-603.291] * [-605.149] (-603.495) (-602.638) (-601.909) -- 0:00:44
277000 -- (-602.763) [-602.196] (-606.892) (-605.388) * [-602.776] (-603.636) (-603.642) (-605.530) -- 0:00:44
277500 -- (-602.891) (-603.153) (-606.538) [-604.276] * (-609.492) (-606.552) [-604.742] (-603.893) -- 0:00:44
278000 -- (-603.490) (-607.837) [-602.824] (-602.837) * (-603.691) [-607.533] (-604.743) (-603.694) -- 0:00:44
278500 -- [-607.461] (-614.581) (-603.800) (-603.858) * (-603.279) (-605.125) (-606.344) [-602.533] -- 0:00:44
279000 -- [-604.355] (-606.292) (-605.079) (-605.521) * (-602.993) [-604.202] (-603.132) (-603.442) -- 0:00:43
279500 -- (-607.340) [-603.330] (-604.962) (-604.867) * (-603.199) [-608.437] (-602.595) (-603.853) -- 0:00:46
280000 -- (-602.859) (-606.848) (-605.970) [-603.851] * (-602.804) (-605.527) [-604.243] (-603.517) -- 0:00:46
Average standard deviation of split frequencies: 0.022100
280500 -- (-602.160) [-604.626] (-603.787) (-604.065) * [-603.209] (-602.722) (-605.292) (-605.468) -- 0:00:46
281000 -- (-603.792) (-604.124) (-606.399) [-602.503] * (-605.263) (-604.489) [-604.725] (-605.736) -- 0:00:46
281500 -- [-602.994] (-604.102) (-603.559) (-603.507) * (-605.259) (-601.905) (-603.177) [-604.941] -- 0:00:45
282000 -- (-602.979) (-605.495) (-604.179) [-605.856] * (-608.905) [-605.621] (-606.166) (-606.069) -- 0:00:45
282500 -- (-603.810) (-605.790) [-604.688] (-604.604) * (-605.759) [-603.229] (-604.190) (-608.864) -- 0:00:45
283000 -- [-602.888] (-603.769) (-602.753) (-607.022) * (-603.055) (-609.403) [-604.858] (-608.716) -- 0:00:45
283500 -- (-604.269) (-602.944) [-603.573] (-604.722) * (-604.041) (-608.402) [-605.157] (-605.301) -- 0:00:45
284000 -- [-604.761] (-602.487) (-604.521) (-605.206) * (-603.502) (-604.156) [-608.798] (-608.961) -- 0:00:45
284500 -- (-604.922) (-605.840) [-603.589] (-605.129) * [-605.126] (-605.001) (-606.186) (-611.348) -- 0:00:45
285000 -- [-604.916] (-606.415) (-605.829) (-605.372) * (-608.061) [-607.535] (-603.591) (-606.528) -- 0:00:45
Average standard deviation of split frequencies: 0.022208
285500 -- (-602.709) (-606.964) [-604.640] (-606.879) * (-604.372) (-610.338) [-603.720] (-605.105) -- 0:00:45
286000 -- [-603.591] (-604.848) (-603.375) (-605.208) * (-605.671) (-607.905) [-605.165] (-603.100) -- 0:00:44
286500 -- (-605.427) (-603.220) (-604.678) [-602.792] * [-604.358] (-603.194) (-606.547) (-603.455) -- 0:00:44
287000 -- [-602.223] (-603.829) (-603.927) (-604.455) * (-603.487) [-605.983] (-604.257) (-603.388) -- 0:00:44
287500 -- (-603.304) (-605.755) [-604.136] (-604.323) * (-606.627) [-605.905] (-604.292) (-605.410) -- 0:00:44
288000 -- (-603.972) (-605.012) (-605.212) [-604.215] * (-603.890) [-603.967] (-605.123) (-603.952) -- 0:00:44
288500 -- (-603.351) (-603.548) (-602.588) [-603.738] * (-606.669) [-604.508] (-603.249) (-604.986) -- 0:00:44
289000 -- (-603.304) (-609.630) [-606.298] (-605.505) * (-603.113) (-603.642) [-602.582] (-603.923) -- 0:00:44
289500 -- (-605.416) (-603.126) [-603.816] (-603.972) * (-604.396) (-603.477) [-604.973] (-602.188) -- 0:00:44
290000 -- (-605.380) (-602.219) (-603.744) [-605.809] * (-604.986) (-603.599) [-603.209] (-602.609) -- 0:00:44
Average standard deviation of split frequencies: 0.022615
290500 -- (-602.815) (-606.780) [-602.476] (-603.454) * (-607.331) [-603.762] (-603.693) (-601.899) -- 0:00:43
291000 -- (-604.336) [-603.853] (-605.925) (-604.712) * (-603.942) [-604.277] (-605.743) (-601.903) -- 0:00:43
291500 -- (-607.425) (-604.642) [-608.231] (-605.183) * (-605.538) [-602.846] (-603.262) (-603.710) -- 0:00:43
292000 -- (-605.866) (-603.982) (-606.249) [-605.450] * (-605.004) [-605.867] (-604.758) (-606.468) -- 0:00:43
292500 -- [-604.441] (-602.241) (-603.485) (-605.984) * (-605.186) [-605.143] (-602.298) (-602.830) -- 0:00:43
293000 -- (-603.223) [-602.631] (-608.595) (-603.169) * (-605.318) (-604.230) [-607.436] (-607.469) -- 0:00:43
293500 -- (-604.751) (-604.305) (-603.163) [-607.243] * (-608.267) [-604.451] (-603.358) (-603.773) -- 0:00:43
294000 -- (-608.272) (-604.672) [-606.195] (-604.203) * (-605.992) (-602.498) [-604.722] (-603.491) -- 0:00:43
294500 -- (-607.773) [-602.481] (-602.309) (-602.617) * (-602.027) (-603.625) (-604.554) [-603.001] -- 0:00:43
295000 -- (-606.007) [-605.946] (-604.506) (-602.438) * (-610.626) (-605.249) (-603.834) [-602.262] -- 0:00:43
Average standard deviation of split frequencies: 0.022031
295500 -- [-606.703] (-602.189) (-604.350) (-604.182) * [-604.106] (-605.453) (-604.578) (-604.431) -- 0:00:42
296000 -- [-602.639] (-603.853) (-608.326) (-605.261) * (-603.536) (-606.446) [-602.847] (-604.609) -- 0:00:45
296500 -- (-607.885) (-602.209) (-609.230) [-605.180] * (-603.084) (-608.542) (-602.127) [-602.426] -- 0:00:45
297000 -- (-602.413) [-601.840] (-606.957) (-602.901) * (-602.864) (-605.732) (-603.702) [-602.552] -- 0:00:44
297500 -- (-607.353) (-603.890) (-607.087) [-603.670] * (-607.611) (-606.007) [-607.910] (-605.520) -- 0:00:44
298000 -- (-606.897) [-603.222] (-603.786) (-602.559) * (-605.791) [-602.152] (-603.555) (-604.310) -- 0:00:44
298500 -- (-603.481) [-604.407] (-604.667) (-603.089) * (-603.969) [-604.880] (-602.208) (-608.082) -- 0:00:44
299000 -- (-606.132) (-602.298) [-604.367] (-609.003) * [-608.538] (-604.996) (-602.216) (-605.136) -- 0:00:44
299500 -- (-603.810) [-604.211] (-603.901) (-603.303) * [-603.119] (-605.128) (-601.976) (-604.434) -- 0:00:44
300000 -- (-604.666) (-604.627) (-607.428) [-603.198] * [-602.838] (-602.690) (-605.944) (-602.836) -- 0:00:44
Average standard deviation of split frequencies: 0.019947
300500 -- (-603.060) (-604.552) (-605.802) [-607.187] * (-604.784) (-604.069) [-603.144] (-603.792) -- 0:00:44
301000 -- (-604.400) (-602.792) (-603.431) [-604.618] * (-603.541) (-608.195) [-603.545] (-602.895) -- 0:00:44
301500 -- (-604.190) [-602.501] (-604.137) (-604.687) * (-611.523) (-605.705) (-602.310) [-604.427] -- 0:00:44
302000 -- [-602.074] (-602.151) (-603.999) (-606.036) * (-603.983) (-602.830) [-603.457] (-603.633) -- 0:00:43
302500 -- (-602.379) [-604.803] (-603.502) (-604.587) * (-603.498) (-603.626) [-602.358] (-609.440) -- 0:00:43
303000 -- (-603.097) (-606.381) [-604.857] (-603.041) * (-607.524) [-605.211] (-604.475) (-605.633) -- 0:00:43
303500 -- (-605.565) (-604.212) [-603.537] (-604.375) * (-606.602) (-603.766) [-602.353] (-606.982) -- 0:00:43
304000 -- (-602.749) [-604.312] (-604.100) (-606.565) * [-603.405] (-608.085) (-609.063) (-606.715) -- 0:00:43
304500 -- (-604.579) (-604.597) (-603.694) [-607.381] * (-604.070) (-604.178) (-607.409) [-606.051] -- 0:00:43
305000 -- (-605.657) [-605.337] (-603.915) (-602.385) * (-604.414) [-603.733] (-605.757) (-607.924) -- 0:00:43
Average standard deviation of split frequencies: 0.019856
305500 -- [-602.962] (-604.783) (-604.140) (-602.666) * (-601.723) (-603.913) (-604.289) [-607.117] -- 0:00:43
306000 -- (-604.554) [-602.617] (-608.342) (-603.690) * (-602.948) (-603.074) [-602.805] (-608.002) -- 0:00:43
306500 -- (-604.657) (-602.262) (-604.999) [-602.573] * (-604.956) [-604.275] (-602.423) (-604.091) -- 0:00:42
307000 -- [-602.274] (-602.590) (-605.267) (-602.604) * (-604.537) (-602.326) (-602.176) [-605.770] -- 0:00:42
307500 -- (-605.756) (-603.634) [-603.844] (-605.342) * (-602.899) (-602.760) [-602.908] (-603.823) -- 0:00:42
308000 -- (-603.714) (-603.393) [-602.021] (-604.466) * (-603.909) (-605.493) (-610.115) [-605.546] -- 0:00:42
308500 -- (-602.448) (-602.676) (-608.060) [-603.330] * (-604.315) [-603.893] (-602.888) (-605.918) -- 0:00:42
309000 -- (-604.790) [-604.478] (-605.380) (-602.463) * (-607.469) [-605.613] (-604.243) (-603.675) -- 0:00:42
309500 -- (-604.357) [-602.645] (-603.298) (-606.801) * (-606.099) [-604.854] (-607.531) (-606.771) -- 0:00:42
310000 -- (-603.580) (-602.649) [-602.180] (-604.113) * [-607.193] (-602.596) (-604.741) (-604.225) -- 0:00:42
Average standard deviation of split frequencies: 0.019810
310500 -- (-609.884) [-602.379] (-603.517) (-603.480) * (-602.877) (-603.675) [-602.869] (-609.198) -- 0:00:42
311000 -- [-602.491] (-602.677) (-602.727) (-609.645) * [-602.201] (-609.651) (-603.082) (-606.392) -- 0:00:42
311500 -- (-603.213) (-605.856) (-604.066) [-602.014] * (-603.752) (-608.722) [-603.273] (-606.599) -- 0:00:41
312000 -- (-603.612) (-604.833) (-603.474) [-607.090] * (-604.411) (-605.951) [-605.148] (-605.179) -- 0:00:41
312500 -- [-603.472] (-604.766) (-603.856) (-602.767) * (-604.004) (-604.493) (-603.027) [-602.938] -- 0:00:41
313000 -- (-604.805) [-603.569] (-604.306) (-604.373) * (-602.983) (-607.338) (-603.752) [-602.451] -- 0:00:43
313500 -- (-605.774) (-604.857) [-606.425] (-603.109) * (-602.513) (-604.201) (-603.774) [-603.763] -- 0:00:43
314000 -- (-605.632) (-607.320) (-604.366) [-603.810] * [-606.056] (-603.502) (-602.775) (-602.186) -- 0:00:43
314500 -- (-603.887) (-603.396) (-604.428) [-603.676] * (-602.541) (-602.559) (-602.156) [-602.098] -- 0:00:43
315000 -- (-603.293) (-602.643) [-604.301] (-604.423) * (-603.360) (-603.525) [-605.346] (-604.799) -- 0:00:43
Average standard deviation of split frequencies: 0.018979
315500 -- (-606.983) [-608.537] (-605.530) (-607.038) * (-602.989) (-603.294) [-603.563] (-602.671) -- 0:00:43
316000 -- (-606.527) [-603.287] (-608.930) (-602.684) * [-603.513] (-603.520) (-607.086) (-605.412) -- 0:00:43
316500 -- (-605.834) (-603.696) [-607.356] (-603.261) * (-603.420) (-604.434) (-604.777) [-605.002] -- 0:00:43
317000 -- (-602.735) [-602.748] (-603.326) (-601.784) * (-607.019) (-605.079) [-604.585] (-604.034) -- 0:00:43
317500 -- (-603.842) (-604.562) [-604.431] (-602.028) * [-605.035] (-607.704) (-604.940) (-604.964) -- 0:00:42
318000 -- (-606.521) (-602.746) (-605.278) [-605.286] * (-604.710) (-605.745) [-602.603] (-603.838) -- 0:00:42
318500 -- [-603.801] (-602.774) (-603.008) (-604.838) * (-602.668) [-604.832] (-604.454) (-603.872) -- 0:00:42
319000 -- (-609.826) (-606.417) (-604.067) [-602.328] * (-601.860) (-603.350) [-602.811] (-604.149) -- 0:00:42
319500 -- [-608.371] (-606.198) (-602.983) (-607.292) * (-604.151) (-602.358) (-606.638) [-606.434] -- 0:00:42
320000 -- (-603.084) (-604.281) (-604.352) [-606.759] * (-602.593) (-606.543) [-604.211] (-602.735) -- 0:00:42
Average standard deviation of split frequencies: 0.018213
320500 -- (-607.652) (-602.313) (-606.112) [-605.672] * (-603.193) (-604.142) [-604.913] (-603.432) -- 0:00:42
321000 -- (-606.272) (-605.633) (-611.868) [-604.402] * (-604.021) (-603.036) (-604.635) [-603.338] -- 0:00:42
321500 -- (-602.897) (-604.001) (-607.385) [-602.083] * [-603.640] (-602.221) (-604.035) (-604.891) -- 0:00:42
322000 -- (-602.855) [-602.171] (-606.357) (-604.862) * (-603.237) (-604.916) [-601.949] (-604.186) -- 0:00:42
322500 -- (-605.548) (-604.557) (-603.798) [-604.357] * (-602.906) (-607.738) [-603.623] (-603.607) -- 0:00:42
323000 -- [-604.735] (-605.071) (-605.230) (-604.558) * (-604.303) (-608.959) [-608.617] (-604.259) -- 0:00:41
323500 -- (-608.578) [-605.732] (-604.461) (-603.340) * (-606.808) (-606.135) (-606.284) [-602.650] -- 0:00:41
324000 -- (-608.058) (-602.949) [-603.245] (-603.247) * (-605.478) (-604.949) (-609.978) [-602.492] -- 0:00:41
324500 -- (-607.157) (-603.059) [-604.678] (-610.417) * [-605.708] (-606.158) (-605.605) (-602.892) -- 0:00:41
325000 -- (-607.097) (-604.308) (-607.716) [-604.653] * [-603.916] (-604.099) (-604.684) (-607.043) -- 0:00:41
Average standard deviation of split frequencies: 0.018638
325500 -- (-602.364) (-603.578) [-604.928] (-603.449) * (-602.886) [-602.052] (-602.711) (-604.162) -- 0:00:41
326000 -- [-604.226] (-602.619) (-603.078) (-604.108) * (-606.784) [-610.189] (-603.471) (-602.924) -- 0:00:41
326500 -- [-603.695] (-602.551) (-604.756) (-603.947) * (-604.458) (-610.205) (-603.961) [-602.546] -- 0:00:41
327000 -- [-602.473] (-602.194) (-604.380) (-603.012) * (-602.894) (-603.735) (-601.967) [-602.132] -- 0:00:41
327500 -- [-603.383] (-603.436) (-603.293) (-602.387) * (-604.985) (-604.468) (-614.385) [-602.841] -- 0:00:41
328000 -- (-604.146) [-604.596] (-602.338) (-602.728) * (-607.912) [-604.748] (-615.540) (-605.765) -- 0:00:40
328500 -- (-605.540) (-606.022) (-602.451) [-603.656] * (-604.601) (-610.579) [-605.812] (-606.819) -- 0:00:40
329000 -- [-602.593] (-604.032) (-601.743) (-603.169) * (-607.211) [-603.882] (-604.325) (-604.352) -- 0:00:42
329500 -- (-602.564) (-603.997) (-607.825) [-606.109] * (-602.814) (-605.971) [-604.611] (-607.424) -- 0:00:42
330000 -- (-604.865) (-605.539) [-606.877] (-605.237) * (-605.854) (-602.477) (-602.667) [-603.753] -- 0:00:42
Average standard deviation of split frequencies: 0.017345
330500 -- (-603.245) (-603.882) (-606.058) [-602.893] * (-608.381) [-605.151] (-602.388) (-609.973) -- 0:00:42
331000 -- [-605.613] (-603.191) (-606.258) (-604.847) * (-603.881) [-605.684] (-603.413) (-607.734) -- 0:00:42
331500 -- (-607.797) (-603.149) [-605.483] (-607.626) * (-602.734) [-606.565] (-605.407) (-602.150) -- 0:00:42
332000 -- (-603.110) (-605.099) (-607.678) [-603.704] * (-602.665) (-611.664) [-604.212] (-602.530) -- 0:00:42
332500 -- (-608.557) (-602.466) (-603.010) [-605.309] * (-602.449) (-607.644) [-603.977] (-603.587) -- 0:00:42
333000 -- (-606.999) (-603.416) (-607.536) [-602.867] * (-604.367) (-606.089) (-604.225) [-602.607] -- 0:00:42
333500 -- (-607.164) (-604.128) (-605.441) [-603.315] * (-607.543) (-605.512) (-602.856) [-604.459] -- 0:00:41
334000 -- (-603.058) (-604.094) (-603.778) [-603.341] * (-607.158) (-603.195) (-610.695) [-604.855] -- 0:00:41
334500 -- (-606.097) [-605.153] (-603.365) (-606.292) * [-605.761] (-605.784) (-606.559) (-609.764) -- 0:00:41
335000 -- (-608.530) (-603.093) (-606.869) [-605.804] * (-605.901) (-605.997) (-604.496) [-608.190] -- 0:00:41
Average standard deviation of split frequencies: 0.016836
335500 -- (-610.661) (-607.799) (-611.308) [-604.926] * [-603.145] (-605.197) (-605.351) (-604.937) -- 0:00:41
336000 -- (-609.720) [-601.960] (-610.356) (-604.084) * (-606.049) (-602.379) (-603.530) [-602.554] -- 0:00:41
336500 -- (-603.518) (-604.334) (-603.579) [-605.891] * (-602.526) [-604.079] (-604.479) (-603.514) -- 0:00:41
337000 -- (-603.640) [-607.435] (-604.534) (-605.132) * (-605.347) (-603.197) (-602.826) [-605.423] -- 0:00:41
337500 -- (-603.210) [-605.036] (-606.054) (-603.810) * (-602.254) (-602.831) [-603.237] (-606.833) -- 0:00:41
338000 -- (-606.549) (-604.557) (-603.916) [-603.412] * (-603.198) (-606.516) [-608.366] (-610.218) -- 0:00:41
338500 -- [-605.108] (-606.812) (-604.535) (-604.493) * (-602.634) (-607.573) [-603.645] (-605.602) -- 0:00:41
339000 -- (-603.699) [-604.595] (-603.132) (-605.126) * (-608.008) (-604.381) (-605.152) [-604.048] -- 0:00:40
339500 -- (-603.681) [-606.690] (-605.485) (-606.585) * (-605.234) (-603.307) (-602.386) [-603.162] -- 0:00:40
340000 -- (-605.412) (-605.418) [-603.973] (-606.501) * (-605.415) (-603.910) (-604.627) [-605.171] -- 0:00:40
Average standard deviation of split frequencies: 0.015990
340500 -- (-608.632) (-604.684) (-602.640) [-602.567] * [-605.650] (-607.382) (-602.117) (-603.417) -- 0:00:40
341000 -- (-604.469) (-606.143) (-605.501) [-603.651] * (-605.649) (-609.238) [-606.996] (-606.761) -- 0:00:40
341500 -- (-604.943) (-603.100) [-603.959] (-603.928) * (-606.510) [-605.734] (-605.889) (-606.783) -- 0:00:40
342000 -- [-604.556] (-603.078) (-603.363) (-605.656) * (-605.402) (-605.267) [-606.635] (-602.464) -- 0:00:40
342500 -- (-603.813) [-605.011] (-603.228) (-607.820) * (-604.076) (-606.135) [-602.377] (-603.892) -- 0:00:40
343000 -- (-604.587) (-608.279) [-606.863] (-603.095) * [-603.089] (-604.476) (-603.797) (-604.596) -- 0:00:40
343500 -- (-604.523) (-607.805) (-604.463) [-602.374] * [-602.515] (-603.856) (-604.642) (-604.477) -- 0:00:40
344000 -- (-603.325) [-605.132] (-605.469) (-603.235) * (-604.541) (-603.752) [-602.884] (-602.796) -- 0:00:40
344500 -- (-603.724) (-609.277) (-602.833) [-603.271] * [-603.963] (-605.548) (-603.362) (-602.510) -- 0:00:39
345000 -- (-603.171) (-602.667) [-603.919] (-604.003) * (-605.890) [-604.657] (-605.092) (-604.162) -- 0:00:41
Average standard deviation of split frequencies: 0.015214
345500 -- [-603.865] (-602.746) (-603.876) (-602.573) * [-603.342] (-604.059) (-604.275) (-605.755) -- 0:00:41
346000 -- (-604.674) [-602.710] (-608.254) (-602.074) * (-608.197) (-602.913) (-605.588) [-603.432] -- 0:00:41
346500 -- (-603.279) (-603.905) (-603.574) [-604.205] * [-603.165] (-604.104) (-603.058) (-604.398) -- 0:00:41
347000 -- (-604.459) (-609.179) [-602.428] (-605.084) * [-603.633] (-603.665) (-604.092) (-603.674) -- 0:00:41
347500 -- (-603.246) [-602.362] (-606.501) (-604.238) * [-603.925] (-603.978) (-607.321) (-604.363) -- 0:00:41
348000 -- (-602.346) (-602.886) (-604.115) [-606.399] * [-603.066] (-603.536) (-605.248) (-604.881) -- 0:00:41
348500 -- (-603.041) (-604.923) (-603.418) [-604.668] * (-607.303) [-603.181] (-603.969) (-604.357) -- 0:00:41
349000 -- (-603.170) (-604.170) [-603.018] (-606.667) * [-607.189] (-602.501) (-611.367) (-603.469) -- 0:00:41
349500 -- [-602.752] (-604.938) (-612.936) (-603.571) * (-610.267) (-605.767) (-604.797) [-602.624] -- 0:00:40
350000 -- (-602.678) (-604.170) (-608.973) [-603.100] * (-606.005) (-604.112) [-602.982] (-602.586) -- 0:00:40
Average standard deviation of split frequencies: 0.015236
350500 -- (-602.309) [-603.626] (-602.623) (-603.635) * (-608.184) [-607.337] (-604.998) (-603.850) -- 0:00:40
351000 -- [-602.497] (-603.867) (-602.829) (-605.261) * (-603.890) [-602.641] (-603.032) (-603.160) -- 0:00:40
351500 -- (-602.806) [-606.201] (-606.423) (-606.602) * [-602.760] (-603.952) (-602.992) (-605.832) -- 0:00:40
352000 -- (-602.844) (-606.462) (-604.222) [-605.843] * (-603.338) [-603.423] (-604.064) (-605.979) -- 0:00:40
352500 -- (-605.236) (-607.606) [-605.313] (-605.192) * [-603.684] (-602.072) (-604.918) (-603.418) -- 0:00:40
353000 -- (-602.589) (-607.023) (-602.281) [-602.602] * (-603.077) (-602.908) (-604.395) [-601.983] -- 0:00:40
353500 -- (-605.755) [-607.713] (-605.216) (-603.560) * (-608.392) (-603.777) [-603.766] (-602.662) -- 0:00:40
354000 -- (-606.052) [-605.561] (-602.238) (-603.622) * (-602.774) (-602.966) [-608.922] (-603.542) -- 0:00:40
354500 -- (-602.896) (-605.459) (-602.834) [-603.859] * (-604.892) (-604.239) (-607.421) [-605.745] -- 0:00:40
355000 -- (-603.394) [-602.898] (-603.779) (-602.703) * (-602.386) (-607.390) (-605.394) [-604.697] -- 0:00:39
Average standard deviation of split frequencies: 0.015669
355500 -- (-603.181) (-602.720) (-610.736) [-603.211] * (-602.039) (-603.281) [-607.990] (-605.029) -- 0:00:39
356000 -- (-605.272) (-603.624) [-605.243] (-606.630) * (-605.736) (-603.364) (-605.340) [-607.337] -- 0:00:39
356500 -- (-604.696) [-606.538] (-607.391) (-602.864) * (-607.071) [-604.649] (-605.089) (-606.155) -- 0:00:39
357000 -- [-605.609] (-605.482) (-606.509) (-605.641) * (-607.470) (-606.001) [-603.085] (-604.327) -- 0:00:39
357500 -- (-607.090) (-604.897) [-605.734] (-602.416) * (-602.323) [-603.145] (-609.279) (-603.824) -- 0:00:39
358000 -- (-607.993) [-605.804] (-604.065) (-604.034) * (-604.984) [-603.253] (-602.693) (-604.599) -- 0:00:39
358500 -- [-606.696] (-606.121) (-606.894) (-606.195) * [-602.107] (-602.680) (-604.952) (-606.943) -- 0:00:39
359000 -- (-603.362) (-604.455) [-602.758] (-605.912) * (-605.001) (-605.221) (-602.678) [-602.129] -- 0:00:39
359500 -- [-603.098] (-604.561) (-603.557) (-603.794) * (-605.256) [-606.574] (-606.579) (-605.854) -- 0:00:39
360000 -- (-603.564) (-605.414) [-602.981] (-603.187) * (-604.839) (-602.488) [-607.566] (-603.168) -- 0:00:39
Average standard deviation of split frequencies: 0.015757
360500 -- (-602.464) [-604.214] (-603.949) (-604.361) * (-607.964) (-606.978) [-605.975] (-603.127) -- 0:00:39
361000 -- (-602.668) [-604.138] (-609.490) (-607.007) * (-605.921) [-607.190] (-603.095) (-605.242) -- 0:00:38
361500 -- (-604.101) (-602.928) [-603.945] (-604.279) * (-603.791) [-604.563] (-605.011) (-605.477) -- 0:00:38
362000 -- [-602.937] (-604.579) (-605.030) (-605.619) * (-602.289) [-608.921] (-602.245) (-601.949) -- 0:00:40
362500 -- (-603.368) (-606.566) [-605.536] (-607.744) * (-605.125) [-603.108] (-605.000) (-602.594) -- 0:00:40
363000 -- (-604.847) (-602.481) [-604.377] (-603.756) * (-606.779) (-603.260) [-603.935] (-603.131) -- 0:00:40
363500 -- [-603.508] (-612.135) (-603.657) (-601.947) * (-606.976) (-603.696) [-606.080] (-604.339) -- 0:00:40
364000 -- (-602.447) (-603.412) [-610.052] (-603.490) * (-603.681) [-602.237] (-603.848) (-604.214) -- 0:00:40
364500 -- [-601.873] (-603.538) (-604.557) (-605.308) * (-604.228) (-603.496) [-604.843] (-603.274) -- 0:00:40
365000 -- (-601.856) [-602.479] (-603.032) (-602.934) * (-604.701) (-602.815) [-605.554] (-605.951) -- 0:00:40
Average standard deviation of split frequencies: 0.015599
365500 -- (-603.229) (-602.002) [-604.085] (-604.746) * (-606.410) [-607.448] (-604.700) (-607.188) -- 0:00:39
366000 -- [-602.719] (-608.959) (-604.474) (-604.390) * (-607.374) (-604.995) (-604.584) [-604.945] -- 0:00:39
366500 -- (-606.880) (-605.184) [-604.670] (-602.560) * [-604.056] (-602.486) (-607.487) (-606.090) -- 0:00:39
367000 -- (-605.928) [-603.222] (-605.195) (-603.134) * (-606.129) [-602.104] (-607.378) (-602.786) -- 0:00:39
367500 -- [-603.174] (-602.696) (-604.233) (-603.438) * [-602.886] (-604.332) (-608.413) (-604.086) -- 0:00:39
368000 -- (-603.358) (-605.063) (-602.657) [-603.266] * (-602.231) [-604.242] (-604.107) (-604.055) -- 0:00:39
368500 -- [-603.523] (-603.344) (-603.937) (-605.104) * (-602.162) (-604.326) (-605.682) [-602.370] -- 0:00:39
369000 -- (-605.769) (-603.084) (-604.687) [-605.917] * (-602.185) (-607.186) [-606.219] (-606.575) -- 0:00:39
369500 -- [-605.358] (-605.317) (-606.683) (-606.967) * [-602.355] (-604.027) (-605.870) (-605.638) -- 0:00:39
370000 -- (-604.353) (-604.129) (-605.847) [-605.096] * (-602.867) (-606.009) [-605.866] (-604.265) -- 0:00:39
Average standard deviation of split frequencies: 0.015544
370500 -- (-603.480) (-603.958) (-605.121) [-606.254] * (-602.473) (-609.925) [-604.609] (-608.957) -- 0:00:39
371000 -- (-605.172) [-605.285] (-603.370) (-605.472) * (-602.444) (-603.394) (-604.413) [-606.589] -- 0:00:38
371500 -- (-604.313) (-606.475) (-604.463) [-604.053] * [-602.913] (-604.139) (-605.503) (-606.417) -- 0:00:38
372000 -- (-604.331) (-603.236) [-604.325] (-605.758) * (-602.542) (-605.291) (-604.368) [-606.571] -- 0:00:38
372500 -- (-602.219) (-603.967) (-606.253) [-602.893] * (-604.722) (-605.903) [-602.999] (-605.046) -- 0:00:38
373000 -- (-605.784) (-605.347) [-603.354] (-602.947) * (-605.624) (-609.060) [-603.463] (-602.422) -- 0:00:38
373500 -- (-603.563) [-604.178] (-604.694) (-604.481) * (-606.290) (-603.317) [-603.544] (-604.380) -- 0:00:38
374000 -- (-602.855) (-603.435) [-603.239] (-604.438) * (-603.538) (-608.758) (-606.930) [-602.309] -- 0:00:38
374500 -- (-603.015) (-603.177) (-602.655) [-604.417] * (-603.498) [-605.279] (-608.057) (-605.724) -- 0:00:38
375000 -- (-605.284) (-602.699) (-606.091) [-606.155] * (-606.743) (-603.574) (-604.725) [-604.356] -- 0:00:38
Average standard deviation of split frequencies: 0.016716
375500 -- [-602.860] (-603.443) (-605.033) (-603.130) * (-603.479) (-607.740) (-605.506) [-605.299] -- 0:00:38
376000 -- (-605.942) [-605.861] (-606.220) (-604.580) * (-606.687) (-607.977) [-603.946] (-602.323) -- 0:00:38
376500 -- (-604.970) (-603.292) (-603.458) [-606.155] * (-605.226) (-606.943) [-603.957] (-601.857) -- 0:00:38
377000 -- (-604.858) (-602.798) (-602.266) [-604.393] * (-603.310) [-603.956] (-604.193) (-606.745) -- 0:00:38
377500 -- (-603.407) (-602.921) (-603.845) [-602.597] * (-608.239) [-604.268] (-605.721) (-602.921) -- 0:00:37
378000 -- (-604.708) (-603.939) [-603.537] (-602.708) * (-607.767) [-605.104] (-603.514) (-602.713) -- 0:00:37
378500 -- (-604.132) [-602.195] (-603.387) (-605.599) * [-602.330] (-606.513) (-602.441) (-603.814) -- 0:00:39
379000 -- [-605.940] (-608.537) (-603.168) (-602.763) * (-603.356) (-606.165) [-603.813] (-605.764) -- 0:00:39
379500 -- (-606.988) (-604.084) (-605.174) [-602.375] * (-603.212) [-606.682] (-604.802) (-602.433) -- 0:00:39
380000 -- (-603.145) (-603.326) [-604.922] (-607.288) * [-606.943] (-602.656) (-607.275) (-604.116) -- 0:00:39
Average standard deviation of split frequencies: 0.016305
380500 -- [-603.489] (-602.810) (-602.352) (-606.981) * [-606.318] (-604.433) (-605.113) (-602.815) -- 0:00:39
381000 -- (-605.080) (-602.833) (-603.860) [-603.498] * (-604.163) [-607.650] (-602.619) (-602.253) -- 0:00:38
381500 -- [-602.977] (-604.455) (-603.165) (-604.598) * [-603.507] (-607.702) (-603.172) (-605.736) -- 0:00:38
382000 -- (-604.246) (-605.579) [-602.990] (-603.463) * (-605.269) (-604.315) (-604.254) [-604.698] -- 0:00:38
382500 -- [-602.564] (-603.375) (-605.007) (-603.970) * (-603.845) [-602.560] (-605.503) (-603.272) -- 0:00:38
383000 -- (-602.590) (-604.478) [-603.365] (-603.020) * (-602.958) [-603.007] (-604.827) (-606.348) -- 0:00:38
383500 -- [-605.457] (-603.097) (-603.685) (-606.064) * (-604.880) (-605.296) [-605.754] (-603.653) -- 0:00:38
384000 -- (-602.976) (-602.468) [-604.595] (-603.267) * (-604.415) (-604.361) [-602.762] (-605.589) -- 0:00:38
384500 -- (-608.295) [-604.982] (-605.479) (-603.065) * [-603.170] (-606.522) (-602.764) (-604.571) -- 0:00:38
385000 -- (-603.631) (-607.293) (-605.512) [-603.314] * (-604.731) (-609.635) (-604.341) [-603.608] -- 0:00:38
Average standard deviation of split frequencies: 0.015673
385500 -- [-604.951] (-604.227) (-602.497) (-603.583) * (-603.572) (-609.344) [-605.657] (-603.081) -- 0:00:38
386000 -- (-606.075) (-602.074) [-602.234] (-603.606) * (-604.559) [-602.655] (-603.603) (-602.932) -- 0:00:38
386500 -- [-606.087] (-602.313) (-602.985) (-603.105) * [-607.096] (-603.485) (-604.885) (-602.026) -- 0:00:38
387000 -- (-606.646) (-603.783) [-602.543] (-602.981) * (-604.420) (-605.619) [-603.835] (-604.657) -- 0:00:38
387500 -- (-604.378) (-604.269) [-603.494] (-605.304) * (-605.928) (-608.609) [-602.957] (-602.842) -- 0:00:37
388000 -- (-606.718) (-603.521) [-607.030] (-603.112) * [-605.356] (-606.489) (-603.527) (-603.771) -- 0:00:37
388500 -- (-602.478) (-604.613) (-604.971) [-605.315] * (-603.352) (-605.426) [-604.064] (-602.949) -- 0:00:37
389000 -- (-602.476) (-604.520) (-605.094) [-603.099] * (-604.900) (-604.711) [-605.135] (-602.743) -- 0:00:37
389500 -- [-603.056] (-605.946) (-605.812) (-605.680) * (-603.730) (-606.144) (-602.563) [-603.362] -- 0:00:37
390000 -- (-605.309) [-604.560] (-605.775) (-603.449) * [-603.683] (-605.512) (-602.371) (-605.981) -- 0:00:37
Average standard deviation of split frequencies: 0.015486
390500 -- (-605.005) (-605.803) [-602.840] (-601.799) * [-604.176] (-606.870) (-603.834) (-603.712) -- 0:00:37
391000 -- (-605.396) [-605.066] (-607.043) (-606.711) * (-606.928) (-602.845) [-604.056] (-606.957) -- 0:00:37
391500 -- (-602.316) (-607.204) [-603.790] (-604.330) * (-606.256) [-603.492] (-603.869) (-604.292) -- 0:00:37
392000 -- (-602.750) (-606.456) [-602.669] (-603.057) * (-605.149) (-603.015) [-603.312] (-603.160) -- 0:00:37
392500 -- [-602.397] (-605.892) (-602.306) (-606.172) * (-604.494) (-603.612) (-604.005) [-603.983] -- 0:00:37
393000 -- [-603.687] (-602.077) (-602.757) (-603.421) * [-604.139] (-606.793) (-605.155) (-606.314) -- 0:00:37
393500 -- (-605.860) (-601.987) (-603.617) [-603.768] * (-604.074) (-606.454) [-602.440] (-607.349) -- 0:00:36
394000 -- (-604.221) (-602.782) (-605.788) [-603.692] * (-606.042) [-604.884] (-604.346) (-604.327) -- 0:00:36
394500 -- (-605.164) (-603.455) (-602.805) [-603.675] * (-605.760) [-603.344] (-604.663) (-604.206) -- 0:00:36
395000 -- (-605.347) (-603.721) [-603.456] (-609.325) * (-610.574) [-604.087] (-602.338) (-608.184) -- 0:00:36
Average standard deviation of split frequencies: 0.015409
395500 -- (-604.444) (-604.172) [-603.118] (-606.644) * (-605.689) (-603.311) [-603.081] (-602.425) -- 0:00:38
396000 -- (-606.814) [-604.710] (-602.796) (-602.699) * (-604.278) [-608.268] (-602.258) (-602.453) -- 0:00:38
396500 -- [-603.929] (-610.865) (-602.962) (-603.099) * [-603.973] (-607.292) (-606.065) (-603.710) -- 0:00:38
397000 -- (-603.708) (-603.723) (-602.944) [-602.668] * (-604.969) [-605.912] (-603.839) (-603.791) -- 0:00:37
397500 -- (-604.812) [-602.051] (-605.853) (-605.894) * (-602.432) (-605.184) [-603.884] (-603.597) -- 0:00:37
398000 -- (-605.452) (-602.464) (-604.441) [-604.501] * (-602.605) [-605.596] (-605.879) (-604.043) -- 0:00:37
398500 -- [-603.574] (-603.833) (-605.280) (-604.802) * (-603.049) (-606.218) (-604.924) [-603.149] -- 0:00:37
399000 -- [-604.444] (-604.450) (-605.693) (-602.522) * [-603.513] (-603.178) (-602.332) (-606.213) -- 0:00:37
399500 -- (-603.771) (-605.134) (-608.446) [-604.079] * (-605.338) (-603.676) [-602.494] (-607.711) -- 0:00:37
400000 -- [-606.037] (-605.089) (-603.144) (-606.924) * (-604.135) (-603.531) [-603.322] (-607.593) -- 0:00:37
Average standard deviation of split frequencies: 0.015099
400500 -- (-607.236) (-602.200) (-602.137) [-603.916] * (-603.299) (-606.899) [-605.680] (-603.053) -- 0:00:37
401000 -- (-603.902) (-602.020) (-602.818) [-602.124] * (-606.152) [-605.175] (-603.734) (-603.180) -- 0:00:37
401500 -- (-609.530) (-604.586) [-602.738] (-602.653) * (-602.781) (-604.207) (-603.817) [-602.945] -- 0:00:37
402000 -- (-603.869) (-604.838) (-608.462) [-604.887] * (-603.661) (-602.824) (-603.617) [-602.791] -- 0:00:37
402500 -- (-603.211) [-604.351] (-604.674) (-606.724) * [-602.361] (-602.446) (-603.441) (-607.460) -- 0:00:37
403000 -- (-604.664) [-603.820] (-606.772) (-603.656) * (-602.958) (-603.773) (-604.246) [-605.951] -- 0:00:37
403500 -- (-604.356) [-603.028] (-604.888) (-602.421) * [-602.990] (-603.654) (-604.190) (-607.630) -- 0:00:36
404000 -- (-604.274) [-603.330] (-605.580) (-604.572) * (-604.346) [-606.834] (-604.998) (-605.399) -- 0:00:36
404500 -- (-605.597) [-604.931] (-607.011) (-604.807) * [-604.548] (-603.047) (-604.080) (-602.807) -- 0:00:36
405000 -- (-601.904) [-608.951] (-603.614) (-605.359) * (-603.023) (-603.250) [-603.127] (-602.146) -- 0:00:36
Average standard deviation of split frequencies: 0.014256
405500 -- (-602.173) (-606.331) (-605.238) [-604.095] * (-602.980) (-603.743) (-603.277) [-604.136] -- 0:00:36
406000 -- (-603.546) [-604.158] (-603.784) (-608.738) * [-601.998] (-603.308) (-604.334) (-603.403) -- 0:00:36
406500 -- [-602.815] (-605.118) (-602.728) (-604.615) * (-602.280) [-605.560] (-607.141) (-607.087) -- 0:00:36
407000 -- (-603.709) [-602.644] (-603.332) (-604.079) * (-605.758) (-602.753) [-610.065] (-605.525) -- 0:00:36
407500 -- (-604.557) (-603.001) [-604.494] (-604.513) * (-604.121) [-602.519] (-604.021) (-602.498) -- 0:00:36
408000 -- (-603.987) [-606.748] (-604.177) (-605.963) * (-602.538) (-604.157) (-607.505) [-604.772] -- 0:00:36
408500 -- [-605.125] (-602.260) (-602.977) (-603.682) * (-606.626) (-606.445) [-603.268] (-603.134) -- 0:00:36
409000 -- (-603.995) (-602.667) (-603.846) [-606.337] * (-603.262) (-603.461) (-603.304) [-606.246] -- 0:00:36
409500 -- [-604.984] (-605.766) (-606.507) (-602.578) * [-602.877] (-606.802) (-603.522) (-604.970) -- 0:00:36
410000 -- (-607.964) (-606.173) (-604.598) [-603.377] * (-606.830) (-606.655) (-607.554) [-604.505] -- 0:00:35
Average standard deviation of split frequencies: 0.012627
410500 -- (-607.285) (-605.504) [-610.909] (-603.232) * (-604.211) (-604.952) [-607.592] (-605.618) -- 0:00:35
411000 -- (-604.181) (-603.527) [-602.145] (-606.483) * [-602.560] (-607.734) (-605.765) (-605.434) -- 0:00:35
411500 -- (-606.546) (-605.340) (-603.271) [-602.697] * (-603.712) (-603.778) [-605.252] (-604.730) -- 0:00:35
412000 -- (-609.115) [-603.894] (-603.534) (-603.361) * (-602.356) (-604.359) (-602.100) [-602.424] -- 0:00:37
412500 -- (-604.175) [-606.416] (-606.880) (-608.044) * [-602.003] (-603.558) (-602.376) (-604.026) -- 0:00:37
413000 -- (-605.926) [-604.872] (-603.154) (-606.326) * (-604.714) (-607.114) (-605.574) [-603.826] -- 0:00:36
413500 -- (-604.443) (-606.586) [-604.365] (-611.946) * (-606.698) (-602.718) (-602.280) [-603.265] -- 0:00:36
414000 -- (-602.921) (-602.585) (-607.671) [-605.591] * [-602.926] (-605.044) (-602.428) (-602.893) -- 0:00:36
414500 -- (-603.741) (-603.569) (-603.757) [-603.398] * (-605.502) (-609.337) (-602.339) [-603.851] -- 0:00:36
415000 -- (-606.595) [-605.496] (-605.860) (-603.375) * (-607.036) [-604.291] (-604.889) (-603.279) -- 0:00:36
Average standard deviation of split frequencies: 0.011773
415500 -- (-608.821) [-603.944] (-605.406) (-603.257) * (-604.066) [-604.854] (-602.639) (-608.160) -- 0:00:36
416000 -- (-603.883) (-605.025) [-603.259] (-603.546) * [-605.109] (-603.480) (-603.247) (-603.801) -- 0:00:36
416500 -- (-601.922) [-603.486] (-602.422) (-606.318) * (-602.047) [-603.333] (-606.327) (-603.289) -- 0:00:36
417000 -- [-604.245] (-604.892) (-606.539) (-603.438) * (-604.031) [-604.126] (-602.769) (-604.454) -- 0:00:36
417500 -- (-603.667) [-604.381] (-608.600) (-604.176) * [-604.264] (-607.748) (-603.813) (-604.438) -- 0:00:36
418000 -- [-608.326] (-602.308) (-604.572) (-605.681) * (-603.144) (-605.572) (-605.299) [-603.626] -- 0:00:36
418500 -- (-602.687) [-603.165] (-606.329) (-603.443) * (-607.131) (-605.037) (-606.209) [-603.553] -- 0:00:36
419000 -- (-603.939) [-603.566] (-605.751) (-604.419) * (-603.602) (-603.433) (-602.705) [-606.740] -- 0:00:36
419500 -- (-605.634) (-606.537) [-605.278] (-604.650) * (-603.515) (-604.124) (-603.405) [-605.499] -- 0:00:35
420000 -- (-607.785) (-602.726) (-603.300) [-606.498] * (-604.719) (-603.470) [-606.557] (-605.075) -- 0:00:35
Average standard deviation of split frequencies: 0.010481
420500 -- (-605.242) (-602.824) (-604.074) [-602.942] * [-603.893] (-605.666) (-605.849) (-604.085) -- 0:00:35
421000 -- (-607.682) (-606.478) (-604.819) [-603.504] * [-602.383] (-603.235) (-604.774) (-603.194) -- 0:00:35
421500 -- (-603.601) (-605.011) (-603.471) [-605.739] * [-603.299] (-603.897) (-602.827) (-605.109) -- 0:00:35
422000 -- (-605.942) (-602.641) [-603.933] (-603.387) * (-602.533) (-602.764) (-604.264) [-607.570] -- 0:00:35
422500 -- (-605.055) (-602.934) [-602.971] (-602.857) * [-602.492] (-603.731) (-602.772) (-603.087) -- 0:00:35
423000 -- (-606.406) [-604.044] (-602.695) (-609.372) * (-602.852) (-603.310) [-606.512] (-605.086) -- 0:00:35
423500 -- (-606.495) [-602.682] (-606.609) (-603.486) * [-602.488] (-607.109) (-602.588) (-604.553) -- 0:00:35
424000 -- (-607.226) [-602.466] (-606.019) (-602.437) * (-602.280) (-604.548) [-603.414] (-604.928) -- 0:00:35
424500 -- (-603.194) [-603.042] (-604.055) (-603.530) * (-606.946) [-605.877] (-609.382) (-603.692) -- 0:00:35
425000 -- (-603.154) [-603.230] (-604.503) (-607.931) * (-603.671) (-606.546) [-603.104] (-608.985) -- 0:00:35
Average standard deviation of split frequencies: 0.010480
425500 -- (-603.589) [-604.890] (-607.940) (-610.973) * (-602.226) [-606.040] (-602.960) (-604.660) -- 0:00:35
426000 -- [-605.573] (-607.789) (-606.233) (-609.854) * (-603.020) (-603.824) [-604.209] (-610.649) -- 0:00:35
426500 -- (-604.577) (-604.924) (-602.597) [-609.525] * (-604.520) (-604.747) [-602.924] (-603.387) -- 0:00:34
427000 -- (-604.112) [-603.737] (-606.126) (-605.620) * (-602.575) (-606.157) (-603.966) [-603.657] -- 0:00:34
427500 -- (-605.777) (-605.510) [-603.372] (-605.555) * (-603.422) (-611.324) (-605.964) [-603.631] -- 0:00:34
428000 -- [-602.118] (-605.778) (-604.544) (-603.846) * (-605.397) (-604.272) (-605.037) [-603.447] -- 0:00:34
428500 -- (-609.570) [-603.976] (-609.541) (-603.453) * (-605.988) (-605.577) (-606.143) [-602.576] -- 0:00:34
429000 -- (-602.962) [-603.121] (-609.862) (-604.790) * (-605.659) (-603.407) [-605.058] (-602.961) -- 0:00:35
429500 -- (-603.227) (-603.635) (-604.841) [-603.346] * [-603.506] (-605.651) (-603.987) (-602.819) -- 0:00:35
430000 -- (-603.888) (-602.300) [-608.532] (-606.818) * (-604.713) [-604.765] (-605.627) (-603.927) -- 0:00:35
Average standard deviation of split frequencies: 0.011139
430500 -- [-605.670] (-603.466) (-608.773) (-602.902) * [-607.478] (-603.359) (-603.718) (-605.303) -- 0:00:35
431000 -- (-605.818) (-602.083) [-602.394] (-605.663) * [-604.233] (-603.052) (-610.614) (-605.581) -- 0:00:35
431500 -- [-606.145] (-602.891) (-609.349) (-604.354) * (-603.460) (-602.855) [-606.404] (-606.636) -- 0:00:35
432000 -- (-604.804) (-605.743) (-606.826) [-606.808] * (-604.239) (-603.528) (-604.716) [-603.233] -- 0:00:35
432500 -- (-604.878) [-602.988] (-606.101) (-603.284) * [-603.510] (-602.270) (-608.863) (-602.346) -- 0:00:35
433000 -- [-604.571] (-604.221) (-608.813) (-603.583) * [-602.888] (-605.296) (-604.182) (-602.687) -- 0:00:35
433500 -- (-602.810) (-602.484) [-603.505] (-603.066) * [-602.579] (-602.968) (-605.149) (-602.594) -- 0:00:35
434000 -- (-606.191) (-602.026) (-602.757) [-603.081] * [-604.845] (-604.158) (-604.418) (-603.375) -- 0:00:35
434500 -- [-603.655] (-604.403) (-604.533) (-603.402) * (-603.474) (-605.806) (-603.822) [-605.014] -- 0:00:35
435000 -- (-606.126) (-606.380) (-602.201) [-603.008] * [-602.212] (-603.302) (-603.714) (-602.398) -- 0:00:35
Average standard deviation of split frequencies: 0.011512
435500 -- (-603.997) (-605.253) [-607.500] (-603.242) * [-605.239] (-603.151) (-602.580) (-602.764) -- 0:00:34
436000 -- (-602.172) [-603.297] (-602.448) (-606.672) * (-602.207) (-602.347) [-602.609] (-602.267) -- 0:00:34
436500 -- (-604.299) (-605.051) [-602.558] (-603.371) * (-602.188) (-602.959) [-604.515] (-602.670) -- 0:00:34
437000 -- [-606.310] (-606.286) (-606.483) (-603.312) * (-603.912) [-603.127] (-602.303) (-606.267) -- 0:00:34
437500 -- (-605.840) (-603.277) (-602.710) [-604.691] * [-603.750] (-602.899) (-603.098) (-604.436) -- 0:00:34
438000 -- (-602.417) (-605.249) [-601.844] (-606.859) * (-604.617) (-605.095) (-602.875) [-604.379] -- 0:00:34
438500 -- (-603.392) (-603.900) [-602.473] (-603.620) * (-602.077) [-603.625] (-605.489) (-603.735) -- 0:00:34
439000 -- [-603.377] (-604.499) (-603.746) (-604.429) * [-604.100] (-603.778) (-602.126) (-603.293) -- 0:00:34
439500 -- (-603.626) (-603.451) (-603.470) [-603.903] * (-602.363) (-603.466) (-607.217) [-604.618] -- 0:00:34
440000 -- (-606.496) (-602.246) [-608.288] (-603.457) * [-603.549] (-605.635) (-611.467) (-604.354) -- 0:00:34
Average standard deviation of split frequencies: 0.010949
440500 -- (-604.423) [-603.668] (-605.335) (-603.888) * (-604.932) [-607.982] (-603.007) (-606.808) -- 0:00:34
441000 -- [-604.271] (-602.543) (-604.264) (-605.336) * [-603.559] (-602.561) (-607.913) (-604.461) -- 0:00:34
441500 -- (-606.496) (-602.424) (-603.236) [-607.401] * (-606.939) (-612.839) [-604.370] (-603.737) -- 0:00:34
442000 -- (-604.323) (-605.187) (-602.796) [-603.735] * (-604.050) [-605.393] (-604.522) (-604.795) -- 0:00:34
442500 -- (-603.932) (-610.631) (-603.586) [-604.166] * (-604.724) [-604.305] (-604.898) (-604.002) -- 0:00:34
443000 -- (-605.108) [-604.139] (-604.809) (-603.519) * (-608.587) (-603.088) [-603.402] (-602.957) -- 0:00:33
443500 -- [-602.028] (-605.666) (-603.037) (-608.145) * [-603.645] (-605.164) (-607.805) (-606.732) -- 0:00:33
444000 -- [-603.150] (-603.411) (-608.020) (-605.620) * (-608.764) (-605.291) (-603.186) [-605.859] -- 0:00:33
444500 -- [-602.794] (-603.910) (-606.493) (-604.750) * [-602.248] (-603.493) (-602.811) (-604.499) -- 0:00:33
445000 -- [-603.238] (-605.154) (-605.250) (-608.916) * (-603.857) (-603.042) (-603.292) [-605.250] -- 0:00:33
Average standard deviation of split frequencies: 0.010570
445500 -- (-604.226) (-604.263) (-605.853) [-607.156] * (-606.512) (-603.206) (-603.517) [-603.280] -- 0:00:34
446000 -- [-604.246] (-607.418) (-609.240) (-603.804) * (-606.237) (-604.577) (-602.253) [-603.118] -- 0:00:34
446500 -- [-603.888] (-608.034) (-604.813) (-604.788) * (-601.989) (-602.666) [-602.249] (-606.760) -- 0:00:34
447000 -- [-603.417] (-607.329) (-605.970) (-602.452) * (-603.707) (-602.642) [-603.249] (-604.666) -- 0:00:34
447500 -- (-602.880) (-607.156) [-604.208] (-603.562) * [-606.701] (-605.897) (-603.918) (-602.335) -- 0:00:34
448000 -- (-608.269) [-605.651] (-606.067) (-607.675) * (-606.267) (-607.911) [-606.794] (-604.056) -- 0:00:34
448500 -- (-607.981) (-606.055) (-603.626) [-603.604] * (-606.810) [-605.084] (-605.162) (-606.098) -- 0:00:34
449000 -- [-609.926] (-609.974) (-605.094) (-602.152) * (-605.760) (-606.038) [-602.453] (-603.451) -- 0:00:34
449500 -- (-608.814) [-602.323] (-602.362) (-602.087) * (-609.378) [-606.946] (-602.824) (-604.086) -- 0:00:34
450000 -- (-603.545) [-604.337] (-603.384) (-602.898) * (-603.777) (-604.390) [-603.322] (-604.158) -- 0:00:34
Average standard deviation of split frequencies: 0.010153
450500 -- (-602.785) (-604.248) [-604.778] (-609.519) * (-604.833) (-607.318) (-603.759) [-605.466] -- 0:00:34
451000 -- (-602.308) (-604.614) (-604.489) [-606.526] * [-602.073] (-604.165) (-607.734) (-604.550) -- 0:00:34
451500 -- (-604.952) (-605.843) (-603.484) [-604.394] * [-602.718] (-605.190) (-604.889) (-602.878) -- 0:00:34
452000 -- (-604.764) [-604.185] (-603.178) (-605.299) * [-602.967] (-602.413) (-602.607) (-602.925) -- 0:00:33
452500 -- (-606.971) (-603.585) (-603.571) [-603.063] * [-602.606] (-606.155) (-603.497) (-604.033) -- 0:00:33
453000 -- (-606.354) (-603.132) (-604.842) [-602.645] * (-604.339) (-603.496) (-602.628) [-603.156] -- 0:00:33
453500 -- [-602.855] (-603.364) (-607.424) (-603.810) * (-604.292) (-608.078) (-603.844) [-603.139] -- 0:00:33
454000 -- (-606.369) (-605.275) [-603.234] (-606.630) * [-602.379] (-606.417) (-604.706) (-605.780) -- 0:00:33
454500 -- (-602.426) (-602.197) (-603.323) [-607.119] * (-610.437) (-605.154) [-603.694] (-604.446) -- 0:00:33
455000 -- (-602.493) (-602.723) [-606.278] (-604.109) * (-608.063) [-605.310] (-602.911) (-606.522) -- 0:00:33
Average standard deviation of split frequencies: 0.009973
455500 -- [-603.992] (-606.401) (-609.683) (-602.716) * [-602.170] (-602.670) (-603.684) (-605.741) -- 0:00:33
456000 -- (-610.641) [-602.722] (-609.812) (-606.875) * (-602.810) (-604.559) [-605.397] (-605.084) -- 0:00:33
456500 -- (-603.097) (-604.932) (-603.322) [-607.225] * (-602.261) (-615.262) [-606.586] (-607.016) -- 0:00:33
457000 -- [-603.580] (-605.270) (-604.031) (-605.399) * (-604.201) [-606.792] (-602.812) (-606.911) -- 0:00:33
457500 -- (-608.796) (-606.420) [-602.961] (-604.732) * (-608.714) (-612.378) (-603.610) [-602.741] -- 0:00:33
458000 -- [-602.867] (-604.195) (-605.828) (-603.959) * [-605.923] (-605.432) (-603.096) (-606.198) -- 0:00:33
458500 -- [-603.656] (-603.707) (-604.405) (-604.933) * (-607.140) [-605.167] (-602.486) (-604.378) -- 0:00:33
459000 -- [-603.424] (-605.213) (-603.812) (-605.683) * (-603.257) (-602.925) (-608.169) [-603.323] -- 0:00:33
459500 -- [-604.527] (-605.403) (-602.857) (-603.381) * [-603.047] (-605.893) (-604.484) (-603.781) -- 0:00:32
460000 -- (-607.164) (-603.987) (-602.801) [-604.380] * (-603.896) (-602.991) (-603.308) [-603.806] -- 0:00:32
Average standard deviation of split frequencies: 0.010105
460500 -- (-609.813) (-606.021) (-603.666) [-605.185] * (-609.473) (-602.776) (-603.416) [-604.556] -- 0:00:32
461000 -- (-604.831) (-604.163) [-604.217] (-604.145) * (-606.943) (-603.103) (-603.517) [-604.662] -- 0:00:32
461500 -- (-604.959) [-603.084] (-603.766) (-602.792) * (-605.672) [-603.375] (-606.853) (-603.904) -- 0:00:32
462000 -- (-604.161) (-605.259) (-603.808) [-604.547] * (-604.414) [-603.747] (-604.619) (-605.819) -- 0:00:33
462500 -- (-603.728) [-605.290] (-603.402) (-605.795) * (-608.072) (-605.578) [-604.076] (-606.535) -- 0:00:33
463000 -- (-605.037) (-604.205) (-602.460) [-603.665] * (-608.535) (-605.616) [-606.371] (-604.280) -- 0:00:33
463500 -- (-604.700) (-603.572) (-602.104) [-602.761] * (-602.891) [-603.027] (-604.726) (-602.274) -- 0:00:33
464000 -- [-603.768] (-602.984) (-603.344) (-605.899) * (-604.786) (-603.916) [-602.723] (-606.655) -- 0:00:33
464500 -- (-605.818) (-603.461) (-605.595) [-602.051] * [-603.157] (-602.464) (-604.035) (-603.925) -- 0:00:33
465000 -- (-603.509) (-609.391) [-604.037] (-602.199) * (-603.551) [-603.341] (-608.057) (-604.096) -- 0:00:33
Average standard deviation of split frequencies: 0.010473
465500 -- (-608.908) (-602.842) (-604.112) [-602.518] * [-605.987] (-602.852) (-603.451) (-604.791) -- 0:00:33
466000 -- [-603.899] (-604.153) (-604.487) (-603.506) * (-604.508) (-603.226) (-607.153) [-604.124] -- 0:00:33
466500 -- (-606.512) (-603.954) [-602.953] (-605.163) * (-605.449) [-602.553] (-602.452) (-603.069) -- 0:00:33
467000 -- (-606.228) [-603.214] (-606.784) (-603.626) * (-605.451) [-604.768] (-603.916) (-605.387) -- 0:00:33
467500 -- (-605.753) (-602.362) [-604.915] (-603.876) * (-602.400) (-605.037) (-602.650) [-603.126] -- 0:00:33
468000 -- [-602.628] (-607.636) (-603.628) (-602.776) * (-604.487) (-602.406) [-605.985] (-607.003) -- 0:00:32
468500 -- (-602.434) [-603.344] (-605.729) (-605.830) * (-609.175) [-604.822] (-604.232) (-608.189) -- 0:00:32
469000 -- [-603.052] (-604.655) (-604.383) (-602.537) * (-607.464) [-605.290] (-605.650) (-602.896) -- 0:00:32
469500 -- (-604.867) (-603.852) (-608.153) [-603.941] * (-605.555) [-605.678] (-606.271) (-604.415) -- 0:00:32
470000 -- [-603.207] (-607.725) (-603.500) (-603.081) * (-610.926) [-603.988] (-602.927) (-603.060) -- 0:00:32
Average standard deviation of split frequencies: 0.010782
470500 -- (-603.637) [-602.048] (-606.276) (-603.773) * (-603.620) (-603.599) [-605.455] (-603.979) -- 0:00:32
471000 -- (-603.628) [-601.951] (-602.057) (-605.309) * (-606.776) (-604.687) [-602.940] (-602.553) -- 0:00:32
471500 -- (-604.790) (-603.623) [-604.430] (-603.587) * (-606.937) [-604.121] (-602.632) (-604.571) -- 0:00:32
472000 -- (-602.931) (-603.082) [-602.254] (-604.279) * [-605.327] (-602.631) (-605.102) (-602.979) -- 0:00:32
472500 -- (-603.387) (-605.478) (-601.918) [-603.700] * (-606.563) (-604.305) (-602.131) [-604.555] -- 0:00:32
473000 -- (-602.644) (-602.666) (-603.253) [-604.720] * (-605.907) (-607.546) (-607.386) [-604.820] -- 0:00:32
473500 -- [-603.703] (-601.721) (-604.026) (-604.188) * [-607.358] (-604.047) (-607.943) (-606.321) -- 0:00:32
474000 -- [-603.387] (-603.288) (-603.541) (-608.799) * (-602.595) (-602.571) (-604.665) [-603.694] -- 0:00:32
474500 -- (-611.141) (-603.018) [-604.276] (-604.262) * [-603.968] (-602.801) (-604.641) (-609.744) -- 0:00:32
475000 -- (-607.375) (-603.746) (-605.119) [-604.698] * (-605.871) (-605.225) (-604.752) [-603.986] -- 0:00:32
Average standard deviation of split frequencies: 0.011010
475500 -- (-608.025) (-603.895) [-603.166] (-604.348) * (-606.052) (-604.442) (-604.898) [-609.819] -- 0:00:31
476000 -- (-606.801) (-604.592) [-605.767] (-602.165) * (-602.233) (-603.544) [-603.744] (-602.097) -- 0:00:31
476500 -- (-603.293) (-603.494) [-603.646] (-603.820) * [-602.391] (-603.322) (-602.328) (-603.025) -- 0:00:31
477000 -- [-606.583] (-606.550) (-603.609) (-604.129) * (-603.899) (-604.871) (-603.852) [-607.027] -- 0:00:31
477500 -- (-604.060) [-607.638] (-602.830) (-603.436) * (-606.872) [-602.298] (-605.661) (-604.476) -- 0:00:31
478000 -- (-604.506) (-603.449) (-603.296) [-602.228] * (-604.404) (-604.982) [-603.865] (-603.144) -- 0:00:31
478500 -- (-602.698) (-606.101) (-604.747) [-604.110] * (-605.785) (-604.443) [-603.144] (-608.095) -- 0:00:31
479000 -- (-602.475) [-605.032] (-604.922) (-604.632) * (-603.090) (-604.070) [-603.644] (-605.355) -- 0:00:32
479500 -- (-603.730) (-603.742) [-605.294] (-604.849) * [-604.603] (-604.707) (-603.370) (-602.696) -- 0:00:32
480000 -- (-603.330) (-607.219) (-604.150) [-602.214] * (-611.230) (-603.415) (-603.075) [-608.262] -- 0:00:32
Average standard deviation of split frequencies: 0.010327
480500 -- (-605.285) (-606.534) (-604.745) [-602.604] * (-606.044) (-602.532) [-604.040] (-603.973) -- 0:00:32
481000 -- (-602.962) (-602.853) (-607.455) [-606.437] * [-608.617] (-613.958) (-602.673) (-602.462) -- 0:00:32
481500 -- [-606.960] (-602.995) (-607.643) (-604.502) * (-606.169) [-604.862] (-602.495) (-606.447) -- 0:00:32
482000 -- [-601.887] (-602.643) (-607.020) (-606.709) * (-603.159) (-604.520) (-605.369) [-606.394] -- 0:00:32
482500 -- (-605.769) (-605.310) [-604.795] (-607.134) * (-602.176) (-603.894) [-604.601] (-603.429) -- 0:00:32
483000 -- (-603.365) [-605.157] (-603.567) (-604.633) * [-603.837] (-602.239) (-605.112) (-605.338) -- 0:00:32
483500 -- (-604.629) [-604.254] (-605.907) (-602.931) * (-604.571) (-605.607) (-605.666) [-605.082] -- 0:00:32
484000 -- (-604.498) (-604.561) [-604.605] (-604.207) * (-603.330) (-611.625) [-605.843] (-603.205) -- 0:00:31
484500 -- (-603.600) (-605.304) [-605.358] (-604.469) * [-604.671] (-605.579) (-605.177) (-603.475) -- 0:00:31
485000 -- (-603.462) (-605.151) (-604.798) [-604.140] * (-603.957) (-603.682) (-602.140) [-607.206] -- 0:00:31
Average standard deviation of split frequencies: 0.010441
485500 -- (-603.316) (-603.485) (-604.166) [-604.856] * (-603.440) (-607.119) [-602.652] (-604.251) -- 0:00:31
486000 -- [-604.259] (-605.516) (-604.146) (-606.027) * (-603.676) (-602.607) [-603.630] (-602.717) -- 0:00:31
486500 -- [-603.977] (-605.054) (-602.184) (-606.227) * (-603.550) (-604.628) [-606.014] (-603.736) -- 0:00:31
487000 -- [-604.550] (-602.671) (-607.360) (-605.483) * (-611.547) [-603.142] (-603.052) (-607.133) -- 0:00:31
487500 -- (-603.674) (-602.687) (-607.067) [-606.358] * (-604.110) [-604.413] (-604.025) (-603.686) -- 0:00:31
488000 -- (-603.720) (-604.719) (-605.176) [-604.833] * (-604.630) (-603.980) (-604.282) [-603.929] -- 0:00:31
488500 -- (-605.270) (-607.507) [-602.919] (-613.226) * [-602.808] (-605.519) (-604.856) (-605.732) -- 0:00:31
489000 -- (-604.866) (-603.704) (-604.069) [-606.524] * (-605.049) (-602.432) (-603.771) [-603.856] -- 0:00:31
489500 -- [-607.068] (-602.495) (-605.965) (-605.907) * [-603.309] (-602.547) (-602.703) (-603.459) -- 0:00:31
490000 -- (-603.523) (-602.104) [-603.507] (-605.309) * (-602.109) (-606.075) (-602.812) [-602.261] -- 0:00:31
Average standard deviation of split frequencies: 0.010173
490500 -- [-604.451] (-604.175) (-602.886) (-604.967) * (-604.194) (-605.419) (-602.212) [-602.712] -- 0:00:31
491000 -- [-608.425] (-608.434) (-603.312) (-611.922) * (-604.189) (-602.074) [-603.853] (-604.836) -- 0:00:31
491500 -- (-605.394) [-602.735] (-606.309) (-608.044) * (-603.774) (-606.182) (-610.109) [-602.562] -- 0:00:31
492000 -- (-609.045) (-606.914) (-604.541) [-603.880] * (-603.451) (-604.586) (-602.897) [-605.351] -- 0:00:30
492500 -- (-605.165) (-603.443) (-605.697) [-602.950] * (-603.148) (-603.512) [-603.473] (-603.932) -- 0:00:30
493000 -- (-604.356) (-605.027) (-605.339) [-603.275] * (-602.442) (-608.565) [-602.580] (-604.695) -- 0:00:30
493500 -- (-607.624) [-604.157] (-603.880) (-605.134) * (-604.431) [-608.565] (-606.214) (-604.663) -- 0:00:30
494000 -- (-604.325) (-605.274) [-607.478] (-602.707) * (-602.706) (-607.368) [-602.368] (-604.599) -- 0:00:30
494500 -- (-607.417) (-605.984) (-603.092) [-604.722] * (-602.644) (-605.946) (-603.864) [-603.144] -- 0:00:30
495000 -- [-605.649] (-605.467) (-603.642) (-603.662) * (-605.704) (-604.743) (-609.216) [-605.438] -- 0:00:30
Average standard deviation of split frequencies: 0.010063
495500 -- [-605.915] (-603.542) (-603.239) (-603.569) * (-604.316) [-604.643] (-606.051) (-605.766) -- 0:00:30
496000 -- (-607.870) [-603.319] (-604.120) (-602.571) * [-602.555] (-603.239) (-608.670) (-602.834) -- 0:00:31
496500 -- (-604.477) (-605.404) [-603.592] (-602.454) * (-603.378) [-603.303] (-606.858) (-605.439) -- 0:00:31
497000 -- (-605.267) [-605.035] (-604.999) (-602.920) * [-603.576] (-606.375) (-605.912) (-604.920) -- 0:00:31
497500 -- (-604.235) (-603.771) (-603.694) [-601.892] * (-606.706) [-603.549] (-604.068) (-603.602) -- 0:00:31
498000 -- (-604.233) [-603.787] (-605.233) (-604.973) * (-604.207) (-607.152) [-602.880] (-604.615) -- 0:00:31
498500 -- (-604.867) (-604.151) (-604.091) [-606.042] * (-605.029) [-605.955] (-602.629) (-607.891) -- 0:00:31
499000 -- [-602.339] (-604.256) (-607.752) (-607.512) * [-605.226] (-608.196) (-603.283) (-603.741) -- 0:00:31
499500 -- (-605.259) (-604.732) (-604.889) [-603.683] * (-602.914) [-603.003] (-609.108) (-606.088) -- 0:00:31
500000 -- (-606.122) (-603.017) (-602.082) [-608.810] * (-604.180) [-604.393] (-603.937) (-603.259) -- 0:00:31
Average standard deviation of split frequencies: 0.009748
500500 -- (-607.130) (-602.411) (-604.115) [-603.229] * (-603.916) [-603.532] (-602.615) (-602.943) -- 0:00:30
501000 -- [-607.152] (-609.991) (-606.961) (-602.975) * (-606.835) (-603.895) [-602.892] (-602.081) -- 0:00:30
501500 -- (-604.399) [-603.846] (-606.735) (-603.166) * (-604.717) [-602.781] (-605.235) (-603.689) -- 0:00:30
502000 -- (-603.852) (-602.933) (-604.343) [-604.115] * [-603.832] (-605.034) (-603.795) (-605.630) -- 0:00:30
502500 -- [-603.715] (-603.746) (-604.459) (-603.506) * (-603.892) (-604.698) [-604.068] (-604.135) -- 0:00:30
503000 -- (-606.899) [-603.817] (-604.111) (-604.356) * [-605.505] (-603.427) (-605.343) (-604.984) -- 0:00:30
503500 -- [-603.850] (-603.836) (-604.072) (-604.017) * (-604.823) (-602.839) (-603.457) [-605.446] -- 0:00:30
504000 -- (-604.689) [-604.425] (-602.661) (-606.440) * (-604.562) (-607.479) (-601.905) [-602.248] -- 0:00:30
504500 -- (-603.679) (-605.141) [-603.167] (-606.587) * (-604.952) (-607.891) (-602.664) [-603.168] -- 0:00:30
505000 -- (-602.269) (-606.453) [-603.951] (-602.599) * (-605.432) (-602.480) [-604.527] (-610.029) -- 0:00:30
Average standard deviation of split frequencies: 0.009590
505500 -- (-602.834) [-604.332] (-603.510) (-602.955) * (-605.036) [-603.138] (-609.183) (-604.281) -- 0:00:30
506000 -- (-603.379) (-607.980) (-604.113) [-601.938] * (-605.004) [-603.212] (-604.348) (-605.548) -- 0:00:30
506500 -- (-606.155) (-602.856) (-603.561) [-603.226] * (-603.995) (-609.803) (-604.763) [-603.453] -- 0:00:30
507000 -- (-604.640) (-603.950) [-603.125] (-602.962) * (-604.650) (-605.717) [-602.935] (-606.130) -- 0:00:30
507500 -- [-604.654] (-603.194) (-603.823) (-604.458) * [-602.489] (-603.963) (-603.130) (-605.110) -- 0:00:30
508000 -- (-603.636) [-602.027] (-603.177) (-602.587) * (-602.942) (-609.635) (-602.119) [-603.538] -- 0:00:30
508500 -- (-603.294) (-604.011) (-604.556) [-606.504] * [-605.660] (-608.686) (-602.204) (-602.229) -- 0:00:29
509000 -- (-603.732) (-606.560) [-602.676] (-603.672) * (-605.977) [-603.909] (-605.259) (-603.835) -- 0:00:29
509500 -- (-602.178) [-604.145] (-602.373) (-604.246) * [-603.169] (-605.457) (-602.329) (-605.053) -- 0:00:29
510000 -- [-602.630] (-603.201) (-603.179) (-604.695) * (-607.432) (-603.002) (-605.022) [-602.269] -- 0:00:29
Average standard deviation of split frequencies: 0.009991
510500 -- (-603.755) [-602.357] (-604.464) (-605.433) * (-604.889) (-605.796) [-603.857] (-604.759) -- 0:00:29
511000 -- (-603.574) (-603.034) [-604.484] (-603.817) * [-607.402] (-603.763) (-610.177) (-605.851) -- 0:00:29
511500 -- [-603.942] (-603.137) (-604.062) (-603.287) * (-603.132) [-604.607] (-603.213) (-605.692) -- 0:00:29
512000 -- (-602.365) [-603.746] (-601.918) (-603.466) * (-603.820) (-602.977) [-602.638] (-605.270) -- 0:00:29
512500 -- (-605.825) [-602.525] (-602.407) (-603.876) * [-604.799] (-603.518) (-604.006) (-604.089) -- 0:00:30
513000 -- [-606.656] (-602.665) (-602.052) (-606.542) * (-602.316) [-604.845] (-603.817) (-603.965) -- 0:00:30
513500 -- (-603.110) (-602.765) [-604.058] (-602.920) * (-603.170) (-604.491) [-602.365] (-603.649) -- 0:00:30
514000 -- [-608.847] (-602.931) (-602.945) (-603.232) * (-605.456) (-608.610) [-603.026] (-602.730) -- 0:00:30
514500 -- (-606.214) (-604.803) (-606.459) [-602.453] * (-604.013) [-603.243] (-604.006) (-602.688) -- 0:00:30
515000 -- (-607.399) [-603.989] (-603.809) (-603.454) * (-604.165) [-602.771] (-605.439) (-604.775) -- 0:00:30
Average standard deviation of split frequencies: 0.010103
515500 -- (-604.400) [-603.101] (-602.015) (-603.001) * [-603.768] (-602.713) (-603.700) (-603.791) -- 0:00:30
516000 -- [-604.506] (-603.984) (-602.521) (-602.732) * (-603.225) [-604.517] (-605.730) (-603.901) -- 0:00:30
516500 -- (-604.528) [-603.606] (-604.558) (-603.801) * (-603.372) (-605.293) [-605.573] (-603.521) -- 0:00:29
517000 -- (-603.481) [-603.723] (-604.342) (-603.367) * (-608.199) [-607.102] (-605.506) (-606.910) -- 0:00:29
517500 -- (-602.435) (-604.555) [-603.344] (-602.661) * (-603.626) (-603.829) (-608.256) [-603.628] -- 0:00:29
518000 -- (-605.425) (-605.191) (-603.442) [-604.633] * [-605.351] (-603.905) (-603.079) (-603.085) -- 0:00:29
518500 -- (-603.873) (-602.146) [-603.751] (-604.942) * (-610.250) [-603.288] (-602.261) (-604.777) -- 0:00:29
519000 -- (-602.526) (-603.981) (-602.224) [-603.742] * (-608.149) [-606.097] (-609.982) (-602.946) -- 0:00:29
519500 -- (-605.333) (-604.904) [-603.913] (-605.106) * [-605.250] (-605.996) (-609.009) (-602.132) -- 0:00:29
520000 -- [-608.744] (-604.867) (-605.265) (-602.899) * (-603.095) [-605.757] (-604.684) (-603.249) -- 0:00:29
Average standard deviation of split frequencies: 0.010016
520500 -- [-604.021] (-602.833) (-603.934) (-604.019) * [-603.003] (-610.840) (-604.395) (-602.861) -- 0:00:29
521000 -- (-605.846) (-604.692) [-602.730] (-603.623) * [-602.437] (-603.393) (-603.764) (-606.181) -- 0:00:29
521500 -- (-604.802) [-604.673] (-602.806) (-609.942) * (-603.986) (-604.752) (-603.038) [-603.578] -- 0:00:29
522000 -- [-603.311] (-602.082) (-604.545) (-604.176) * [-602.331] (-603.528) (-604.232) (-603.767) -- 0:00:29
522500 -- (-602.338) [-604.536] (-606.175) (-608.216) * (-606.897) [-604.572] (-603.839) (-603.383) -- 0:00:29
523000 -- (-602.274) (-605.117) [-603.228] (-602.882) * [-602.917] (-603.191) (-603.506) (-604.991) -- 0:00:29
523500 -- (-604.854) [-605.183] (-604.845) (-602.808) * (-604.699) (-604.796) [-602.420] (-603.795) -- 0:00:29
524000 -- (-603.372) [-605.337] (-605.198) (-604.337) * (-603.377) [-609.916] (-607.277) (-603.247) -- 0:00:29
524500 -- [-603.784] (-605.726) (-604.168) (-603.669) * [-603.343] (-609.455) (-612.072) (-603.439) -- 0:00:29
525000 -- (-603.963) [-604.173] (-603.171) (-602.244) * (-602.664) [-609.960] (-605.165) (-604.482) -- 0:00:28
Average standard deviation of split frequencies: 0.010642
525500 -- (-606.837) [-604.490] (-603.697) (-607.524) * (-602.567) (-603.369) (-606.565) [-602.634] -- 0:00:28
526000 -- (-606.919) (-604.182) [-602.788] (-605.281) * (-602.930) (-604.550) (-603.580) [-604.899] -- 0:00:28
526500 -- (-604.816) (-603.224) (-603.243) [-608.527] * (-604.369) (-603.544) (-607.304) [-603.478] -- 0:00:28
527000 -- (-605.173) [-612.362] (-604.125) (-605.325) * (-605.533) [-605.633] (-603.069) (-608.938) -- 0:00:28
527500 -- (-609.881) [-604.058] (-606.315) (-605.904) * (-603.325) (-606.664) [-603.496] (-605.610) -- 0:00:28
528000 -- [-603.149] (-605.009) (-602.820) (-602.608) * (-607.730) [-602.753] (-605.885) (-605.436) -- 0:00:28
528500 -- (-607.331) (-603.517) [-602.703] (-603.784) * (-605.854) (-602.021) [-606.759] (-602.767) -- 0:00:28
529000 -- [-602.524] (-603.315) (-602.945) (-602.346) * [-605.201] (-602.479) (-603.706) (-604.385) -- 0:00:29
529500 -- (-607.066) (-605.616) (-605.123) [-603.929] * (-604.309) (-612.953) [-602.923] (-603.106) -- 0:00:29
530000 -- [-605.572] (-603.740) (-604.761) (-602.358) * (-603.556) (-609.862) [-603.095] (-603.861) -- 0:00:29
Average standard deviation of split frequencies: 0.010438
530500 -- (-606.008) (-604.334) [-606.152] (-602.874) * (-607.637) (-610.233) [-602.635] (-606.065) -- 0:00:29
531000 -- (-604.361) [-603.810] (-605.508) (-612.024) * (-605.218) [-603.585] (-606.073) (-604.565) -- 0:00:29
531500 -- (-603.057) (-605.822) [-603.985] (-606.159) * (-604.101) [-602.468] (-605.234) (-605.749) -- 0:00:29
532000 -- [-603.819] (-606.396) (-603.649) (-603.824) * (-603.926) (-604.329) [-603.861] (-603.257) -- 0:00:29
532500 -- (-605.390) (-605.882) (-603.936) [-605.505] * (-605.096) (-603.492) (-603.800) [-602.685] -- 0:00:28
533000 -- (-604.875) [-603.652] (-604.362) (-603.696) * (-604.222) (-603.343) (-608.412) [-602.908] -- 0:00:28
533500 -- (-605.531) (-604.779) [-604.081] (-605.502) * (-604.220) (-603.967) [-605.004] (-602.380) -- 0:00:28
534000 -- (-606.568) (-611.429) [-602.094] (-605.170) * (-602.611) (-607.636) [-605.352] (-603.301) -- 0:00:28
534500 -- [-602.882] (-602.714) (-603.460) (-604.567) * (-602.786) (-605.867) [-603.399] (-606.113) -- 0:00:28
535000 -- (-604.547) [-602.256] (-603.767) (-603.170) * (-605.335) (-604.155) [-604.717] (-604.404) -- 0:00:28
Average standard deviation of split frequencies: 0.009894
535500 -- (-607.203) [-602.122] (-601.969) (-606.333) * (-606.621) (-607.222) (-604.956) [-602.637] -- 0:00:28
536000 -- (-604.758) [-602.443] (-606.568) (-608.371) * (-608.866) [-604.454] (-604.411) (-602.517) -- 0:00:28
536500 -- (-603.545) [-603.331] (-606.805) (-604.151) * (-603.770) [-603.850] (-603.409) (-604.789) -- 0:00:28
537000 -- (-607.281) (-603.081) [-602.148] (-603.998) * (-603.579) [-605.851] (-602.877) (-604.765) -- 0:00:28
537500 -- (-605.087) (-607.716) [-603.331] (-605.499) * (-603.305) (-607.847) [-603.949] (-602.662) -- 0:00:28
538000 -- (-606.942) (-609.118) (-604.580) [-606.055] * [-602.877] (-605.758) (-607.184) (-605.262) -- 0:00:28
538500 -- (-603.658) [-602.444] (-604.553) (-604.373) * [-604.551] (-606.592) (-603.676) (-604.555) -- 0:00:28
539000 -- (-607.624) [-605.632] (-603.786) (-604.814) * (-603.482) [-604.175] (-602.699) (-604.703) -- 0:00:28
539500 -- (-606.729) [-608.295] (-604.322) (-602.446) * (-602.366) [-605.289] (-605.061) (-602.729) -- 0:00:28
540000 -- (-606.673) (-602.336) [-606.325] (-603.303) * (-602.903) (-606.669) (-605.266) [-602.699] -- 0:00:28
Average standard deviation of split frequencies: 0.009863
540500 -- (-603.645) (-605.301) [-604.051] (-603.331) * (-602.368) (-602.889) [-604.736] (-607.046) -- 0:00:28
541000 -- [-602.590] (-604.350) (-605.027) (-603.522) * [-602.329] (-603.334) (-602.744) (-605.230) -- 0:00:27
541500 -- [-604.968] (-603.874) (-604.778) (-604.181) * (-605.538) (-606.595) (-606.294) [-605.037] -- 0:00:27
542000 -- (-603.087) (-604.570) [-604.323] (-604.423) * [-604.308] (-605.782) (-606.541) (-605.575) -- 0:00:27
542500 -- (-604.629) [-603.797] (-606.462) (-603.488) * (-605.607) (-603.468) (-604.125) [-605.449] -- 0:00:27
543000 -- [-604.288] (-603.773) (-607.269) (-602.702) * (-602.313) (-602.272) [-603.351] (-605.159) -- 0:00:27
543500 -- (-604.999) (-604.451) [-608.741] (-604.154) * [-604.211] (-605.346) (-603.098) (-605.077) -- 0:00:27
544000 -- (-608.506) [-603.836] (-605.681) (-604.592) * (-605.894) [-604.369] (-604.482) (-607.491) -- 0:00:27
544500 -- (-606.178) (-604.482) [-604.005] (-607.203) * [-605.166] (-602.503) (-605.387) (-606.403) -- 0:00:27
545000 -- (-606.885) (-606.397) [-608.058] (-603.920) * (-603.930) [-608.861] (-604.881) (-606.114) -- 0:00:27
Average standard deviation of split frequencies: 0.009700
545500 -- [-603.567] (-607.789) (-604.839) (-604.172) * [-603.079] (-609.468) (-603.139) (-607.726) -- 0:00:28
546000 -- (-605.180) [-606.157] (-602.173) (-603.695) * (-603.729) (-606.090) (-604.009) [-602.818] -- 0:00:28
546500 -- [-605.569] (-606.182) (-602.466) (-603.045) * (-606.384) (-609.085) [-602.745] (-603.326) -- 0:00:28
547000 -- (-610.064) (-605.343) (-603.007) [-602.274] * [-603.560] (-606.909) (-605.092) (-603.263) -- 0:00:28
547500 -- (-612.878) (-603.548) [-606.277] (-607.834) * (-602.058) (-602.812) (-603.584) [-602.537] -- 0:00:28
548000 -- (-609.356) [-606.212] (-604.313) (-603.343) * (-603.921) (-605.527) [-604.145] (-603.128) -- 0:00:28
548500 -- (-603.718) [-605.695] (-602.855) (-603.260) * (-603.969) (-603.268) (-606.511) [-602.194] -- 0:00:27
549000 -- (-603.715) (-604.143) (-604.505) [-603.765] * [-604.725] (-605.326) (-603.403) (-605.361) -- 0:00:27
549500 -- (-603.614) (-602.899) (-606.352) [-605.278] * (-604.300) (-607.331) [-605.330] (-603.848) -- 0:00:27
550000 -- (-606.721) (-603.527) (-609.063) [-603.842] * (-604.368) (-606.789) (-604.328) [-604.018] -- 0:00:27
Average standard deviation of split frequencies: 0.008935
550500 -- [-602.511] (-604.821) (-605.971) (-605.455) * (-602.772) [-603.299] (-603.581) (-602.772) -- 0:00:27
551000 -- (-604.081) (-604.543) [-610.065] (-603.202) * [-603.812] (-602.868) (-611.314) (-604.515) -- 0:00:27
551500 -- (-603.171) (-604.619) (-608.320) [-603.711] * (-604.228) (-604.053) [-602.079] (-605.830) -- 0:00:27
552000 -- (-602.772) [-602.776] (-608.238) (-604.001) * (-604.935) (-604.183) [-602.235] (-605.630) -- 0:00:27
552500 -- (-604.528) (-605.171) [-602.050] (-604.417) * [-602.749] (-603.786) (-604.191) (-603.494) -- 0:00:27
553000 -- (-602.815) (-605.676) [-605.320] (-603.578) * (-602.979) (-603.893) [-608.179] (-606.534) -- 0:00:27
553500 -- (-604.685) (-608.710) (-605.360) [-602.947] * [-607.526] (-603.669) (-606.495) (-603.988) -- 0:00:27
554000 -- (-602.795) (-603.617) (-604.570) [-604.906] * (-603.263) (-607.229) [-606.933] (-603.395) -- 0:00:27
554500 -- [-603.175] (-605.625) (-605.282) (-617.290) * (-603.680) (-604.673) (-607.449) [-604.854] -- 0:00:27
555000 -- (-602.826) [-607.588] (-605.262) (-605.144) * (-606.682) [-605.048] (-606.338) (-608.376) -- 0:00:27
Average standard deviation of split frequencies: 0.009114
555500 -- (-606.497) (-606.244) [-602.618] (-603.044) * (-608.969) (-606.438) (-608.910) [-603.855] -- 0:00:27
556000 -- (-604.485) (-608.161) [-602.314] (-605.894) * [-606.920] (-604.069) (-604.447) (-606.008) -- 0:00:27
556500 -- (-608.725) [-606.572] (-607.444) (-603.098) * (-605.343) (-609.050) [-604.834] (-605.043) -- 0:00:27
557000 -- (-607.622) (-603.187) (-602.545) [-605.773] * (-606.153) (-601.886) (-605.827) [-607.660] -- 0:00:27
557500 -- [-603.220] (-606.418) (-604.364) (-603.194) * (-603.807) (-601.961) [-605.576] (-606.936) -- 0:00:26
558000 -- (-604.831) (-603.919) (-602.632) [-605.212] * (-605.943) [-605.023] (-602.525) (-603.509) -- 0:00:26
558500 -- [-607.173] (-604.890) (-602.683) (-603.371) * (-604.769) [-602.995] (-604.049) (-603.760) -- 0:00:26
559000 -- [-604.956] (-605.095) (-601.959) (-605.974) * [-604.465] (-605.017) (-604.273) (-602.466) -- 0:00:26
559500 -- (-605.101) [-605.550] (-603.337) (-603.146) * (-603.477) [-604.159] (-606.295) (-603.852) -- 0:00:26
560000 -- (-604.996) (-604.226) (-602.663) [-604.807] * (-603.660) [-603.415] (-603.960) (-605.431) -- 0:00:26
Average standard deviation of split frequencies: 0.008856
560500 -- (-606.526) (-608.249) (-603.127) [-603.674] * [-606.443] (-603.533) (-606.214) (-604.716) -- 0:00:26
561000 -- (-605.077) [-603.970] (-602.065) (-603.160) * [-604.203] (-606.727) (-605.991) (-605.677) -- 0:00:26
561500 -- (-607.485) (-603.206) [-602.187] (-602.772) * (-604.247) (-603.601) [-605.011] (-603.857) -- 0:00:26
562000 -- (-605.455) (-602.580) (-602.130) [-605.129] * (-603.681) (-603.727) (-604.950) [-601.788] -- 0:00:26
562500 -- [-603.729] (-602.945) (-604.082) (-605.999) * (-602.072) (-603.586) [-605.634] (-603.879) -- 0:00:27
563000 -- [-602.843] (-606.874) (-607.370) (-609.305) * (-602.515) [-608.459] (-606.306) (-604.012) -- 0:00:27
563500 -- [-604.091] (-607.195) (-604.434) (-603.949) * (-603.167) (-604.465) [-606.113] (-604.695) -- 0:00:27
564000 -- [-602.954] (-602.345) (-608.323) (-602.423) * [-602.956] (-605.977) (-602.800) (-603.404) -- 0:00:27
564500 -- [-606.686] (-602.773) (-604.865) (-604.738) * (-606.346) (-603.503) [-607.914] (-605.269) -- 0:00:27
565000 -- (-604.567) [-602.711] (-609.465) (-604.671) * (-604.529) [-604.623] (-606.364) (-607.337) -- 0:00:26
Average standard deviation of split frequencies: 0.008939
565500 -- (-603.493) (-604.421) (-606.415) [-603.857] * (-603.601) (-602.413) (-605.157) [-602.793] -- 0:00:26
566000 -- [-602.662] (-606.568) (-602.105) (-604.563) * (-605.599) (-603.950) [-605.667] (-603.499) -- 0:00:26
566500 -- (-603.765) [-605.494] (-602.538) (-604.960) * (-605.161) [-603.752] (-607.837) (-608.980) -- 0:00:26
567000 -- (-602.844) (-603.199) [-602.729] (-603.102) * (-603.975) (-605.969) [-604.700] (-604.689) -- 0:00:26
567500 -- (-604.152) [-603.893] (-602.012) (-607.199) * [-602.669] (-604.097) (-603.169) (-604.842) -- 0:00:26
568000 -- (-605.195) (-604.290) [-605.551] (-602.820) * (-601.835) [-604.613] (-602.583) (-606.577) -- 0:00:26
568500 -- [-603.062] (-607.067) (-603.304) (-602.294) * (-607.564) (-602.238) (-602.774) [-603.323] -- 0:00:26
569000 -- (-605.248) (-604.940) [-607.521] (-607.084) * (-605.453) [-602.620] (-602.525) (-603.709) -- 0:00:26
569500 -- (-603.305) [-602.501] (-605.996) (-605.434) * (-603.887) (-602.891) (-604.324) [-602.863] -- 0:00:26
570000 -- [-604.752] (-602.496) (-604.258) (-602.656) * (-604.880) [-601.929] (-605.785) (-604.033) -- 0:00:26
Average standard deviation of split frequencies: 0.008591
570500 -- (-609.185) (-605.541) [-604.196] (-604.781) * (-602.679) (-602.701) [-601.969] (-606.394) -- 0:00:26
571000 -- (-607.525) (-602.942) [-602.905] (-604.805) * [-603.505] (-604.105) (-602.729) (-604.667) -- 0:00:26
571500 -- [-607.060] (-602.423) (-603.505) (-604.715) * (-602.127) (-604.325) (-602.516) [-605.359] -- 0:00:26
572000 -- (-607.953) (-604.459) [-603.040] (-606.379) * [-605.021] (-604.946) (-603.351) (-606.637) -- 0:00:26
572500 -- [-603.090] (-605.712) (-603.310) (-607.737) * (-603.487) [-604.753] (-604.907) (-603.753) -- 0:00:26
573000 -- [-602.097] (-603.985) (-603.509) (-602.495) * (-607.454) (-603.236) (-607.206) [-603.771] -- 0:00:26
573500 -- (-603.256) [-606.044] (-605.000) (-602.502) * (-603.289) (-604.101) [-603.820] (-604.452) -- 0:00:26
574000 -- [-602.295] (-603.628) (-604.759) (-607.018) * (-604.651) (-606.686) (-606.257) [-602.833] -- 0:00:25
574500 -- [-604.758] (-604.297) (-607.019) (-615.066) * (-604.576) (-602.853) (-604.566) [-603.091] -- 0:00:25
575000 -- [-603.209] (-603.331) (-602.391) (-602.926) * [-603.024] (-603.629) (-602.593) (-604.760) -- 0:00:25
Average standard deviation of split frequencies: 0.008457
575500 -- [-603.484] (-609.081) (-604.946) (-604.109) * (-605.477) [-602.908] (-603.093) (-603.865) -- 0:00:25
576000 -- (-604.270) [-602.479] (-603.704) (-605.491) * [-602.259] (-602.318) (-602.562) (-607.760) -- 0:00:25
576500 -- (-606.017) (-603.184) [-603.438] (-604.232) * (-604.346) (-605.432) [-605.062] (-604.450) -- 0:00:25
577000 -- (-605.546) [-605.000] (-602.939) (-608.234) * [-602.181] (-604.197) (-603.504) (-604.342) -- 0:00:25
577500 -- (-604.893) (-603.714) [-602.188] (-604.727) * [-602.959] (-605.836) (-607.123) (-604.033) -- 0:00:25
578000 -- [-602.425] (-602.674) (-603.344) (-608.895) * [-607.032] (-608.365) (-603.300) (-604.976) -- 0:00:25
578500 -- (-603.961) (-603.218) [-603.726] (-612.328) * (-607.609) [-607.146] (-602.306) (-606.843) -- 0:00:25
579000 -- (-606.651) (-602.231) [-604.504] (-603.012) * (-605.120) (-604.057) [-602.466] (-605.936) -- 0:00:25
579500 -- [-602.934] (-602.037) (-605.025) (-603.963) * (-602.360) [-603.397] (-602.361) (-602.949) -- 0:00:26
580000 -- (-602.786) (-605.213) (-604.630) [-604.618] * (-602.112) (-606.354) [-604.276] (-605.391) -- 0:00:26
Average standard deviation of split frequencies: 0.008660
580500 -- (-604.500) (-602.994) [-603.146] (-604.066) * (-604.324) [-609.202] (-604.244) (-611.814) -- 0:00:26
581000 -- (-604.489) (-602.879) [-603.899] (-603.071) * (-603.241) (-606.574) [-604.684] (-604.471) -- 0:00:25
581500 -- (-602.942) [-603.150] (-603.670) (-604.114) * (-602.179) [-604.814] (-605.076) (-604.698) -- 0:00:25
582000 -- (-603.197) (-603.564) (-605.428) [-605.446] * (-603.601) (-602.469) (-604.900) [-607.327] -- 0:00:25
582500 -- [-604.683] (-603.115) (-602.688) (-603.427) * (-603.941) [-603.900] (-604.355) (-606.171) -- 0:00:25
583000 -- [-607.482] (-603.308) (-602.179) (-602.552) * (-604.393) (-602.238) [-602.616] (-605.187) -- 0:00:25
583500 -- (-604.684) (-607.854) (-602.087) [-603.505] * (-603.232) [-603.135] (-605.624) (-603.076) -- 0:00:25
584000 -- (-605.914) (-607.302) (-605.879) [-602.652] * [-604.145] (-602.949) (-603.612) (-603.228) -- 0:00:25
584500 -- (-604.946) (-611.184) [-603.247] (-602.433) * (-603.476) (-603.035) (-603.703) [-604.279] -- 0:00:25
585000 -- (-605.458) (-604.613) [-604.087] (-602.472) * (-603.595) (-603.925) (-603.629) [-603.995] -- 0:00:25
Average standard deviation of split frequencies: 0.008195
585500 -- [-603.665] (-602.411) (-605.469) (-603.386) * (-604.005) (-605.798) [-606.636] (-604.235) -- 0:00:25
586000 -- (-604.664) [-602.415] (-606.141) (-604.284) * (-604.716) (-604.124) (-609.219) [-605.772] -- 0:00:25
586500 -- (-603.094) [-602.459] (-603.110) (-603.750) * [-606.741] (-604.331) (-605.209) (-605.159) -- 0:00:25
587000 -- [-602.637] (-602.354) (-606.082) (-609.065) * (-604.776) [-605.089] (-603.228) (-604.891) -- 0:00:25
587500 -- (-602.770) [-603.421] (-603.754) (-603.925) * (-604.962) (-603.963) (-602.993) [-602.474] -- 0:00:25
588000 -- (-604.030) [-606.440] (-606.276) (-604.834) * (-607.859) (-604.402) (-603.095) [-603.666] -- 0:00:25
588500 -- (-602.597) (-605.671) (-603.940) [-602.610] * [-606.794] (-602.561) (-603.672) (-606.346) -- 0:00:25
589000 -- (-602.348) (-602.209) (-602.897) [-602.625] * (-604.626) (-607.224) [-602.844] (-604.484) -- 0:00:25
589500 -- (-604.477) (-603.156) [-603.511] (-603.698) * (-602.411) (-606.228) (-605.141) [-607.020] -- 0:00:25
590000 -- [-602.763] (-602.825) (-604.646) (-606.451) * [-605.861] (-610.440) (-603.306) (-602.800) -- 0:00:25
Average standard deviation of split frequencies: 0.008480
590500 -- (-605.199) (-602.618) (-603.580) [-604.062] * (-603.772) (-608.497) (-605.577) [-604.315] -- 0:00:24
591000 -- (-604.711) (-602.929) (-604.971) [-602.392] * [-605.330] (-604.060) (-605.294) (-603.444) -- 0:00:24
591500 -- (-609.614) (-602.466) (-604.470) [-602.704] * (-610.349) (-604.844) (-604.779) [-603.334] -- 0:00:24
592000 -- (-605.810) [-602.894] (-604.144) (-603.497) * (-604.153) (-603.126) [-603.860] (-603.949) -- 0:00:24
592500 -- (-606.990) (-604.925) [-603.533] (-607.085) * [-602.317] (-602.782) (-601.830) (-603.265) -- 0:00:24
593000 -- (-605.067) (-603.574) (-604.079) [-606.402] * (-603.163) [-603.751] (-605.539) (-602.162) -- 0:00:24
593500 -- [-604.327] (-607.167) (-603.501) (-603.589) * [-607.185] (-606.548) (-603.293) (-606.869) -- 0:00:24
594000 -- [-602.501] (-605.993) (-604.406) (-602.765) * (-603.737) [-607.239] (-603.268) (-604.565) -- 0:00:24
594500 -- [-603.468] (-604.020) (-605.130) (-604.107) * [-602.724] (-602.722) (-603.230) (-604.107) -- 0:00:24
595000 -- (-605.642) (-606.871) (-607.714) [-604.895] * [-604.078] (-607.084) (-602.498) (-603.277) -- 0:00:24
Average standard deviation of split frequencies: 0.008602
595500 -- (-605.071) [-610.531] (-604.422) (-602.901) * (-602.541) (-606.679) (-603.965) [-602.502] -- 0:00:24
596000 -- [-602.813] (-605.081) (-604.460) (-602.837) * (-603.151) [-608.751] (-602.798) (-607.209) -- 0:00:24
596500 -- (-604.937) [-605.652] (-603.790) (-603.133) * (-605.452) [-606.973] (-606.800) (-602.708) -- 0:00:25
597000 -- (-604.009) (-606.374) (-604.546) [-602.454] * (-604.212) [-603.743] (-605.305) (-602.039) -- 0:00:24
597500 -- [-605.638] (-605.566) (-603.189) (-604.389) * (-602.316) (-603.371) [-603.037] (-606.375) -- 0:00:24
598000 -- [-602.088] (-606.671) (-607.015) (-606.740) * (-605.061) (-604.075) [-602.205] (-604.085) -- 0:00:24
598500 -- (-602.016) (-605.900) [-603.488] (-604.171) * (-604.362) (-607.767) [-604.128] (-606.693) -- 0:00:24
599000 -- (-602.791) (-603.904) (-603.823) [-604.212] * (-603.288) (-605.600) [-602.966] (-605.127) -- 0:00:24
599500 -- (-604.573) (-607.043) [-603.852] (-604.786) * (-606.591) (-606.507) (-603.601) [-605.188] -- 0:00:24
600000 -- (-604.423) (-605.842) [-603.525] (-604.906) * (-605.858) [-611.429] (-604.289) (-603.992) -- 0:00:24
Average standard deviation of split frequencies: 0.008424
600500 -- (-604.516) (-610.812) (-603.159) [-603.978] * (-602.809) [-604.349] (-604.529) (-605.168) -- 0:00:24
601000 -- [-603.869] (-606.326) (-602.507) (-604.052) * (-605.152) [-603.739] (-604.983) (-603.828) -- 0:00:24
601500 -- [-603.926] (-606.213) (-603.878) (-603.970) * (-601.967) [-603.003] (-611.859) (-604.587) -- 0:00:24
602000 -- (-604.627) (-608.517) (-606.074) [-602.753] * (-603.871) [-604.471] (-606.016) (-604.123) -- 0:00:24
602500 -- (-602.444) [-606.970] (-604.637) (-602.576) * (-603.444) [-604.132] (-604.728) (-604.607) -- 0:00:24
603000 -- [-601.837] (-605.771) (-605.540) (-604.601) * (-605.626) (-602.239) [-604.906] (-604.924) -- 0:00:24
603500 -- (-601.803) (-603.613) (-603.720) [-604.153] * (-602.966) [-603.788] (-602.541) (-603.708) -- 0:00:24
604000 -- (-603.455) (-606.134) [-604.660] (-606.272) * (-604.249) (-603.150) [-606.400] (-602.587) -- 0:00:24
604500 -- (-606.552) (-605.959) [-603.635] (-605.310) * (-606.759) (-604.817) (-605.237) [-602.261] -- 0:00:24
605000 -- (-604.229) [-604.567] (-603.729) (-606.721) * (-604.067) (-606.036) [-609.907] (-602.398) -- 0:00:24
Average standard deviation of split frequencies: 0.008246
605500 -- (-602.713) (-602.918) (-603.640) [-605.999] * [-605.530] (-602.465) (-604.896) (-605.046) -- 0:00:24
606000 -- (-602.030) [-603.796] (-610.248) (-603.214) * (-605.258) (-603.129) (-603.299) [-603.164] -- 0:00:24
606500 -- [-605.329] (-604.167) (-603.980) (-602.897) * (-604.402) (-603.131) (-604.534) [-603.044] -- 0:00:24
607000 -- (-608.400) [-602.882] (-606.936) (-604.486) * (-603.474) [-605.006] (-604.825) (-602.654) -- 0:00:23
607500 -- (-604.132) (-608.047) (-606.500) [-603.368] * [-603.738] (-603.846) (-604.035) (-607.581) -- 0:00:23
608000 -- (-604.832) (-602.759) (-601.994) [-602.995] * [-603.541] (-602.510) (-605.627) (-607.234) -- 0:00:23
608500 -- (-604.894) (-603.214) (-602.691) [-604.247] * (-602.959) (-602.424) (-605.330) [-604.462] -- 0:00:23
609000 -- [-603.183] (-605.634) (-605.564) (-603.453) * (-606.346) (-606.247) (-605.852) [-604.030] -- 0:00:23
609500 -- (-602.924) (-603.529) [-602.861] (-602.349) * (-604.943) [-602.162] (-602.993) (-606.603) -- 0:00:23
610000 -- (-605.270) [-603.548] (-602.555) (-604.137) * (-609.085) (-602.241) [-602.189] (-603.505) -- 0:00:23
Average standard deviation of split frequencies: 0.007874
610500 -- (-604.775) (-605.051) (-602.873) [-605.986] * (-603.369) [-602.330] (-604.167) (-605.167) -- 0:00:23
611000 -- (-607.027) (-612.540) [-604.280] (-604.102) * (-602.325) (-602.594) [-604.137] (-603.300) -- 0:00:23
611500 -- (-604.013) (-607.989) [-602.562] (-606.653) * [-603.903] (-602.437) (-605.897) (-605.600) -- 0:00:23
612000 -- (-605.015) (-607.203) (-603.542) [-601.744] * (-606.274) (-603.653) [-602.714] (-610.615) -- 0:00:23
612500 -- (-605.982) (-603.856) (-602.602) [-602.594] * (-606.619) (-602.560) [-605.109] (-605.329) -- 0:00:23
613000 -- [-604.591] (-604.942) (-604.712) (-602.008) * (-605.652) (-602.290) [-604.109] (-603.962) -- 0:00:23
613500 -- (-602.303) [-604.275] (-609.468) (-602.485) * (-604.617) (-602.632) (-606.010) [-607.374] -- 0:00:23
614000 -- (-604.057) [-606.681] (-605.497) (-606.343) * (-602.451) (-603.442) (-605.272) [-602.799] -- 0:00:23
614500 -- (-604.084) (-603.224) (-604.750) [-603.946] * (-602.597) (-604.238) [-606.062] (-602.481) -- 0:00:23
615000 -- (-603.849) (-603.124) (-602.737) [-603.798] * [-602.692] (-602.068) (-605.902) (-606.176) -- 0:00:23
Average standard deviation of split frequencies: 0.007347
615500 -- (-607.317) [-603.045] (-604.577) (-603.635) * [-602.182] (-605.433) (-602.168) (-603.500) -- 0:00:23
616000 -- (-602.039) [-603.510] (-607.122) (-602.380) * (-602.323) [-605.240] (-603.776) (-603.856) -- 0:00:23
616500 -- [-604.253] (-604.379) (-604.939) (-603.634) * (-602.286) (-606.459) [-603.491] (-603.676) -- 0:00:23
617000 -- (-603.535) (-607.925) (-604.774) [-604.818] * (-604.070) (-603.779) [-602.105] (-605.982) -- 0:00:23
617500 -- (-603.682) [-602.782] (-605.307) (-606.760) * [-604.457] (-605.692) (-602.769) (-603.433) -- 0:00:23
618000 -- (-605.451) [-602.561] (-603.034) (-603.553) * (-607.214) (-606.020) (-605.597) [-604.022] -- 0:00:23
618500 -- (-606.096) (-604.075) [-607.492] (-602.091) * (-604.208) (-605.065) (-605.052) [-603.266] -- 0:00:23
619000 -- [-603.333] (-605.274) (-605.449) (-602.607) * (-607.360) (-607.099) (-607.490) [-605.415] -- 0:00:23
619500 -- (-605.285) (-603.169) (-602.719) [-608.093] * (-602.586) (-603.733) (-608.723) [-603.896] -- 0:00:23
620000 -- (-603.078) [-602.033] (-604.029) (-605.439) * (-603.542) (-603.821) [-603.027] (-602.608) -- 0:00:23
Average standard deviation of split frequencies: 0.006836
620500 -- (-602.977) [-605.958] (-606.442) (-608.017) * (-608.547) (-604.101) (-605.322) [-604.408] -- 0:00:23
621000 -- [-602.046] (-605.909) (-601.848) (-608.607) * (-604.455) (-604.706) [-603.938] (-604.579) -- 0:00:23
621500 -- [-605.536] (-608.391) (-602.096) (-602.570) * (-607.982) (-605.829) [-607.501] (-604.643) -- 0:00:23
622000 -- (-603.013) (-605.024) (-602.068) [-602.583] * (-607.263) (-604.109) [-603.193] (-606.043) -- 0:00:23
622500 -- (-605.825) (-602.625) (-606.351) [-602.577] * [-603.575] (-605.066) (-604.523) (-607.705) -- 0:00:23
623000 -- (-608.479) (-604.636) [-605.056] (-604.210) * [-604.363] (-605.764) (-605.332) (-603.691) -- 0:00:22
623500 -- (-603.633) (-603.351) [-604.233] (-606.834) * [-603.105] (-602.757) (-608.093) (-603.185) -- 0:00:22
624000 -- (-605.713) (-602.770) (-605.767) [-603.857] * (-603.451) (-603.900) (-602.131) [-610.136] -- 0:00:22
624500 -- (-605.073) [-603.958] (-605.689) (-603.692) * [-603.781] (-604.069) (-602.070) (-606.326) -- 0:00:22
625000 -- (-603.698) [-604.301] (-606.510) (-604.504) * (-604.963) [-605.335] (-603.748) (-604.672) -- 0:00:22
Average standard deviation of split frequencies: 0.007430
625500 -- (-603.328) [-602.452] (-603.378) (-603.262) * (-611.488) (-602.422) (-604.155) [-603.794] -- 0:00:22
626000 -- (-602.110) (-603.182) [-605.073] (-603.674) * (-607.506) [-602.601] (-602.221) (-606.394) -- 0:00:22
626500 -- (-608.509) [-604.539] (-604.299) (-604.367) * (-605.826) [-602.790] (-602.434) (-606.323) -- 0:00:22
627000 -- (-604.752) (-604.811) (-602.506) [-605.580] * [-604.888] (-605.128) (-605.431) (-602.709) -- 0:00:22
627500 -- (-606.544) (-603.810) (-607.146) [-605.909] * (-605.246) [-603.693] (-607.051) (-602.644) -- 0:00:22
628000 -- [-605.713] (-606.143) (-602.091) (-605.343) * [-605.058] (-605.207) (-604.484) (-604.199) -- 0:00:22
628500 -- [-604.898] (-605.061) (-602.721) (-611.933) * (-604.654) (-608.282) (-605.671) [-605.011] -- 0:00:22
629000 -- (-604.502) (-602.732) [-602.691] (-613.888) * [-602.805] (-603.782) (-604.444) (-602.591) -- 0:00:22
629500 -- (-602.320) [-602.048] (-608.307) (-602.593) * (-602.482) (-606.386) [-606.737] (-608.617) -- 0:00:22
630000 -- (-603.543) (-604.011) (-608.105) [-605.768] * [-603.828] (-602.262) (-605.866) (-606.197) -- 0:00:22
Average standard deviation of split frequencies: 0.007425
630500 -- (-608.149) (-603.762) [-603.995] (-602.291) * [-604.078] (-605.631) (-602.131) (-603.777) -- 0:00:22
631000 -- (-603.054) (-606.568) (-603.098) [-603.574] * (-604.296) (-605.815) (-604.435) [-604.702] -- 0:00:22
631500 -- (-607.404) (-605.361) [-605.702] (-603.161) * (-602.331) (-605.644) (-605.827) [-603.544] -- 0:00:22
632000 -- (-606.759) (-604.240) [-603.482] (-604.642) * (-606.233) (-604.695) [-603.938] (-603.426) -- 0:00:22
632500 -- (-604.198) [-603.941] (-603.971) (-603.761) * (-603.295) [-604.647] (-603.787) (-604.766) -- 0:00:22
633000 -- (-607.905) [-603.589] (-603.853) (-601.989) * (-606.139) (-603.281) [-603.338] (-604.505) -- 0:00:22
633500 -- (-604.478) (-603.203) [-606.180] (-603.070) * (-604.591) [-605.335] (-605.333) (-606.513) -- 0:00:22
634000 -- (-603.767) (-604.630) (-606.099) [-603.231] * (-604.432) (-604.901) (-605.571) [-604.514] -- 0:00:22
634500 -- (-602.794) (-604.564) (-605.859) [-603.253] * (-606.172) [-605.934] (-602.752) (-603.886) -- 0:00:22
635000 -- [-602.486] (-605.261) (-603.540) (-603.006) * (-605.672) [-605.044] (-605.179) (-603.100) -- 0:00:22
Average standard deviation of split frequencies: 0.007560
635500 -- (-604.606) [-602.582] (-610.859) (-605.246) * (-603.730) [-605.051] (-603.991) (-609.587) -- 0:00:22
636000 -- (-605.760) [-603.901] (-609.080) (-603.424) * [-604.018] (-604.027) (-603.920) (-603.003) -- 0:00:22
636500 -- [-605.304] (-605.299) (-611.747) (-605.824) * (-611.600) (-605.729) [-602.134] (-603.897) -- 0:00:22
637000 -- (-605.218) [-606.186] (-603.227) (-603.895) * (-603.393) (-602.980) (-609.100) [-605.192] -- 0:00:22
637500 -- (-606.996) (-603.942) [-603.700] (-604.973) * [-602.262] (-603.198) (-605.422) (-606.948) -- 0:00:22
638000 -- (-610.799) (-603.362) [-602.826] (-602.804) * (-602.614) (-603.895) [-603.855] (-605.051) -- 0:00:22
638500 -- (-602.243) (-602.027) [-602.641] (-604.531) * (-602.186) [-602.101] (-602.174) (-603.151) -- 0:00:22
639000 -- (-606.533) [-606.080] (-603.037) (-602.492) * (-601.849) (-604.315) [-602.311] (-602.910) -- 0:00:22
639500 -- [-604.613] (-605.433) (-604.325) (-604.551) * [-606.402] (-602.669) (-605.721) (-602.444) -- 0:00:21
640000 -- (-604.319) (-604.307) [-604.650] (-606.996) * (-606.763) [-604.783] (-604.368) (-602.910) -- 0:00:21
Average standard deviation of split frequencies: 0.008437
640500 -- (-603.053) (-603.899) [-603.586] (-608.665) * (-602.892) [-603.235] (-605.121) (-602.665) -- 0:00:21
641000 -- [-603.034] (-602.863) (-603.412) (-605.425) * (-604.092) (-602.216) (-605.400) [-602.807] -- 0:00:21
641500 -- [-603.906] (-606.719) (-607.232) (-606.217) * (-602.754) (-602.466) [-606.477] (-604.208) -- 0:00:21
642000 -- (-603.417) [-602.181] (-604.971) (-608.222) * (-603.438) [-606.631] (-603.389) (-606.542) -- 0:00:21
642500 -- [-604.296] (-603.594) (-602.956) (-602.592) * [-604.618] (-606.273) (-604.505) (-603.193) -- 0:00:21
643000 -- (-605.685) (-605.401) (-603.792) [-602.367] * [-603.370] (-602.706) (-606.645) (-602.270) -- 0:00:21
643500 -- (-603.675) (-603.499) [-604.160] (-604.520) * (-605.504) (-604.705) (-607.114) [-602.983] -- 0:00:21
644000 -- (-603.043) [-603.279] (-604.206) (-605.626) * (-605.112) (-604.131) (-604.014) [-603.592] -- 0:00:21
644500 -- (-604.310) (-602.591) (-606.225) [-604.840] * (-604.153) [-603.557] (-606.356) (-603.339) -- 0:00:21
645000 -- (-603.326) (-604.729) [-604.735] (-604.356) * (-603.756) [-610.746] (-602.362) (-603.903) -- 0:00:21
Average standard deviation of split frequencies: 0.009000
645500 -- [-603.946] (-602.734) (-603.694) (-605.196) * (-610.115) (-603.305) [-605.078] (-602.411) -- 0:00:21
646000 -- [-602.830] (-605.100) (-605.861) (-605.215) * (-605.077) [-603.425] (-605.407) (-602.923) -- 0:00:21
646500 -- (-603.000) (-607.109) (-606.073) [-604.058] * (-604.848) [-607.285] (-603.468) (-603.682) -- 0:00:21
647000 -- (-602.895) [-601.811] (-603.948) (-603.193) * (-605.785) (-605.980) [-604.416] (-605.578) -- 0:00:21
647500 -- (-604.813) [-603.548] (-602.901) (-605.458) * (-603.711) (-606.214) (-604.208) [-603.988] -- 0:00:21
648000 -- [-605.535] (-604.772) (-605.156) (-603.636) * [-603.956] (-607.249) (-603.342) (-603.829) -- 0:00:21
648500 -- (-606.161) (-605.198) (-605.523) [-604.721] * [-602.945] (-607.264) (-602.094) (-606.961) -- 0:00:21
649000 -- (-603.452) (-603.095) [-602.798] (-602.245) * (-603.538) (-602.693) [-603.546] (-603.863) -- 0:00:21
649500 -- (-602.606) (-603.577) (-602.982) [-601.912] * (-602.617) (-603.508) [-605.429] (-602.271) -- 0:00:21
650000 -- (-604.549) (-603.255) [-602.716] (-604.278) * (-603.229) [-604.278] (-603.138) (-604.798) -- 0:00:21
Average standard deviation of split frequencies: 0.009225
650500 -- (-604.246) [-603.548] (-602.677) (-607.633) * (-603.559) (-604.536) [-604.442] (-608.781) -- 0:00:21
651000 -- (-601.962) [-606.479] (-602.288) (-606.459) * (-603.943) [-604.713] (-606.768) (-605.190) -- 0:00:21
651500 -- (-605.239) (-604.115) (-608.442) [-604.815] * (-604.278) (-605.226) [-605.222] (-603.169) -- 0:00:21
652000 -- (-605.828) (-604.350) (-608.638) [-602.966] * (-604.117) (-603.794) (-603.759) [-602.480] -- 0:00:21
652500 -- (-602.366) (-602.983) [-603.655] (-603.761) * (-604.058) (-603.229) (-604.541) [-604.252] -- 0:00:21
653000 -- (-604.730) [-605.419] (-608.134) (-604.163) * (-605.538) (-604.959) [-603.370] (-606.454) -- 0:00:21
653500 -- (-603.189) (-602.427) [-603.561] (-605.156) * (-604.927) (-602.734) [-606.863] (-603.511) -- 0:00:21
654000 -- [-605.068] (-602.217) (-603.371) (-607.784) * (-604.932) [-603.999] (-603.650) (-602.908) -- 0:00:21
654500 -- (-609.607) [-602.664] (-602.996) (-604.928) * [-602.359] (-605.504) (-603.435) (-603.238) -- 0:00:21
655000 -- (-602.067) [-603.388] (-604.802) (-606.934) * (-602.175) [-604.845] (-603.564) (-602.621) -- 0:00:21
Average standard deviation of split frequencies: 0.009581
655500 -- (-605.186) (-603.379) [-604.463] (-603.025) * (-602.035) [-603.670] (-602.780) (-603.853) -- 0:00:21
656000 -- (-604.897) (-603.283) (-608.913) [-603.601] * [-604.245] (-603.592) (-606.689) (-604.712) -- 0:00:20
656500 -- [-605.686] (-604.580) (-609.015) (-604.378) * [-603.581] (-606.950) (-602.893) (-602.594) -- 0:00:20
657000 -- [-604.412] (-602.545) (-602.823) (-603.004) * (-605.565) [-604.232] (-603.870) (-604.495) -- 0:00:20
657500 -- (-607.070) (-603.302) [-603.566] (-603.355) * (-606.898) (-602.663) [-605.932] (-605.641) -- 0:00:20
658000 -- (-604.405) (-602.502) (-604.341) [-602.860] * [-603.716] (-603.384) (-605.686) (-602.725) -- 0:00:20
658500 -- (-602.274) [-602.594] (-605.833) (-603.997) * (-602.930) (-603.405) [-602.890] (-604.894) -- 0:00:20
659000 -- (-601.851) [-604.581] (-605.274) (-603.429) * [-604.791] (-602.617) (-611.756) (-605.817) -- 0:00:20
659500 -- (-603.271) (-608.585) (-604.656) [-604.157] * (-607.298) (-602.439) [-603.978] (-608.080) -- 0:00:20
660000 -- (-609.527) (-605.217) (-602.230) [-602.843] * (-605.356) [-605.500] (-603.205) (-605.607) -- 0:00:20
Average standard deviation of split frequencies: 0.009228
660500 -- (-610.030) [-605.359] (-608.348) (-604.397) * (-604.074) [-603.133] (-605.286) (-604.084) -- 0:00:20
661000 -- [-605.152] (-605.624) (-607.804) (-608.195) * (-606.341) (-603.594) [-602.510] (-604.798) -- 0:00:20
661500 -- (-605.023) (-611.894) [-602.319] (-602.962) * [-604.537] (-604.418) (-604.048) (-604.283) -- 0:00:20
662000 -- (-604.124) [-605.318] (-604.189) (-605.420) * (-605.563) (-604.160) [-605.247] (-603.642) -- 0:00:20
662500 -- [-603.161] (-603.632) (-603.948) (-606.746) * (-606.054) [-603.194] (-605.024) (-604.488) -- 0:00:20
663000 -- (-604.188) [-602.110] (-607.278) (-603.423) * [-603.180] (-603.856) (-603.015) (-604.263) -- 0:00:20
663500 -- [-607.010] (-606.386) (-605.130) (-604.409) * (-604.313) (-603.609) [-602.609] (-608.300) -- 0:00:20
664000 -- (-602.799) [-605.406] (-605.727) (-603.667) * (-603.590) (-602.287) [-602.105] (-604.530) -- 0:00:20
664500 -- (-604.049) (-609.543) [-602.870] (-607.002) * (-602.548) (-605.760) [-602.080] (-604.376) -- 0:00:20
665000 -- (-603.827) (-603.870) (-605.394) [-605.578] * (-602.500) (-603.735) (-603.077) [-603.517] -- 0:00:20
Average standard deviation of split frequencies: 0.008918
665500 -- [-604.365] (-603.966) (-608.648) (-606.762) * [-604.525] (-604.111) (-604.756) (-608.189) -- 0:00:20
666000 -- (-604.011) (-605.240) (-607.651) [-602.557] * (-605.548) (-603.744) (-602.347) [-604.515] -- 0:00:20
666500 -- (-602.987) (-602.912) (-603.371) [-604.282] * (-604.663) (-603.970) (-609.224) [-602.928] -- 0:00:20
667000 -- (-602.987) (-604.623) [-604.465] (-602.032) * [-603.720] (-603.969) (-603.084) (-603.498) -- 0:00:20
667500 -- [-602.167] (-604.458) (-604.808) (-603.058) * (-603.522) (-604.210) [-604.436] (-602.849) -- 0:00:20
668000 -- (-608.249) (-604.960) [-603.453] (-602.003) * (-604.144) [-603.796] (-604.980) (-603.588) -- 0:00:20
668500 -- (-604.449) (-608.980) [-604.187] (-602.733) * (-608.319) (-604.755) [-604.699] (-603.903) -- 0:00:20
669000 -- [-604.906] (-607.848) (-605.107) (-604.729) * [-602.090] (-604.072) (-608.138) (-603.353) -- 0:00:20
669500 -- (-606.584) [-604.579] (-608.704) (-603.733) * (-603.265) [-603.537] (-607.834) (-604.014) -- 0:00:20
670000 -- [-602.636] (-604.791) (-604.609) (-603.054) * (-603.629) [-603.758] (-606.420) (-603.690) -- 0:00:20
Average standard deviation of split frequencies: 0.008435
670500 -- (-604.187) [-604.171] (-604.174) (-603.036) * (-604.935) (-605.100) (-607.225) [-602.677] -- 0:00:20
671000 -- (-605.494) (-607.809) (-605.125) [-604.455] * [-602.673] (-602.623) (-604.216) (-602.958) -- 0:00:20
671500 -- [-604.213] (-606.871) (-605.309) (-603.537) * (-602.683) (-603.981) (-603.769) [-603.396] -- 0:00:20
672000 -- (-604.140) (-604.045) (-603.977) [-602.352] * [-603.138] (-606.535) (-607.470) (-604.260) -- 0:00:20
672500 -- [-607.944] (-603.383) (-605.303) (-603.834) * (-603.366) (-604.306) (-605.286) [-602.952] -- 0:00:19
673000 -- (-605.494) (-603.828) (-604.082) [-602.484] * (-604.978) [-603.304] (-603.714) (-603.352) -- 0:00:19
673500 -- (-602.807) (-605.179) (-613.562) [-605.176] * (-604.375) [-602.083] (-603.170) (-604.764) -- 0:00:19
674000 -- (-606.632) (-606.326) [-605.284] (-603.856) * [-605.599] (-602.769) (-605.892) (-603.253) -- 0:00:19
674500 -- [-602.344] (-605.185) (-606.541) (-604.956) * (-603.533) (-602.819) [-605.093] (-603.553) -- 0:00:19
675000 -- (-603.786) (-605.157) (-602.884) [-604.980] * (-606.206) [-602.441] (-605.391) (-603.048) -- 0:00:19
Average standard deviation of split frequencies: 0.008461
675500 -- (-603.610) (-606.618) (-606.095) [-604.656] * [-603.003] (-602.558) (-606.001) (-602.738) -- 0:00:19
676000 -- (-603.289) (-603.720) [-602.701] (-602.378) * (-604.490) (-604.589) (-602.354) [-602.104] -- 0:00:19
676500 -- [-604.379] (-602.595) (-604.212) (-604.271) * [-603.088] (-603.957) (-601.796) (-610.006) -- 0:00:19
677000 -- (-603.141) (-603.523) (-604.213) [-604.115] * [-603.913] (-603.775) (-602.776) (-607.418) -- 0:00:19
677500 -- (-602.931) (-604.573) [-603.257] (-602.294) * (-605.492) (-603.250) (-605.223) [-606.180] -- 0:00:19
678000 -- (-604.759) (-605.120) (-603.355) [-603.076] * (-605.535) (-605.110) (-603.754) [-603.688] -- 0:00:19
678500 -- (-603.815) (-606.204) (-604.030) [-603.436] * (-604.325) (-601.891) (-606.743) [-605.799] -- 0:00:19
679000 -- (-603.636) [-604.200] (-603.260) (-606.279) * (-603.615) (-604.216) (-607.255) [-606.139] -- 0:00:19
679500 -- (-608.041) (-604.172) [-602.507] (-605.241) * [-604.735] (-604.630) (-603.572) (-606.086) -- 0:00:19
680000 -- (-604.585) (-605.340) (-604.664) [-605.498] * (-603.989) (-603.660) [-602.912] (-603.145) -- 0:00:19
Average standard deviation of split frequencies: 0.008726
680500 -- (-603.745) [-604.983] (-607.258) (-604.465) * [-603.150] (-602.522) (-607.660) (-603.847) -- 0:00:19
681000 -- [-603.191] (-603.423) (-605.337) (-604.931) * (-607.351) (-602.107) [-604.811] (-604.597) -- 0:00:19
681500 -- (-604.236) [-602.390] (-603.431) (-606.496) * (-609.467) (-602.890) (-606.760) [-602.212] -- 0:00:19
682000 -- (-603.794) [-605.661] (-603.445) (-603.721) * (-605.699) [-605.142] (-607.046) (-602.175) -- 0:00:19
682500 -- (-608.567) (-605.937) (-607.658) [-603.952] * [-604.690] (-604.861) (-602.661) (-603.665) -- 0:00:19
683000 -- (-611.407) [-605.299] (-606.120) (-604.967) * (-604.537) [-603.119] (-604.946) (-604.560) -- 0:00:19
683500 -- (-605.638) (-603.854) [-611.149] (-607.730) * (-603.740) (-605.245) (-605.377) [-604.612] -- 0:00:19
684000 -- [-605.231] (-602.516) (-602.856) (-603.068) * (-603.843) (-605.596) (-606.180) [-604.045] -- 0:00:19
684500 -- (-604.259) (-602.947) [-604.859] (-604.688) * (-602.876) (-603.723) [-603.907] (-604.312) -- 0:00:19
685000 -- (-603.348) (-604.752) [-605.702] (-610.943) * (-604.304) [-604.366] (-606.931) (-608.363) -- 0:00:19
Average standard deviation of split frequencies: 0.008842
685500 -- (-604.544) (-605.456) (-603.414) [-607.485] * [-602.530] (-604.917) (-604.770) (-603.704) -- 0:00:19
686000 -- (-604.046) (-602.901) (-603.870) [-604.136] * [-602.625] (-609.494) (-605.391) (-603.761) -- 0:00:19
686500 -- (-603.585) (-602.411) (-604.972) [-604.067] * [-603.396] (-609.442) (-604.059) (-602.380) -- 0:00:19
687000 -- (-606.598) (-603.836) (-603.050) [-602.372] * (-603.399) (-604.970) [-603.612] (-606.476) -- 0:00:19
687500 -- (-608.646) (-603.580) [-603.052] (-605.048) * (-603.384) [-604.894] (-603.963) (-605.064) -- 0:00:19
688000 -- [-606.738] (-603.574) (-603.039) (-604.023) * [-604.009] (-604.967) (-602.553) (-603.807) -- 0:00:19
688500 -- [-601.923] (-602.436) (-602.615) (-604.722) * (-603.342) (-604.908) (-605.741) [-605.852] -- 0:00:19
689000 -- [-602.476] (-604.782) (-603.684) (-605.279) * (-602.940) [-604.124] (-604.422) (-607.089) -- 0:00:18
689500 -- [-602.974] (-603.821) (-603.654) (-604.403) * [-603.359] (-610.193) (-607.263) (-604.596) -- 0:00:18
690000 -- (-605.366) [-603.525] (-604.517) (-602.257) * (-603.214) (-608.441) [-604.102] (-604.793) -- 0:00:18
Average standard deviation of split frequencies: 0.008691
690500 -- [-604.732] (-608.877) (-602.010) (-605.058) * [-602.621] (-606.339) (-603.600) (-605.386) -- 0:00:18
691000 -- (-602.972) (-608.334) (-603.718) [-604.639] * (-602.631) (-604.428) [-603.520] (-602.590) -- 0:00:18
691500 -- (-603.759) (-607.242) (-603.942) [-606.127] * (-606.770) [-602.373] (-603.719) (-604.268) -- 0:00:18
692000 -- (-605.272) [-604.087] (-607.174) (-605.776) * [-609.858] (-602.621) (-602.831) (-604.102) -- 0:00:18
692500 -- (-603.015) (-603.507) (-603.824) [-602.864] * (-609.530) [-602.647] (-606.660) (-603.417) -- 0:00:18
693000 -- (-602.871) (-609.172) [-606.422] (-604.876) * (-605.517) [-603.389] (-602.017) (-604.313) -- 0:00:18
693500 -- (-603.714) (-603.463) (-605.851) [-605.023] * (-603.335) (-609.089) [-602.329] (-607.077) -- 0:00:18
694000 -- (-603.493) [-603.958] (-605.534) (-603.767) * (-606.315) (-606.297) [-602.594] (-603.240) -- 0:00:18
694500 -- (-605.987) [-603.402] (-610.164) (-604.903) * (-606.731) (-605.037) (-603.839) [-606.100] -- 0:00:18
695000 -- (-602.921) [-603.437] (-605.681) (-607.138) * (-606.614) (-607.311) [-603.938] (-605.271) -- 0:00:18
Average standard deviation of split frequencies: 0.008940
695500 -- [-603.383] (-605.711) (-604.526) (-606.509) * (-603.832) (-607.061) (-604.632) [-604.586] -- 0:00:18
696000 -- [-603.213] (-607.881) (-602.625) (-602.716) * (-603.150) [-604.595] (-603.732) (-603.232) -- 0:00:18
696500 -- [-603.256] (-608.165) (-603.605) (-603.051) * (-607.640) [-603.775] (-603.921) (-603.448) -- 0:00:18
697000 -- [-602.624] (-605.554) (-605.199) (-604.065) * (-605.712) (-603.758) [-604.036] (-603.538) -- 0:00:18
697500 -- (-602.920) (-605.046) (-607.592) [-605.661] * (-605.362) [-602.394] (-603.437) (-604.429) -- 0:00:18
698000 -- (-606.948) [-602.505] (-604.877) (-608.432) * (-610.571) [-605.404] (-603.122) (-604.715) -- 0:00:18
698500 -- (-603.789) (-604.350) (-604.520) [-601.952] * [-603.334] (-602.787) (-604.812) (-603.264) -- 0:00:18
699000 -- (-605.163) (-607.127) (-607.541) [-604.437] * (-605.735) [-602.785] (-602.231) (-603.508) -- 0:00:18
699500 -- (-604.267) [-604.716] (-602.347) (-603.613) * (-607.149) (-604.891) (-601.873) [-602.293] -- 0:00:18
700000 -- (-604.748) [-601.891] (-604.224) (-603.026) * (-603.935) (-604.227) (-605.586) [-603.894] -- 0:00:18
Average standard deviation of split frequencies: 0.008971
700500 -- (-603.128) (-603.911) [-602.528] (-603.083) * (-604.641) (-603.013) (-602.672) [-606.017] -- 0:00:18
701000 -- (-604.571) (-602.950) [-602.610] (-604.179) * (-602.330) [-603.367] (-603.587) (-605.095) -- 0:00:18
701500 -- (-602.648) (-603.762) [-603.423] (-612.088) * (-605.357) (-602.993) [-602.886] (-604.174) -- 0:00:18
702000 -- [-602.903] (-608.098) (-603.710) (-607.733) * (-605.556) (-606.646) [-605.525] (-603.616) -- 0:00:18
702500 -- (-603.761) (-605.053) (-608.507) [-603.710] * (-603.826) (-602.824) [-602.826] (-602.486) -- 0:00:18
703000 -- (-607.177) [-603.581] (-602.718) (-602.311) * (-604.501) [-604.286] (-602.128) (-602.455) -- 0:00:18
703500 -- (-605.433) [-607.079] (-603.989) (-605.140) * (-603.919) (-603.564) (-605.404) [-607.135] -- 0:00:18
704000 -- [-603.645] (-603.473) (-603.432) (-602.429) * (-603.857) (-603.435) [-605.614] (-608.093) -- 0:00:18
704500 -- (-603.018) (-608.670) [-603.759] (-607.303) * (-603.505) [-602.431] (-605.337) (-606.756) -- 0:00:18
705000 -- (-603.656) (-606.591) (-602.283) [-605.309] * (-602.948) (-602.697) [-603.226] (-606.955) -- 0:00:17
Average standard deviation of split frequencies: 0.008903
705500 -- (-602.217) (-602.686) (-605.818) [-602.049] * (-603.568) [-603.138] (-602.209) (-603.546) -- 0:00:17
706000 -- (-603.011) (-603.097) [-603.376] (-604.897) * [-602.503] (-602.913) (-607.060) (-602.902) -- 0:00:17
706500 -- [-608.508] (-604.407) (-602.556) (-609.782) * (-605.446) (-604.322) (-608.429) [-602.929] -- 0:00:17
707000 -- (-606.587) (-602.877) (-602.534) [-603.794] * (-603.968) (-607.237) (-604.186) [-602.261] -- 0:00:17
707500 -- (-604.509) (-605.564) (-606.941) [-603.514] * (-603.696) [-605.325] (-602.970) (-603.518) -- 0:00:17
708000 -- (-604.657) (-606.307) (-605.960) [-603.754] * [-603.438] (-604.255) (-605.171) (-607.884) -- 0:00:17
708500 -- (-605.840) [-605.425] (-607.225) (-604.680) * (-606.479) (-603.926) (-604.114) [-602.409] -- 0:00:17
709000 -- (-610.615) [-606.324] (-606.170) (-603.637) * [-603.730] (-604.569) (-603.405) (-602.933) -- 0:00:17
709500 -- (-605.327) [-605.820] (-602.569) (-604.465) * [-602.613] (-605.348) (-604.578) (-604.173) -- 0:00:17
710000 -- (-605.525) (-607.608) [-602.141] (-604.720) * (-604.569) [-603.166] (-603.275) (-602.759) -- 0:00:17
Average standard deviation of split frequencies: 0.009021
710500 -- (-602.705) (-603.098) [-602.746] (-603.748) * (-609.250) (-608.237) [-602.179] (-602.497) -- 0:00:17
711000 -- (-606.491) (-604.927) (-603.266) [-602.318] * [-607.129] (-602.295) (-605.113) (-602.345) -- 0:00:17
711500 -- (-605.597) (-602.713) [-603.448] (-604.700) * (-602.402) (-603.406) (-605.123) [-602.713] -- 0:00:17
712000 -- (-603.092) (-606.972) (-603.814) [-604.756] * [-603.651] (-604.997) (-602.838) (-605.108) -- 0:00:17
712500 -- (-604.903) (-604.739) [-603.601] (-604.439) * [-602.369] (-603.726) (-604.525) (-605.977) -- 0:00:17
713000 -- (-606.020) [-603.012] (-603.669) (-602.468) * (-603.441) [-603.822] (-605.859) (-604.613) -- 0:00:17
713500 -- (-605.447) (-606.238) [-604.420] (-603.583) * (-604.458) (-606.939) [-603.042] (-606.936) -- 0:00:17
714000 -- (-606.741) (-604.887) (-607.684) [-603.401] * (-602.518) [-604.810] (-606.098) (-604.443) -- 0:00:17
714500 -- [-601.967] (-603.734) (-604.348) (-603.554) * (-604.383) [-604.302] (-603.889) (-603.292) -- 0:00:17
715000 -- (-607.738) [-604.901] (-605.223) (-604.187) * (-603.000) (-602.881) (-606.261) [-602.841] -- 0:00:17
Average standard deviation of split frequencies: 0.008971
715500 -- (-605.974) (-605.156) (-602.394) [-606.945] * (-604.097) (-604.807) (-604.767) [-603.663] -- 0:00:17
716000 -- (-605.310) (-605.393) [-603.724] (-607.235) * (-606.766) [-606.603] (-602.223) (-606.908) -- 0:00:17
716500 -- (-606.382) [-603.447] (-602.330) (-608.369) * (-604.138) (-603.016) (-602.886) [-606.674] -- 0:00:17
717000 -- (-608.371) (-604.559) [-603.055] (-603.341) * (-603.817) (-603.514) [-603.597] (-606.760) -- 0:00:17
717500 -- (-610.417) [-603.601] (-605.344) (-608.032) * [-603.593] (-604.391) (-602.245) (-604.389) -- 0:00:17
718000 -- (-605.734) [-604.749] (-604.648) (-605.612) * [-603.162] (-605.553) (-604.028) (-605.642) -- 0:00:17
718500 -- (-605.490) (-603.599) (-603.587) [-605.023] * (-601.952) (-602.662) [-605.289] (-603.613) -- 0:00:17
719000 -- (-606.059) (-606.478) (-611.247) [-602.801] * [-601.955] (-604.058) (-606.892) (-602.659) -- 0:00:17
719500 -- (-606.666) [-607.030] (-607.715) (-604.838) * (-601.878) [-603.664] (-605.568) (-601.990) -- 0:00:17
720000 -- (-606.673) (-606.948) (-603.572) [-603.820] * [-602.161] (-603.626) (-602.772) (-602.174) -- 0:00:17
Average standard deviation of split frequencies: 0.008619
720500 -- [-603.729] (-604.419) (-603.283) (-603.295) * (-602.458) [-606.317] (-602.867) (-602.411) -- 0:00:17
721000 -- (-603.546) (-605.326) [-606.339] (-602.677) * (-603.471) (-607.345) (-602.870) [-604.436] -- 0:00:17
721500 -- (-608.799) (-602.783) (-607.940) [-603.904] * (-602.721) (-605.547) [-604.425] (-603.458) -- 0:00:16
722000 -- (-610.514) [-608.083] (-603.659) (-603.153) * (-602.683) (-604.706) [-607.938] (-603.819) -- 0:00:16
722500 -- (-606.176) (-602.730) [-605.697] (-603.859) * (-609.730) (-604.740) [-602.982] (-603.097) -- 0:00:16
723000 -- (-602.801) [-602.755] (-604.879) (-608.803) * (-609.455) [-602.749] (-607.219) (-603.423) -- 0:00:16
723500 -- (-605.658) [-604.241] (-606.165) (-603.033) * (-605.992) (-604.700) [-605.423] (-603.748) -- 0:00:16
724000 -- (-605.684) (-602.835) (-603.540) [-602.467] * (-605.481) (-605.870) (-604.042) [-604.055] -- 0:00:16
724500 -- (-604.851) (-603.206) [-605.568] (-602.537) * (-605.629) [-604.479] (-603.449) (-605.593) -- 0:00:16
725000 -- (-608.942) [-607.008] (-605.289) (-603.731) * (-607.563) (-603.484) [-606.764] (-604.474) -- 0:00:16
Average standard deviation of split frequencies: 0.008594
725500 -- (-605.207) (-603.858) [-606.419] (-606.088) * (-608.382) [-604.831] (-602.593) (-604.188) -- 0:00:16
726000 -- [-603.180] (-603.489) (-604.276) (-605.726) * (-604.252) (-609.888) [-606.883] (-603.951) -- 0:00:16
726500 -- (-605.104) [-604.213] (-604.709) (-605.350) * (-604.126) (-604.926) (-603.947) [-604.552] -- 0:00:16
727000 -- [-604.319] (-606.773) (-607.733) (-608.867) * (-605.540) (-607.525) (-603.946) [-603.818] -- 0:00:16
727500 -- [-603.856] (-604.563) (-605.520) (-607.746) * (-602.314) [-603.665] (-603.630) (-606.056) -- 0:00:16
728000 -- (-604.722) (-606.958) [-603.865] (-605.236) * [-607.508] (-603.011) (-602.825) (-604.698) -- 0:00:16
728500 -- (-605.798) [-609.191] (-606.834) (-604.506) * (-604.262) (-603.276) (-602.944) [-605.247] -- 0:00:16
729000 -- (-603.757) (-607.599) [-602.852] (-605.427) * (-604.748) (-605.050) (-603.914) [-603.915] -- 0:00:16
729500 -- (-604.020) [-604.927] (-604.392) (-604.197) * [-603.583] (-608.279) (-603.547) (-604.754) -- 0:00:16
730000 -- (-604.908) [-607.993] (-607.253) (-604.168) * (-605.587) (-604.704) [-605.079] (-605.185) -- 0:00:16
Average standard deviation of split frequencies: 0.009153
730500 -- [-604.380] (-607.186) (-609.125) (-605.196) * (-601.869) (-604.499) [-604.126] (-604.286) -- 0:00:16
731000 -- (-605.999) [-604.953] (-607.239) (-604.808) * (-602.722) [-602.419] (-603.995) (-604.782) -- 0:00:16
731500 -- [-604.027] (-607.003) (-606.720) (-605.163) * (-602.039) [-602.676] (-604.045) (-605.210) -- 0:00:16
732000 -- [-603.686] (-607.613) (-606.153) (-604.386) * (-602.421) [-602.194] (-607.094) (-603.066) -- 0:00:16
732500 -- (-604.907) (-607.188) (-603.411) [-603.480] * (-603.448) (-608.464) (-605.142) [-605.384] -- 0:00:16
733000 -- (-604.744) (-604.400) (-606.325) [-603.302] * (-603.373) [-602.855] (-604.133) (-609.624) -- 0:00:16
733500 -- (-606.290) [-605.494] (-603.426) (-604.052) * [-603.165] (-604.674) (-604.847) (-605.247) -- 0:00:16
734000 -- (-603.185) [-602.615] (-603.391) (-605.172) * (-603.893) [-608.765] (-602.454) (-605.513) -- 0:00:16
734500 -- [-606.809] (-602.983) (-604.245) (-603.856) * [-604.791] (-610.191) (-604.416) (-602.644) -- 0:00:16
735000 -- (-604.966) (-603.124) [-602.941] (-602.876) * (-605.516) (-606.030) (-602.748) [-602.729] -- 0:00:16
Average standard deviation of split frequencies: 0.008967
735500 -- [-605.545] (-606.367) (-603.282) (-603.629) * (-605.990) (-605.287) (-603.741) [-602.836] -- 0:00:16
736000 -- (-608.277) [-603.602] (-603.613) (-604.482) * [-606.316] (-603.000) (-605.787) (-603.644) -- 0:00:16
736500 -- (-604.699) [-603.993] (-603.605) (-603.777) * (-604.743) [-606.062] (-605.767) (-607.505) -- 0:00:16
737000 -- (-604.634) (-603.060) [-606.959] (-603.922) * (-606.362) (-606.957) (-608.035) [-606.449] -- 0:00:16
737500 -- (-603.239) [-606.060] (-608.633) (-609.529) * (-604.948) (-608.956) (-602.988) [-603.002] -- 0:00:16
738000 -- [-602.662] (-606.696) (-605.511) (-602.598) * (-604.529) (-603.666) [-603.315] (-603.195) -- 0:00:15
738500 -- [-602.849] (-605.990) (-604.244) (-603.128) * (-603.249) [-602.901] (-603.340) (-603.793) -- 0:00:15
739000 -- (-605.669) (-603.412) [-606.232] (-604.816) * (-607.776) (-603.569) [-603.341] (-608.484) -- 0:00:15
739500 -- (-603.034) (-605.680) [-604.098] (-604.795) * [-602.785] (-602.781) (-605.764) (-604.925) -- 0:00:15
740000 -- [-606.328] (-605.062) (-610.124) (-607.600) * (-604.584) [-603.788] (-604.358) (-605.322) -- 0:00:15
Average standard deviation of split frequencies: 0.008712
740500 -- [-605.785] (-605.039) (-607.035) (-608.515) * (-605.342) (-605.922) [-602.503] (-605.308) -- 0:00:15
741000 -- (-602.690) [-602.578] (-606.788) (-613.410) * (-604.250) [-603.238] (-610.327) (-604.989) -- 0:00:15
741500 -- [-603.366] (-604.318) (-608.692) (-605.221) * [-601.861] (-604.075) (-606.378) (-605.759) -- 0:00:15
742000 -- [-603.299] (-603.664) (-602.383) (-605.384) * (-601.961) (-602.383) [-604.404] (-605.969) -- 0:00:15
742500 -- (-603.046) [-603.485] (-605.405) (-603.084) * (-603.941) [-602.844] (-604.126) (-606.973) -- 0:00:15
743000 -- (-604.826) (-605.196) (-604.248) [-603.760] * (-603.705) (-603.486) (-603.281) [-603.875] -- 0:00:15
743500 -- (-603.564) (-604.330) [-603.871] (-605.113) * [-602.558] (-603.612) (-603.006) (-605.197) -- 0:00:15
744000 -- (-604.894) (-603.793) [-605.596] (-604.297) * [-606.319] (-602.844) (-604.039) (-604.219) -- 0:00:15
744500 -- (-603.744) (-604.581) (-604.496) [-602.951] * (-605.121) (-604.948) [-603.211] (-609.039) -- 0:00:15
745000 -- [-602.176] (-609.053) (-603.511) (-607.695) * (-604.932) (-607.076) [-603.685] (-602.205) -- 0:00:15
Average standard deviation of split frequencies: 0.008531
745500 -- (-609.718) (-603.990) [-603.630] (-603.701) * (-607.348) [-603.363] (-605.211) (-610.409) -- 0:00:15
746000 -- (-606.652) (-603.663) [-603.244] (-605.618) * [-603.270] (-604.285) (-608.406) (-604.857) -- 0:00:15
746500 -- (-607.602) [-602.827] (-602.801) (-602.626) * (-604.802) (-602.733) [-603.776] (-606.225) -- 0:00:15
747000 -- (-603.975) [-605.027] (-602.945) (-602.339) * (-604.718) (-608.199) [-604.693] (-602.645) -- 0:00:15
747500 -- (-603.468) (-606.212) (-603.449) [-602.574] * (-606.769) (-602.493) (-603.611) [-603.989] -- 0:00:15
748000 -- (-606.901) [-602.640] (-603.902) (-603.141) * (-605.702) (-605.241) (-605.354) [-603.654] -- 0:00:15
748500 -- [-604.104] (-602.633) (-606.900) (-602.880) * [-606.220] (-606.117) (-608.217) (-607.941) -- 0:00:15
749000 -- (-605.766) [-605.626] (-604.415) (-603.587) * (-606.710) [-604.745] (-607.419) (-604.798) -- 0:00:15
749500 -- (-604.909) (-603.460) (-603.562) [-605.024] * (-604.815) (-605.031) [-603.309] (-607.228) -- 0:00:15
750000 -- (-607.889) (-604.225) [-603.863] (-603.491) * (-605.572) [-603.133] (-604.722) (-606.192) -- 0:00:15
Average standard deviation of split frequencies: 0.008831
750500 -- (-607.122) (-603.080) (-605.328) [-604.527] * (-608.429) (-608.123) (-603.419) [-604.516] -- 0:00:15
751000 -- (-604.275) (-602.951) [-603.602] (-606.065) * (-607.758) (-605.800) [-602.295] (-606.178) -- 0:00:15
751500 -- [-604.651] (-604.744) (-603.368) (-604.929) * (-607.412) (-602.066) [-602.467] (-604.307) -- 0:00:15
752000 -- (-603.556) (-604.023) [-604.353] (-605.049) * (-603.760) (-602.411) [-602.853] (-606.501) -- 0:00:15
752500 -- (-605.280) [-605.028] (-603.976) (-611.815) * (-602.416) [-602.535] (-606.955) (-607.952) -- 0:00:15
753000 -- (-606.542) (-603.773) [-602.096] (-606.391) * (-605.040) (-603.701) [-606.738] (-608.979) -- 0:00:15
753500 -- [-604.783] (-605.315) (-603.783) (-605.821) * (-603.292) (-602.175) (-603.278) [-606.055] -- 0:00:15
754000 -- (-602.518) [-611.462] (-607.079) (-607.256) * (-604.673) [-602.134] (-605.132) (-604.315) -- 0:00:15
754500 -- [-602.112] (-606.974) (-603.648) (-606.442) * (-606.593) [-602.615] (-606.277) (-605.553) -- 0:00:14
755000 -- (-602.856) (-607.617) [-606.429] (-606.285) * (-603.752) [-603.306] (-606.943) (-604.220) -- 0:00:14
Average standard deviation of split frequencies: 0.008535
755500 -- (-603.467) (-603.249) [-604.349] (-605.401) * (-605.474) (-606.083) (-603.930) [-602.833] -- 0:00:14
756000 -- [-605.819] (-602.526) (-607.204) (-603.257) * (-606.667) (-607.287) (-604.304) [-603.002] -- 0:00:14
756500 -- (-608.529) (-602.921) (-603.970) [-604.545] * (-603.811) [-603.344] (-604.947) (-604.740) -- 0:00:14
757000 -- [-602.391] (-606.151) (-603.190) (-602.823) * (-605.715) (-602.927) (-603.384) [-602.674] -- 0:00:14
757500 -- (-602.981) (-602.054) [-602.636] (-603.695) * [-605.350] (-603.283) (-604.382) (-602.672) -- 0:00:14
758000 -- [-602.684] (-603.414) (-604.767) (-605.669) * (-603.476) (-606.671) (-604.856) [-603.221] -- 0:00:14
758500 -- (-603.195) [-604.265] (-610.333) (-605.686) * [-604.905] (-603.791) (-606.353) (-606.465) -- 0:00:14
759000 -- (-602.351) [-605.254] (-602.779) (-609.577) * (-605.782) (-604.223) (-606.198) [-608.221] -- 0:00:14
759500 -- [-602.356] (-603.309) (-602.180) (-603.834) * (-602.843) [-604.734] (-604.016) (-603.313) -- 0:00:14
760000 -- (-607.288) (-604.405) [-601.936] (-604.824) * (-604.374) [-605.192] (-606.621) (-603.275) -- 0:00:14
Average standard deviation of split frequencies: 0.008986
760500 -- (-604.349) (-605.638) (-603.927) [-603.096] * (-603.485) (-604.789) [-602.880] (-603.759) -- 0:00:14
761000 -- (-603.810) (-606.667) (-601.853) [-606.871] * [-607.025] (-607.082) (-602.934) (-606.368) -- 0:00:14
761500 -- (-603.669) (-606.817) (-602.136) [-604.912] * (-603.216) (-604.868) [-605.135] (-602.963) -- 0:00:14
762000 -- (-602.956) (-604.997) (-604.729) [-604.964] * (-602.925) [-606.307] (-604.590) (-602.142) -- 0:00:14
762500 -- [-605.589] (-605.887) (-604.399) (-604.145) * (-606.857) (-604.999) [-602.660] (-602.177) -- 0:00:14
763000 -- [-606.515] (-612.825) (-602.136) (-603.445) * (-606.940) [-606.643] (-605.202) (-608.663) -- 0:00:14
763500 -- (-603.374) (-603.573) [-601.859] (-602.634) * [-605.568] (-611.190) (-609.167) (-602.636) -- 0:00:14
764000 -- (-603.967) [-605.460] (-603.560) (-603.624) * (-602.860) [-602.346] (-605.610) (-603.110) -- 0:00:14
764500 -- (-605.973) (-605.010) [-605.755] (-603.002) * (-603.049) [-602.213] (-608.112) (-605.913) -- 0:00:14
765000 -- (-604.832) [-603.167] (-602.661) (-606.897) * (-603.843) (-604.714) (-605.674) [-604.084] -- 0:00:14
Average standard deviation of split frequencies: 0.009539
765500 -- (-604.431) (-603.489) [-604.015] (-606.343) * [-603.534] (-603.623) (-604.926) (-604.129) -- 0:00:14
766000 -- (-603.642) [-602.841] (-603.907) (-605.644) * [-606.862] (-605.861) (-602.564) (-602.922) -- 0:00:14
766500 -- (-605.031) (-604.948) (-604.364) [-606.220] * (-609.899) (-606.881) [-603.122] (-605.756) -- 0:00:14
767000 -- (-602.771) (-610.061) [-604.187] (-603.364) * (-603.615) (-604.043) [-606.597] (-604.389) -- 0:00:14
767500 -- (-604.494) (-607.903) (-604.716) [-606.356] * [-602.384] (-605.558) (-605.712) (-603.897) -- 0:00:14
768000 -- (-602.784) [-604.636] (-603.663) (-604.293) * [-602.466] (-603.227) (-606.724) (-603.616) -- 0:00:14
768500 -- (-603.362) (-603.408) (-603.307) [-606.509] * (-602.630) [-605.307] (-605.340) (-603.860) -- 0:00:14
769000 -- (-604.910) (-605.876) [-602.342] (-608.182) * (-603.227) [-604.511] (-605.710) (-603.310) -- 0:00:14
769500 -- (-608.750) (-603.994) [-603.201] (-604.420) * (-603.042) (-606.763) (-604.658) [-603.780] -- 0:00:14
770000 -- (-611.867) [-604.975] (-601.998) (-605.249) * [-603.110] (-605.728) (-602.482) (-607.548) -- 0:00:14
Average standard deviation of split frequencies: 0.009443
770500 -- [-608.447] (-605.517) (-604.533) (-606.636) * [-606.069] (-605.926) (-605.358) (-604.940) -- 0:00:13
771000 -- (-605.872) (-603.370) [-602.987] (-608.935) * (-604.096) (-603.073) [-607.828] (-604.230) -- 0:00:13
771500 -- (-608.639) [-604.237] (-602.800) (-609.771) * (-609.127) [-604.158] (-604.169) (-605.278) -- 0:00:13
772000 -- [-603.406] (-604.742) (-604.550) (-603.397) * [-603.858] (-603.202) (-603.928) (-603.307) -- 0:00:13
772500 -- (-605.765) [-603.363] (-604.637) (-607.928) * (-602.881) (-607.519) (-602.809) [-602.902] -- 0:00:13
773000 -- (-604.253) (-604.166) [-604.586] (-605.502) * [-607.016] (-603.811) (-602.766) (-604.492) -- 0:00:13
773500 -- [-605.151] (-604.802) (-604.342) (-604.126) * (-603.239) (-603.177) (-606.616) [-607.087] -- 0:00:13
774000 -- (-604.320) [-604.304] (-604.906) (-604.133) * (-605.372) (-603.320) [-605.435] (-605.312) -- 0:00:13
774500 -- (-604.180) (-605.178) [-602.938] (-603.312) * (-602.944) (-604.125) [-605.149] (-605.750) -- 0:00:13
775000 -- (-609.537) (-603.393) [-604.700] (-602.923) * (-604.860) (-603.500) (-606.125) [-604.191] -- 0:00:13
Average standard deviation of split frequencies: 0.009454
775500 -- (-604.880) (-606.888) (-602.581) [-602.944] * [-605.203] (-603.686) (-605.025) (-605.347) -- 0:00:13
776000 -- (-602.449) (-609.537) (-604.468) [-603.431] * (-603.368) [-603.718] (-604.944) (-602.987) -- 0:00:13
776500 -- (-603.295) (-606.556) (-605.286) [-605.886] * (-603.859) (-605.433) (-603.481) [-604.058] -- 0:00:13
777000 -- (-608.460) (-604.779) (-604.024) [-604.432] * (-605.180) (-606.037) [-604.768] (-604.344) -- 0:00:13
777500 -- (-603.398) [-605.747] (-603.010) (-604.402) * (-602.787) (-605.129) (-606.835) [-605.643] -- 0:00:13
778000 -- [-605.287] (-605.424) (-601.976) (-602.564) * (-604.190) (-604.378) (-605.947) [-602.914] -- 0:00:13
778500 -- (-604.805) (-602.420) (-604.540) [-602.682] * (-604.331) (-604.826) [-607.598] (-603.063) -- 0:00:13
779000 -- (-602.875) (-603.066) (-603.022) [-602.996] * (-606.933) [-607.266] (-606.049) (-603.063) -- 0:00:13
779500 -- (-608.545) [-604.865] (-603.778) (-608.480) * (-606.848) (-604.737) (-602.330) [-602.662] -- 0:00:13
780000 -- (-603.205) [-603.150] (-604.678) (-603.567) * (-602.836) (-606.581) (-604.656) [-605.324] -- 0:00:13
Average standard deviation of split frequencies: 0.009095
780500 -- (-604.806) (-606.212) [-605.930] (-603.522) * [-604.663] (-604.544) (-604.212) (-605.998) -- 0:00:13
781000 -- (-609.294) (-604.852) [-603.722] (-606.247) * (-605.985) (-603.241) (-604.891) [-603.925] -- 0:00:13
781500 -- (-603.611) (-604.325) (-604.396) [-603.898] * (-604.090) (-603.807) (-606.341) [-603.272] -- 0:00:13
782000 -- (-603.516) (-603.658) [-604.842] (-605.285) * (-606.380) (-605.129) (-604.000) [-601.782] -- 0:00:13
782500 -- [-604.676] (-603.127) (-605.261) (-604.801) * (-604.291) (-605.211) [-609.196] (-603.937) -- 0:00:13
783000 -- [-604.788] (-603.302) (-605.816) (-604.182) * [-604.366] (-605.252) (-607.155) (-603.415) -- 0:00:13
783500 -- (-602.621) (-603.234) [-606.551] (-609.176) * (-603.297) (-608.196) (-605.176) [-603.636] -- 0:00:13
784000 -- (-603.816) (-602.904) [-604.799] (-604.812) * [-604.454] (-603.148) (-607.429) (-603.635) -- 0:00:13
784500 -- (-601.843) (-602.826) (-604.459) [-606.166] * (-605.876) (-605.019) [-603.415] (-605.803) -- 0:00:13
785000 -- [-602.798] (-606.934) (-605.304) (-607.262) * (-606.664) (-605.526) [-607.037] (-609.952) -- 0:00:13
Average standard deviation of split frequencies: 0.009259
785500 -- (-604.867) [-604.003] (-610.093) (-603.124) * [-605.723] (-604.617) (-602.461) (-610.407) -- 0:00:13
786000 -- [-602.856] (-602.780) (-606.099) (-603.393) * (-604.676) (-602.707) (-602.349) [-602.958] -- 0:00:13
786500 -- [-604.772] (-603.716) (-609.943) (-604.277) * [-604.804] (-603.895) (-605.512) (-604.141) -- 0:00:13
787000 -- (-603.085) [-604.542] (-605.173) (-607.247) * (-606.854) [-603.582] (-607.183) (-604.901) -- 0:00:12
787500 -- (-604.802) [-604.274] (-608.318) (-606.753) * (-606.910) (-603.276) (-606.862) [-609.807] -- 0:00:12
788000 -- (-605.256) [-603.639] (-603.659) (-607.528) * (-609.564) [-602.737] (-604.140) (-607.626) -- 0:00:12
788500 -- (-609.221) [-607.714] (-602.453) (-610.077) * (-602.200) (-602.327) (-607.017) [-602.759] -- 0:00:12
789000 -- [-604.835] (-604.047) (-603.132) (-610.593) * (-606.231) (-604.471) (-608.840) [-606.472] -- 0:00:12
789500 -- [-605.394] (-602.884) (-602.680) (-606.840) * (-607.456) (-603.509) [-604.040] (-607.245) -- 0:00:12
790000 -- [-604.419] (-602.993) (-605.607) (-607.731) * (-603.459) (-604.303) [-605.174] (-609.291) -- 0:00:12
Average standard deviation of split frequencies: 0.008869
790500 -- (-602.283) (-603.036) (-605.763) [-607.108] * (-609.398) (-607.510) (-602.723) [-605.932] -- 0:00:12
791000 -- [-602.807] (-602.399) (-605.243) (-605.878) * (-604.656) (-602.721) (-604.754) [-604.186] -- 0:00:12
791500 -- (-604.467) [-605.252] (-604.838) (-602.331) * (-604.619) [-605.781] (-604.830) (-607.050) -- 0:00:12
792000 -- [-602.675] (-603.956) (-602.749) (-603.702) * (-603.728) [-601.968] (-608.911) (-605.521) -- 0:00:12
792500 -- (-605.349) [-605.078] (-606.015) (-603.363) * (-611.151) [-604.170] (-604.615) (-608.819) -- 0:00:12
793000 -- (-609.522) (-604.673) [-605.042] (-603.874) * (-602.538) (-602.795) [-603.000] (-602.201) -- 0:00:12
793500 -- (-608.948) (-606.852) (-605.551) [-602.308] * [-603.720] (-607.517) (-602.660) (-603.862) -- 0:00:12
794000 -- [-603.252] (-610.375) (-606.926) (-603.790) * [-605.387] (-603.084) (-602.932) (-603.558) -- 0:00:12
794500 -- (-603.267) (-604.877) [-606.446] (-602.470) * (-604.597) [-602.113] (-608.145) (-604.033) -- 0:00:12
795000 -- [-603.565] (-604.087) (-603.263) (-605.167) * (-605.106) (-602.837) [-603.083] (-604.250) -- 0:00:12
Average standard deviation of split frequencies: 0.008661
795500 -- [-608.947] (-605.405) (-605.345) (-604.072) * (-604.579) (-605.989) (-603.058) [-603.135] -- 0:00:12
796000 -- (-606.712) (-602.603) [-603.954] (-604.500) * [-602.548] (-605.556) (-603.049) (-605.581) -- 0:00:12
796500 -- (-602.347) (-602.284) (-601.971) [-604.853] * [-602.790] (-605.784) (-603.935) (-603.320) -- 0:00:12
797000 -- (-602.303) (-602.471) (-603.008) [-607.414] * (-606.074) (-603.717) [-607.000] (-603.147) -- 0:00:12
797500 -- [-602.546] (-605.109) (-603.899) (-603.275) * (-604.437) (-603.113) (-608.024) [-602.647] -- 0:00:12
798000 -- (-602.322) (-602.555) [-602.380] (-606.296) * (-605.793) [-603.206] (-604.116) (-602.749) -- 0:00:12
798500 -- (-603.154) (-606.997) (-604.931) [-607.479] * [-602.505] (-603.285) (-604.544) (-603.696) -- 0:00:12
799000 -- (-602.614) (-605.403) (-603.793) [-602.475] * (-604.975) [-602.573] (-606.218) (-604.903) -- 0:00:12
799500 -- [-603.054] (-603.801) (-603.198) (-603.714) * (-604.337) (-604.673) [-602.612] (-604.233) -- 0:00:12
800000 -- [-603.414] (-602.869) (-603.468) (-604.170) * (-604.758) (-603.176) [-603.409] (-602.267) -- 0:00:12
Average standard deviation of split frequencies: 0.008280
800500 -- [-605.598] (-605.613) (-604.668) (-603.802) * [-606.310] (-603.232) (-608.215) (-601.844) -- 0:00:12
801000 -- (-603.490) (-604.781) [-603.436] (-604.035) * (-604.723) [-603.188] (-609.274) (-603.336) -- 0:00:12
801500 -- [-606.463] (-602.860) (-602.166) (-603.307) * (-603.592) [-604.249] (-602.374) (-606.407) -- 0:00:12
802000 -- (-608.799) (-602.417) (-603.203) [-603.197] * [-602.503] (-603.871) (-605.013) (-606.953) -- 0:00:12
802500 -- (-609.887) (-601.994) [-604.361] (-603.414) * (-601.847) (-606.768) [-602.594] (-603.627) -- 0:00:12
803000 -- (-604.859) [-601.932] (-603.892) (-606.484) * [-603.351] (-607.778) (-605.277) (-603.492) -- 0:00:12
803500 -- (-603.151) (-605.245) [-605.307] (-610.901) * [-602.669] (-603.450) (-604.410) (-603.352) -- 0:00:11
804000 -- (-605.214) [-603.484] (-606.075) (-606.338) * (-602.694) [-605.698] (-605.339) (-605.684) -- 0:00:11
804500 -- (-602.505) [-603.218] (-608.261) (-606.979) * (-603.204) (-603.031) [-605.446] (-604.557) -- 0:00:11
805000 -- [-602.550] (-604.007) (-603.645) (-608.173) * (-604.747) (-607.518) (-604.065) [-606.140] -- 0:00:11
Average standard deviation of split frequencies: 0.008334
805500 -- (-602.361) (-603.267) [-602.233] (-602.291) * [-603.922] (-606.032) (-606.029) (-604.466) -- 0:00:11
806000 -- (-604.361) (-603.753) (-604.546) [-602.735] * (-606.664) (-609.255) (-604.878) [-603.574] -- 0:00:11
806500 -- (-604.153) (-605.015) [-603.535] (-602.560) * (-611.461) (-606.032) [-602.804] (-602.739) -- 0:00:11
807000 -- (-603.270) (-604.671) (-603.790) [-602.903] * (-606.197) (-604.814) [-603.817] (-606.360) -- 0:00:11
807500 -- (-606.002) (-602.457) (-606.871) [-602.862] * (-603.268) (-603.791) (-603.197) [-607.368] -- 0:00:11
808000 -- (-603.854) (-602.065) [-604.433] (-612.985) * (-605.063) (-605.516) (-603.232) [-605.234] -- 0:00:11
808500 -- (-605.522) [-602.099] (-602.920) (-607.401) * (-605.113) (-604.181) (-606.717) [-606.270] -- 0:00:11
809000 -- (-602.802) [-604.040] (-606.143) (-605.786) * [-608.391] (-605.504) (-605.040) (-605.668) -- 0:00:11
809500 -- (-601.963) (-602.397) [-607.084] (-603.507) * (-606.282) (-602.742) (-602.897) [-602.879] -- 0:00:11
810000 -- [-602.356] (-603.305) (-606.830) (-607.216) * (-604.668) (-605.444) [-602.864] (-603.154) -- 0:00:11
Average standard deviation of split frequencies: 0.007996
810500 -- (-605.297) (-602.820) [-602.748] (-603.866) * (-604.600) [-604.511] (-604.261) (-604.664) -- 0:00:11
811000 -- (-609.266) [-602.699] (-602.999) (-603.148) * (-603.623) (-604.195) (-604.875) [-602.279] -- 0:00:11
811500 -- (-602.530) [-603.254] (-604.422) (-604.487) * (-604.751) [-603.211] (-604.229) (-603.677) -- 0:00:11
812000 -- (-602.282) (-605.169) (-603.501) [-603.634] * (-603.411) [-601.773] (-604.301) (-604.674) -- 0:00:11
812500 -- (-602.485) (-603.414) [-609.866] (-606.694) * (-603.867) (-601.754) [-602.270] (-604.624) -- 0:00:11
813000 -- (-603.032) (-603.104) (-608.622) [-605.278] * [-603.522] (-603.623) (-605.327) (-604.933) -- 0:00:11
813500 -- (-604.350) (-606.375) [-607.512] (-603.221) * (-604.324) [-604.711] (-605.356) (-604.962) -- 0:00:11
814000 -- (-603.676) (-608.095) (-603.150) [-605.218] * (-602.890) (-602.773) (-605.021) [-605.937] -- 0:00:11
814500 -- (-604.881) (-603.693) [-602.823] (-606.735) * (-604.264) (-605.009) (-603.958) [-605.024] -- 0:00:11
815000 -- (-605.341) (-605.143) [-603.322] (-607.107) * (-605.240) (-603.195) [-603.388] (-604.122) -- 0:00:11
Average standard deviation of split frequencies: 0.008088
815500 -- [-604.492] (-603.268) (-606.680) (-607.689) * (-604.832) [-603.045] (-603.446) (-602.870) -- 0:00:11
816000 -- (-605.445) (-604.493) (-604.657) [-607.398] * (-605.180) (-607.469) (-603.039) [-603.499] -- 0:00:11
816500 -- [-605.330] (-607.716) (-605.349) (-601.800) * (-606.079) (-607.361) (-604.876) [-603.627] -- 0:00:11
817000 -- (-603.766) (-604.149) [-607.117] (-602.367) * (-604.000) (-606.022) (-604.502) [-603.367] -- 0:00:11
817500 -- (-604.927) [-603.144] (-609.277) (-604.294) * (-606.563) (-603.580) [-602.436] (-604.655) -- 0:00:11
818000 -- (-606.870) [-602.787] (-606.066) (-605.283) * (-601.956) [-602.053] (-603.865) (-604.058) -- 0:00:11
818500 -- (-603.829) [-607.617] (-605.406) (-603.440) * (-603.465) [-604.069] (-606.698) (-605.274) -- 0:00:11
819000 -- (-604.628) (-606.386) [-602.530] (-603.462) * (-603.670) (-604.374) [-604.303] (-603.892) -- 0:00:11
819500 -- (-605.419) (-602.356) [-604.428] (-603.441) * [-602.110] (-602.578) (-603.521) (-602.378) -- 0:00:11
820000 -- (-604.985) [-602.753] (-604.035) (-607.634) * [-602.541] (-606.078) (-604.652) (-604.022) -- 0:00:10
Average standard deviation of split frequencies: 0.008006
820500 -- (-604.936) (-602.648) [-603.452] (-607.417) * (-606.149) (-603.301) [-602.995] (-604.915) -- 0:00:10
821000 -- (-604.155) (-604.869) (-604.941) [-602.071] * (-602.985) [-603.205] (-602.260) (-607.210) -- 0:00:10
821500 -- (-607.367) (-605.124) (-603.705) [-603.064] * (-603.826) [-602.491] (-603.719) (-603.890) -- 0:00:10
822000 -- (-604.494) [-604.130] (-606.321) (-604.443) * (-605.357) [-602.636] (-604.875) (-603.079) -- 0:00:10
822500 -- [-603.159] (-605.906) (-604.027) (-604.270) * (-604.988) (-606.401) [-603.167] (-605.679) -- 0:00:10
823000 -- (-609.819) [-603.687] (-608.378) (-603.466) * (-604.915) (-603.539) [-604.956] (-603.610) -- 0:00:10
823500 -- [-604.281] (-605.305) (-608.921) (-606.476) * (-602.829) (-603.170) (-603.922) [-603.706] -- 0:00:10
824000 -- (-609.165) (-609.561) (-606.636) [-603.237] * (-602.729) (-602.880) [-602.805] (-606.487) -- 0:00:10
824500 -- (-603.084) [-604.237] (-602.924) (-603.926) * (-602.070) (-604.173) [-603.000] (-602.918) -- 0:00:10
825000 -- (-604.683) [-603.339] (-603.931) (-602.778) * (-602.228) (-606.968) (-606.972) [-605.515] -- 0:00:10
Average standard deviation of split frequencies: 0.007883
825500 -- (-605.485) (-603.032) [-603.894] (-604.949) * (-604.429) (-604.513) (-609.862) [-602.698] -- 0:00:10
826000 -- [-604.014] (-603.285) (-605.599) (-605.999) * (-605.927) (-611.477) (-603.962) [-602.822] -- 0:00:10
826500 -- [-603.624] (-603.608) (-604.501) (-603.165) * (-606.581) (-607.094) (-603.425) [-605.092] -- 0:00:10
827000 -- [-602.551] (-605.185) (-605.087) (-608.229) * [-604.680] (-605.997) (-603.896) (-604.291) -- 0:00:10
827500 -- [-604.257] (-602.624) (-604.764) (-604.651) * (-605.126) (-610.987) (-607.404) [-604.390] -- 0:00:10
828000 -- (-602.096) [-604.859] (-603.398) (-602.503) * (-602.560) (-603.429) (-605.792) [-604.545] -- 0:00:10
828500 -- [-602.395] (-604.316) (-602.255) (-604.577) * (-605.288) (-607.911) [-604.385] (-603.605) -- 0:00:10
829000 -- [-602.388] (-605.885) (-603.156) (-605.668) * (-606.270) (-605.595) (-604.671) [-603.010] -- 0:00:10
829500 -- (-605.143) (-604.327) (-605.337) [-603.351] * [-602.454] (-604.742) (-602.235) (-603.305) -- 0:00:10
830000 -- [-604.209] (-603.749) (-603.363) (-606.804) * (-603.647) (-605.939) [-605.576] (-604.385) -- 0:00:10
Average standard deviation of split frequencies: 0.007378
830500 -- [-603.777] (-603.849) (-606.068) (-604.742) * (-607.237) (-601.896) [-604.930] (-605.347) -- 0:00:10
831000 -- (-603.864) [-604.573] (-603.646) (-603.457) * (-604.174) [-603.127] (-605.009) (-604.257) -- 0:00:10
831500 -- (-606.736) (-603.925) (-605.470) [-605.349] * (-602.431) [-603.463] (-604.709) (-604.134) -- 0:00:10
832000 -- (-602.491) [-611.795] (-603.840) (-605.377) * (-602.655) (-603.195) [-602.939] (-604.238) -- 0:00:10
832500 -- (-603.603) (-603.033) (-603.719) [-604.527] * (-603.193) [-603.805] (-604.414) (-602.339) -- 0:00:10
833000 -- [-602.259] (-603.611) (-607.130) (-607.223) * (-602.764) (-603.722) [-604.063] (-602.360) -- 0:00:10
833500 -- (-607.991) [-603.476] (-604.375) (-604.501) * (-606.181) [-603.075] (-603.326) (-606.002) -- 0:00:10
834000 -- [-605.857] (-606.828) (-603.253) (-602.418) * (-606.497) [-603.208] (-608.188) (-603.578) -- 0:00:10
834500 -- (-604.020) (-602.698) (-603.292) [-602.672] * (-605.488) (-602.850) [-602.949] (-603.735) -- 0:00:10
835000 -- (-602.592) (-602.554) (-603.556) [-604.921] * (-603.988) (-607.602) (-605.139) [-603.600] -- 0:00:10
Average standard deviation of split frequencies: 0.007401
835500 -- [-602.379] (-603.497) (-603.626) (-603.413) * [-604.330] (-606.729) (-604.222) (-602.699) -- 0:00:10
836000 -- (-602.325) (-602.834) [-604.012] (-603.457) * (-602.667) (-603.935) (-604.764) [-603.580] -- 0:00:10
836500 -- (-603.333) (-602.655) [-602.879] (-605.126) * [-601.991] (-607.921) (-606.063) (-602.714) -- 0:00:09
837000 -- (-603.317) [-602.145] (-603.970) (-603.582) * (-606.916) [-603.639] (-603.809) (-603.598) -- 0:00:09
837500 -- [-602.612] (-604.792) (-610.944) (-604.441) * (-603.867) [-602.309] (-602.462) (-605.603) -- 0:00:09
838000 -- (-603.765) [-603.537] (-602.765) (-602.622) * (-602.926) [-602.421] (-602.298) (-605.263) -- 0:00:09
838500 -- (-603.672) [-602.816] (-602.617) (-602.437) * (-606.315) (-603.295) (-605.502) [-602.813] -- 0:00:09
839000 -- (-603.022) (-604.913) [-603.537] (-604.687) * (-607.229) (-602.627) (-603.421) [-602.512] -- 0:00:09
839500 -- (-603.028) (-606.446) [-603.939] (-604.464) * (-602.295) (-604.249) [-605.301] (-603.537) -- 0:00:09
840000 -- (-604.991) (-607.407) [-604.724] (-602.706) * (-603.728) (-602.608) [-604.827] (-603.403) -- 0:00:09
Average standard deviation of split frequencies: 0.007535
840500 -- (-606.312) [-602.189] (-605.237) (-602.877) * (-604.498) (-604.847) [-602.642] (-606.121) -- 0:00:09
841000 -- (-605.481) (-603.161) (-602.872) [-605.963] * [-604.435] (-605.440) (-604.147) (-602.969) -- 0:00:09
841500 -- (-605.643) (-604.385) [-607.184] (-603.252) * (-603.328) (-609.734) (-602.925) [-604.445] -- 0:00:09
842000 -- (-607.098) [-602.977] (-605.711) (-604.492) * [-603.145] (-602.122) (-605.837) (-604.227) -- 0:00:09
842500 -- [-604.123] (-604.254) (-604.996) (-603.481) * (-605.367) (-604.869) [-604.602] (-603.758) -- 0:00:09
843000 -- [-602.932] (-605.892) (-602.260) (-607.862) * (-601.924) [-604.837] (-605.737) (-602.586) -- 0:00:09
843500 -- (-605.580) (-606.091) (-604.294) [-602.531] * (-604.424) (-606.829) [-604.816] (-603.020) -- 0:00:09
844000 -- (-604.167) (-605.127) (-604.921) [-603.337] * (-603.499) (-604.703) [-602.945] (-603.166) -- 0:00:09
844500 -- (-602.677) (-602.998) [-604.313] (-604.329) * [-602.726] (-605.323) (-603.603) (-609.613) -- 0:00:09
845000 -- [-602.612] (-602.694) (-604.047) (-606.957) * (-603.072) (-606.168) [-602.312] (-605.133) -- 0:00:09
Average standard deviation of split frequencies: 0.007940
845500 -- (-605.522) (-604.256) (-607.886) [-604.750] * [-603.198] (-604.898) (-602.164) (-606.878) -- 0:00:09
846000 -- (-608.221) (-604.476) (-603.217) [-606.082] * (-601.924) (-606.009) (-601.913) [-606.606] -- 0:00:09
846500 -- [-607.331] (-602.717) (-603.953) (-603.881) * (-603.399) (-608.409) [-601.844] (-605.560) -- 0:00:09
847000 -- (-605.180) [-602.714] (-603.071) (-608.383) * (-606.405) (-605.668) (-604.064) [-603.384] -- 0:00:09
847500 -- [-607.526] (-603.875) (-602.914) (-603.761) * [-602.611] (-604.494) (-604.462) (-602.448) -- 0:00:09
848000 -- [-604.265] (-606.707) (-604.468) (-603.725) * (-605.071) [-604.469] (-605.088) (-604.690) -- 0:00:09
848500 -- (-604.889) (-606.562) [-604.574] (-607.398) * [-604.263] (-609.211) (-605.130) (-604.555) -- 0:00:09
849000 -- (-604.732) [-605.923] (-610.757) (-604.571) * (-605.279) (-604.927) (-603.134) [-604.290] -- 0:00:09
849500 -- [-605.590] (-606.976) (-610.768) (-606.334) * (-605.038) (-606.863) [-602.757] (-605.074) -- 0:00:09
850000 -- (-605.263) (-604.619) (-605.898) [-604.584] * [-602.138] (-602.600) (-603.443) (-604.614) -- 0:00:09
Average standard deviation of split frequencies: 0.008312
850500 -- (-604.171) (-604.558) [-603.845] (-604.145) * (-604.732) [-605.218] (-608.159) (-607.614) -- 0:00:09
851000 -- (-605.235) [-604.635] (-606.836) (-605.244) * (-601.922) (-603.671) (-606.049) [-602.847] -- 0:00:09
851500 -- (-603.232) (-607.425) (-603.788) [-605.775] * (-606.142) (-607.389) [-604.432] (-605.173) -- 0:00:09
852000 -- (-604.699) (-604.830) [-606.000] (-602.753) * (-603.595) [-606.718] (-608.671) (-608.211) -- 0:00:09
852500 -- (-603.611) (-606.045) (-604.209) [-602.984] * (-602.110) (-605.695) [-603.514] (-603.033) -- 0:00:08
853000 -- (-604.477) (-603.648) (-604.302) [-602.789] * (-603.930) [-604.326] (-604.768) (-602.301) -- 0:00:08
853500 -- (-603.574) (-604.083) [-602.517] (-602.224) * (-602.692) (-603.969) [-605.300] (-606.702) -- 0:00:08
854000 -- [-608.148] (-604.949) (-602.415) (-603.516) * (-606.210) (-602.935) (-603.932) [-607.363] -- 0:00:08
854500 -- (-607.858) [-603.564] (-605.118) (-603.427) * (-605.101) [-602.383] (-604.660) (-604.212) -- 0:00:08
855000 -- (-604.302) [-606.791] (-603.431) (-605.004) * (-604.756) (-607.715) [-603.094] (-604.404) -- 0:00:08
Average standard deviation of split frequencies: 0.008433
855500 -- [-603.204] (-603.162) (-602.686) (-605.159) * (-603.621) (-603.194) [-605.351] (-604.828) -- 0:00:08
856000 -- (-602.218) (-604.242) (-602.521) [-604.171] * (-606.105) (-603.792) [-603.726] (-605.936) -- 0:00:08
856500 -- [-602.086] (-604.684) (-604.418) (-607.200) * (-604.285) (-606.448) (-603.551) [-604.149] -- 0:00:08
857000 -- (-603.823) (-603.065) (-604.265) [-603.829] * [-604.705] (-603.637) (-608.381) (-609.267) -- 0:00:08
857500 -- (-603.536) (-603.363) [-603.146] (-603.531) * (-607.732) (-605.778) (-607.472) [-603.796] -- 0:00:08
858000 -- [-605.090] (-606.378) (-604.667) (-605.120) * (-605.996) [-606.037] (-607.246) (-606.074) -- 0:00:08
858500 -- [-602.961] (-607.257) (-604.155) (-603.682) * (-602.702) (-605.482) [-603.814] (-606.372) -- 0:00:08
859000 -- (-606.096) (-602.815) [-604.849] (-603.709) * (-603.932) (-603.604) (-605.411) [-605.665] -- 0:00:08
859500 -- [-603.196] (-605.109) (-606.793) (-605.468) * (-603.818) (-602.880) (-603.322) [-604.113] -- 0:00:08
860000 -- (-603.827) [-606.223] (-603.942) (-605.594) * (-605.542) (-607.265) [-604.411] (-605.601) -- 0:00:08
Average standard deviation of split frequencies: 0.008627
860500 -- (-603.549) (-605.031) [-604.788] (-604.482) * (-603.361) (-604.485) [-602.771] (-605.967) -- 0:00:08
861000 -- (-607.272) [-604.209] (-607.348) (-604.344) * (-607.549) (-604.409) [-603.922] (-603.951) -- 0:00:08
861500 -- (-604.729) [-602.275] (-603.472) (-604.695) * (-607.841) [-603.747] (-604.398) (-604.634) -- 0:00:08
862000 -- (-606.868) (-604.112) (-608.249) [-603.228] * (-606.832) (-603.891) (-607.007) [-607.038] -- 0:00:08
862500 -- (-606.136) (-604.649) [-603.517] (-602.383) * (-606.373) (-604.698) (-604.829) [-603.047] -- 0:00:08
863000 -- (-607.177) (-605.163) (-605.774) [-602.237] * (-604.528) (-605.152) [-603.244] (-603.774) -- 0:00:08
863500 -- (-604.856) [-603.111] (-603.135) (-603.970) * (-602.804) [-602.515] (-607.877) (-604.213) -- 0:00:08
864000 -- [-603.677] (-608.437) (-603.540) (-603.877) * (-602.578) (-607.223) [-603.022] (-605.241) -- 0:00:08
864500 -- (-605.616) (-603.394) (-605.200) [-603.892] * (-607.880) (-603.275) (-606.257) [-605.164] -- 0:00:08
865000 -- [-602.533] (-604.952) (-604.041) (-605.601) * (-605.970) (-602.650) (-604.861) [-601.925] -- 0:00:08
Average standard deviation of split frequencies: 0.008573
865500 -- [-602.281] (-604.764) (-603.367) (-607.531) * (-604.495) [-603.565] (-606.039) (-602.983) -- 0:00:08
866000 -- (-603.215) (-604.261) (-602.485) [-604.999] * [-603.234] (-602.254) (-604.122) (-601.959) -- 0:00:08
866500 -- [-602.409] (-606.639) (-603.364) (-604.081) * (-605.217) (-604.797) (-603.363) [-605.080] -- 0:00:08
867000 -- (-602.349) (-609.383) [-603.910] (-603.900) * (-604.568) [-602.862] (-607.387) (-605.038) -- 0:00:08
867500 -- (-602.445) [-605.524] (-605.040) (-606.744) * (-601.944) (-602.862) [-603.737] (-603.548) -- 0:00:08
868000 -- [-602.531] (-602.127) (-605.815) (-607.537) * (-602.263) (-606.556) (-604.451) [-604.526] -- 0:00:08
868500 -- (-604.380) (-602.622) (-605.039) [-604.105] * [-603.118] (-605.523) (-602.830) (-607.272) -- 0:00:08
869000 -- (-603.512) [-606.710] (-605.039) (-605.638) * (-604.767) [-602.787] (-602.211) (-603.790) -- 0:00:07
869500 -- (-605.356) [-602.990] (-602.709) (-606.039) * [-608.002] (-604.010) (-603.110) (-605.581) -- 0:00:07
870000 -- (-603.426) (-603.091) [-602.423] (-603.964) * [-603.629] (-603.296) (-604.995) (-604.704) -- 0:00:07
Average standard deviation of split frequencies: 0.008697
870500 -- [-601.892] (-603.046) (-603.385) (-602.793) * (-603.611) (-603.878) (-604.114) [-605.227] -- 0:00:07
871000 -- (-603.122) [-603.785] (-606.636) (-602.449) * (-604.430) (-608.714) [-606.293] (-602.997) -- 0:00:07
871500 -- (-604.613) [-604.764] (-604.900) (-606.078) * (-610.065) [-603.749] (-602.120) (-603.495) -- 0:00:07
872000 -- (-603.585) (-603.529) [-604.986] (-603.588) * (-608.598) (-602.297) [-601.996] (-603.457) -- 0:00:07
872500 -- (-602.990) (-602.587) (-604.398) [-603.204] * (-604.371) [-603.356] (-602.505) (-604.171) -- 0:00:07
873000 -- (-604.038) (-602.522) [-604.064] (-606.811) * [-603.660] (-606.625) (-604.818) (-605.920) -- 0:00:07
873500 -- (-602.105) [-606.662] (-603.529) (-604.013) * (-607.695) (-606.180) [-606.147] (-605.714) -- 0:00:07
874000 -- [-602.843] (-602.385) (-605.883) (-604.438) * (-606.956) (-608.549) (-604.359) [-603.970] -- 0:00:07
874500 -- (-603.858) (-605.327) (-604.421) [-604.696] * [-603.666] (-606.819) (-602.800) (-604.164) -- 0:00:07
875000 -- [-604.130] (-604.559) (-602.956) (-603.312) * [-604.334] (-604.414) (-604.039) (-603.208) -- 0:00:07
Average standard deviation of split frequencies: 0.009552
875500 -- (-603.463) (-605.890) (-607.152) [-604.162] * (-604.959) (-602.668) [-603.371] (-606.973) -- 0:00:07
876000 -- (-606.768) (-604.896) (-608.716) [-604.328] * (-606.892) [-602.874] (-603.219) (-604.651) -- 0:00:07
876500 -- (-606.869) [-605.056] (-606.947) (-604.811) * (-607.781) (-605.169) (-603.745) [-602.325] -- 0:00:07
877000 -- (-606.326) (-602.939) (-602.261) [-603.782] * (-608.677) [-606.524] (-604.407) (-603.973) -- 0:00:07
877500 -- (-604.461) [-603.627] (-602.936) (-603.916) * (-603.673) [-605.003] (-604.865) (-604.416) -- 0:00:07
878000 -- [-607.974] (-603.156) (-603.553) (-606.610) * [-603.056] (-602.614) (-603.040) (-604.514) -- 0:00:07
878500 -- [-604.397] (-602.827) (-602.898) (-604.343) * (-605.228) [-604.035] (-602.600) (-606.124) -- 0:00:07
879000 -- (-602.443) (-608.052) (-603.895) [-602.650] * (-605.895) (-607.333) [-604.409] (-603.744) -- 0:00:07
879500 -- (-603.083) (-607.141) (-603.886) [-605.209] * [-608.156] (-602.847) (-604.828) (-603.504) -- 0:00:07
880000 -- [-602.550] (-608.233) (-604.815) (-605.542) * (-605.584) (-606.843) [-607.055] (-608.447) -- 0:00:07
Average standard deviation of split frequencies: 0.009267
880500 -- (-606.555) (-606.536) [-602.634] (-603.672) * (-602.292) (-607.092) (-606.221) [-603.622] -- 0:00:07
881000 -- (-605.895) [-603.135] (-603.827) (-609.191) * [-609.612] (-608.482) (-606.395) (-606.721) -- 0:00:07
881500 -- (-603.106) (-605.155) (-606.390) [-604.835] * (-604.181) (-603.156) (-603.237) [-609.444] -- 0:00:07
882000 -- (-602.525) [-602.526] (-605.540) (-605.980) * (-604.927) (-605.734) (-602.829) [-608.573] -- 0:00:07
882500 -- (-603.977) [-602.660] (-606.841) (-603.482) * (-606.137) [-604.456] (-604.341) (-604.930) -- 0:00:07
883000 -- (-608.444) (-602.898) [-604.386] (-604.338) * [-604.468] (-604.257) (-603.667) (-604.167) -- 0:00:07
883500 -- [-604.119] (-603.174) (-603.850) (-603.007) * (-603.748) [-604.796] (-607.531) (-605.307) -- 0:00:07
884000 -- (-603.956) (-604.085) [-602.719] (-602.466) * (-606.221) (-602.611) (-611.037) [-605.686] -- 0:00:07
884500 -- (-605.588) (-602.638) [-604.582] (-602.626) * [-602.548] (-605.445) (-606.255) (-602.747) -- 0:00:07
885000 -- [-603.787] (-605.591) (-605.465) (-601.945) * (-604.061) (-604.021) (-604.212) [-602.174] -- 0:00:07
Average standard deviation of split frequencies: 0.009577
885500 -- (-603.910) [-608.487] (-602.621) (-604.276) * (-602.985) [-604.679] (-612.796) (-604.834) -- 0:00:06
886000 -- [-603.232] (-604.173) (-604.156) (-606.379) * [-605.085] (-603.054) (-608.329) (-604.005) -- 0:00:06
886500 -- (-609.707) (-603.568) [-604.615] (-603.644) * (-606.189) [-609.217] (-605.165) (-607.707) -- 0:00:06
887000 -- (-603.941) (-605.405) [-602.880] (-603.104) * [-604.171] (-608.398) (-605.727) (-606.160) -- 0:00:06
887500 -- (-604.976) [-607.814] (-605.677) (-603.317) * (-604.151) [-604.238] (-605.258) (-606.337) -- 0:00:06
888000 -- (-605.379) (-604.184) [-604.371] (-602.614) * [-605.039] (-604.315) (-603.724) (-606.547) -- 0:00:06
888500 -- (-607.326) (-605.999) [-603.026] (-602.974) * (-607.174) [-602.790] (-602.220) (-602.975) -- 0:00:06
889000 -- (-605.002) (-607.509) [-604.991] (-604.379) * (-604.556) (-604.518) [-603.494] (-602.899) -- 0:00:06
889500 -- (-609.286) (-606.683) (-606.021) [-604.550] * (-604.518) [-603.683] (-606.267) (-604.768) -- 0:00:06
890000 -- (-603.197) [-603.815] (-602.810) (-602.540) * [-605.806] (-603.673) (-602.406) (-605.842) -- 0:00:06
Average standard deviation of split frequencies: 0.009792
890500 -- (-607.702) (-602.653) (-603.933) [-602.966] * (-605.830) (-603.283) [-604.282] (-604.066) -- 0:00:06
891000 -- [-602.859] (-603.297) (-604.879) (-603.884) * (-606.439) [-603.565] (-606.675) (-602.617) -- 0:00:06
891500 -- (-602.578) [-604.237] (-604.384) (-603.238) * (-606.245) (-607.075) (-603.862) [-603.895] -- 0:00:06
892000 -- (-602.563) (-604.700) [-605.610] (-603.633) * (-603.349) (-602.712) [-603.531] (-603.073) -- 0:00:06
892500 -- [-602.538] (-603.269) (-604.910) (-603.754) * [-604.920] (-602.297) (-602.611) (-602.367) -- 0:00:06
893000 -- (-602.382) (-604.959) (-603.914) [-608.067] * (-605.766) (-603.312) (-603.985) [-602.383] -- 0:00:06
893500 -- (-602.437) (-606.229) [-603.062] (-603.254) * (-605.041) [-605.407] (-605.415) (-602.437) -- 0:00:06
894000 -- (-603.535) [-604.830] (-604.729) (-604.604) * (-608.895) [-607.818] (-602.625) (-601.917) -- 0:00:06
894500 -- (-606.531) (-605.655) (-604.193) [-602.435] * (-606.088) (-604.267) [-603.607] (-601.821) -- 0:00:06
895000 -- [-611.316] (-604.761) (-605.211) (-605.982) * (-606.848) (-604.019) [-603.450] (-601.818) -- 0:00:06
Average standard deviation of split frequencies: 0.009536
895500 -- [-607.628] (-604.630) (-605.458) (-607.898) * (-606.866) (-605.359) [-603.445] (-605.928) -- 0:00:06
896000 -- [-602.925] (-604.221) (-603.324) (-602.918) * [-605.332] (-603.627) (-603.478) (-603.062) -- 0:00:06
896500 -- (-602.817) [-602.686] (-603.191) (-602.792) * (-602.631) (-602.727) (-603.672) [-603.250] -- 0:00:06
897000 -- [-603.137] (-602.699) (-603.411) (-603.881) * [-603.175] (-604.874) (-605.281) (-604.323) -- 0:00:06
897500 -- (-603.805) (-606.668) [-603.077] (-604.695) * [-603.296] (-602.488) (-604.984) (-604.982) -- 0:00:06
898000 -- (-605.100) (-603.789) (-608.553) [-602.768] * [-604.978] (-605.339) (-604.116) (-602.644) -- 0:00:06
898500 -- (-605.284) (-606.437) [-603.468] (-602.618) * (-603.979) [-602.686] (-606.332) (-602.195) -- 0:00:06
899000 -- (-604.325) (-605.060) (-608.074) [-602.550] * (-603.137) (-602.285) (-603.232) [-604.128] -- 0:00:06
899500 -- [-606.357] (-604.151) (-605.501) (-604.972) * (-603.068) (-602.705) (-603.665) [-603.812] -- 0:00:06
900000 -- [-604.369] (-603.708) (-602.841) (-605.695) * [-603.701] (-607.178) (-605.994) (-603.012) -- 0:00:06
Average standard deviation of split frequencies: 0.009356
900500 -- (-603.549) [-604.285] (-603.147) (-610.626) * (-602.595) [-603.830] (-603.508) (-609.557) -- 0:00:06
901000 -- (-602.854) (-604.889) [-603.562] (-604.634) * (-604.278) (-602.596) [-603.977] (-605.229) -- 0:00:06
901500 -- [-604.296] (-607.323) (-607.560) (-604.524) * (-605.074) (-603.180) [-607.063] (-604.197) -- 0:00:06
902000 -- (-604.326) (-603.681) [-603.440] (-607.520) * (-604.397) (-601.831) (-602.450) [-603.267] -- 0:00:05
902500 -- (-605.932) (-606.032) (-605.712) [-603.210] * [-604.715] (-604.857) (-605.025) (-602.420) -- 0:00:05
903000 -- (-603.020) (-606.414) [-602.340] (-604.555) * [-603.948] (-608.297) (-604.185) (-603.362) -- 0:00:05
903500 -- (-602.983) [-603.073] (-602.271) (-611.929) * (-608.522) [-603.166] (-602.636) (-603.637) -- 0:00:05
904000 -- [-602.842] (-604.461) (-604.472) (-606.171) * (-604.066) (-603.668) [-603.472] (-603.811) -- 0:00:05
904500 -- [-603.930] (-603.589) (-604.429) (-605.192) * (-603.377) (-603.525) [-602.406] (-607.503) -- 0:00:05
905000 -- (-604.295) (-603.113) [-604.484] (-603.456) * [-604.625] (-602.479) (-603.093) (-608.074) -- 0:00:05
Average standard deviation of split frequencies: 0.009203
905500 -- (-606.468) (-607.371) [-606.433] (-610.387) * (-609.493) (-602.688) (-606.071) [-602.915] -- 0:00:05
906000 -- (-603.160) (-604.704) [-602.988] (-603.882) * (-608.398) [-605.985] (-603.508) (-603.066) -- 0:00:05
906500 -- (-603.697) (-602.179) [-602.072] (-610.545) * [-605.636] (-606.204) (-602.623) (-604.777) -- 0:00:05
907000 -- [-603.524] (-604.958) (-606.824) (-606.576) * (-609.655) (-606.172) [-603.560] (-604.784) -- 0:00:05
907500 -- [-603.922] (-606.798) (-604.535) (-602.550) * (-605.158) (-604.872) [-605.954] (-605.420) -- 0:00:05
908000 -- [-605.434] (-603.453) (-603.321) (-603.959) * (-606.491) (-604.223) [-602.326] (-608.269) -- 0:00:05
908500 -- (-606.072) (-603.380) (-603.704) [-604.686] * [-605.113] (-606.931) (-605.149) (-609.564) -- 0:00:05
909000 -- [-602.309] (-604.319) (-605.961) (-604.396) * (-601.939) (-607.617) [-602.084] (-605.378) -- 0:00:05
909500 -- (-607.045) (-604.590) [-604.092] (-604.922) * (-602.733) (-604.956) (-602.477) [-604.253] -- 0:00:05
910000 -- (-604.034) (-602.460) (-606.937) [-605.101] * (-603.552) (-602.883) (-603.213) [-603.222] -- 0:00:05
Average standard deviation of split frequencies: 0.009285
910500 -- (-602.317) (-602.269) (-604.311) [-605.010] * (-605.982) [-602.676] (-605.241) (-607.772) -- 0:00:05
911000 -- (-605.332) (-602.333) [-605.234] (-602.624) * [-604.189] (-602.569) (-606.125) (-607.387) -- 0:00:05
911500 -- (-607.227) (-605.478) [-606.867] (-605.303) * [-604.995] (-602.921) (-602.993) (-606.583) -- 0:00:05
912000 -- [-603.141] (-603.637) (-605.980) (-607.200) * (-604.147) (-602.554) [-604.754] (-611.052) -- 0:00:05
912500 -- [-603.812] (-605.500) (-606.186) (-605.642) * [-602.766] (-605.228) (-603.701) (-604.120) -- 0:00:05
913000 -- (-604.758) (-604.977) [-603.147] (-605.056) * [-603.640] (-606.442) (-602.714) (-602.433) -- 0:00:05
913500 -- [-608.383] (-608.231) (-603.199) (-603.880) * (-604.823) (-603.227) (-602.286) [-602.312] -- 0:00:05
914000 -- (-603.300) [-602.405] (-607.071) (-604.512) * (-602.868) [-602.953] (-603.933) (-602.165) -- 0:00:05
914500 -- (-603.197) [-603.716] (-605.097) (-603.532) * (-603.023) (-603.615) (-605.101) [-602.976] -- 0:00:05
915000 -- [-605.927] (-604.568) (-603.308) (-602.815) * (-603.214) (-603.551) (-602.745) [-603.245] -- 0:00:05
Average standard deviation of split frequencies: 0.009714
915500 -- (-603.604) (-604.565) (-603.072) [-603.656] * (-605.212) [-602.766] (-602.877) (-603.174) -- 0:00:05
916000 -- (-608.184) [-603.485] (-609.063) (-603.138) * [-604.647] (-604.586) (-602.227) (-605.714) -- 0:00:05
916500 -- (-606.117) (-606.086) [-603.708] (-602.645) * (-604.291) (-603.625) (-603.771) [-605.081] -- 0:00:05
917000 -- (-603.829) (-603.178) [-606.758] (-604.065) * (-603.344) (-606.779) (-605.844) [-604.013] -- 0:00:05
917500 -- (-602.815) (-603.726) (-602.888) [-604.495] * (-605.124) (-603.216) (-604.709) [-602.665] -- 0:00:05
918000 -- (-602.467) (-603.316) [-605.061] (-604.615) * (-603.839) (-608.127) (-607.639) [-602.429] -- 0:00:05
918500 -- (-605.546) (-603.853) (-606.281) [-605.450] * (-604.124) (-602.785) [-603.928] (-604.915) -- 0:00:04
919000 -- (-606.616) (-602.947) (-605.722) [-609.860] * (-604.954) (-603.099) (-602.750) [-602.574] -- 0:00:04
919500 -- [-604.061] (-603.171) (-607.131) (-610.084) * (-608.767) (-602.345) (-603.744) [-602.643] -- 0:00:04
920000 -- (-607.432) (-602.229) (-607.198) [-607.166] * [-606.226] (-603.871) (-606.205) (-606.737) -- 0:00:04
Average standard deviation of split frequencies: 0.009600
920500 -- (-604.968) [-605.989] (-603.910) (-608.726) * [-605.579] (-605.122) (-606.590) (-603.104) -- 0:00:04
921000 -- (-603.829) (-604.191) [-602.526] (-603.832) * (-606.730) (-606.383) (-604.418) [-605.515] -- 0:00:04
921500 -- [-604.285] (-603.439) (-602.638) (-603.624) * (-603.325) (-603.791) (-608.289) [-604.595] -- 0:00:04
922000 -- (-603.944) [-603.944] (-603.675) (-603.582) * (-603.734) [-604.304] (-603.597) (-603.229) -- 0:00:04
922500 -- (-603.687) (-603.379) [-602.284] (-604.602) * [-607.713] (-603.654) (-604.465) (-603.525) -- 0:00:04
923000 -- [-602.382] (-605.761) (-603.771) (-604.660) * (-603.780) [-605.297] (-605.628) (-604.479) -- 0:00:04
923500 -- [-602.190] (-603.972) (-602.680) (-602.612) * (-607.153) (-606.112) (-605.748) [-602.720] -- 0:00:04
924000 -- [-603.885] (-606.702) (-603.284) (-605.577) * (-603.709) (-602.818) [-603.850] (-603.803) -- 0:00:04
924500 -- (-602.790) (-605.385) [-603.289] (-602.932) * (-606.132) (-604.032) [-602.464] (-603.685) -- 0:00:04
925000 -- (-602.148) (-609.811) (-605.511) [-602.970] * (-602.334) (-603.149) [-602.206] (-604.556) -- 0:00:04
Average standard deviation of split frequencies: 0.009800
925500 -- (-602.779) (-604.855) (-603.562) [-602.856] * (-603.485) (-603.455) (-604.737) [-602.477] -- 0:00:04
926000 -- (-602.787) [-603.085] (-605.640) (-606.396) * (-604.760) (-603.638) (-604.240) [-604.113] -- 0:00:04
926500 -- [-602.887] (-604.063) (-606.243) (-603.993) * [-603.735] (-605.272) (-603.055) (-602.452) -- 0:00:04
927000 -- (-602.139) [-605.678] (-604.862) (-603.957) * [-602.482] (-602.653) (-603.921) (-604.002) -- 0:00:04
927500 -- (-602.215) (-603.657) [-602.322] (-603.028) * (-602.839) [-604.489] (-604.087) (-603.457) -- 0:00:04
928000 -- (-604.583) (-605.471) [-603.686] (-604.640) * (-603.392) (-602.806) [-603.433] (-604.155) -- 0:00:04
928500 -- (-611.795) (-603.533) [-604.378] (-603.555) * [-604.368] (-602.765) (-602.948) (-604.489) -- 0:00:04
929000 -- (-603.329) [-602.376] (-605.440) (-603.850) * (-603.505) [-603.083] (-605.699) (-602.858) -- 0:00:04
929500 -- (-603.493) [-604.733] (-603.603) (-603.270) * (-603.622) (-604.475) (-603.744) [-605.527] -- 0:00:04
930000 -- [-603.219] (-603.043) (-603.903) (-604.215) * (-606.072) [-603.374] (-607.822) (-606.302) -- 0:00:04
Average standard deviation of split frequencies: 0.009529
930500 -- (-603.892) [-608.667] (-603.367) (-603.645) * (-604.784) [-606.116] (-606.702) (-604.256) -- 0:00:04
931000 -- (-608.923) (-603.845) (-604.409) [-603.245] * (-605.338) [-602.855] (-608.373) (-604.791) -- 0:00:04
931500 -- (-605.053) (-603.293) [-603.250] (-603.601) * [-603.204] (-602.842) (-608.234) (-603.364) -- 0:00:04
932000 -- [-603.272] (-606.490) (-602.071) (-604.660) * (-604.023) (-604.327) [-606.281] (-603.827) -- 0:00:04
932500 -- [-602.061] (-607.711) (-602.529) (-604.931) * (-604.215) (-608.219) (-604.846) [-602.580] -- 0:00:04
933000 -- (-603.045) (-606.480) [-603.446] (-604.687) * (-604.860) [-605.237] (-602.728) (-603.135) -- 0:00:04
933500 -- (-602.699) (-602.888) (-603.727) [-602.791] * (-604.039) [-602.753] (-603.601) (-603.527) -- 0:00:04
934000 -- (-603.305) (-604.214) (-603.473) [-602.285] * [-604.184] (-604.968) (-605.642) (-603.500) -- 0:00:04
934500 -- (-602.935) (-603.726) (-603.667) [-605.195] * [-603.253] (-602.193) (-607.365) (-606.229) -- 0:00:03
935000 -- (-602.909) (-602.094) [-602.993] (-604.295) * (-603.926) (-602.709) [-608.099] (-608.986) -- 0:00:03
Average standard deviation of split frequencies: 0.009947
935500 -- (-606.686) (-602.279) [-604.908] (-602.497) * (-606.413) (-603.356) [-606.692] (-602.013) -- 0:00:03
936000 -- (-603.776) [-604.344] (-608.547) (-604.112) * (-605.284) (-608.857) [-606.505] (-606.995) -- 0:00:03
936500 -- (-604.346) (-608.739) [-604.906] (-605.797) * (-602.692) [-603.303] (-602.789) (-603.314) -- 0:00:03
937000 -- (-604.594) [-607.639] (-603.938) (-605.867) * (-602.690) (-604.375) [-607.446] (-602.364) -- 0:00:03
937500 -- (-606.499) [-606.640] (-602.954) (-603.521) * (-602.149) [-604.679] (-606.293) (-603.791) -- 0:00:03
938000 -- [-604.380] (-608.523) (-604.269) (-603.583) * [-605.266] (-602.659) (-604.996) (-603.156) -- 0:00:03
938500 -- [-602.071] (-602.957) (-604.935) (-604.289) * (-604.449) (-604.896) [-605.018] (-603.772) -- 0:00:03
939000 -- (-602.961) (-604.401) [-604.231] (-603.996) * (-603.180) (-604.109) (-606.807) [-605.946] -- 0:00:03
939500 -- [-604.096] (-605.822) (-602.730) (-604.585) * (-603.620) [-604.597] (-605.009) (-606.811) -- 0:00:03
940000 -- (-606.818) (-606.000) [-604.450] (-604.634) * (-603.322) (-603.022) (-603.480) [-602.752] -- 0:00:03
Average standard deviation of split frequencies: 0.009710
940500 -- (-603.473) (-605.917) (-605.797) [-606.545] * [-602.675] (-606.269) (-602.274) (-602.759) -- 0:00:03
941000 -- (-603.165) [-603.997] (-603.582) (-608.192) * (-602.904) [-603.760] (-605.383) (-602.470) -- 0:00:03
941500 -- (-604.013) (-604.839) (-605.914) [-605.364] * (-604.457) (-604.509) (-605.739) [-602.420] -- 0:00:03
942000 -- (-607.164) [-604.021] (-603.793) (-602.810) * (-604.946) (-603.378) (-604.364) [-606.153] -- 0:00:03
942500 -- (-603.796) (-604.253) [-606.567] (-606.553) * [-604.716] (-605.675) (-604.133) (-605.304) -- 0:00:03
943000 -- [-604.318] (-602.389) (-602.323) (-608.512) * (-604.731) (-605.923) (-605.263) [-603.197] -- 0:00:03
943500 -- [-603.961] (-605.571) (-604.127) (-605.638) * (-605.584) (-604.384) [-604.033] (-605.575) -- 0:00:03
944000 -- (-604.086) (-603.548) (-603.403) [-603.182] * (-602.617) [-603.694] (-603.448) (-606.438) -- 0:00:03
944500 -- (-606.062) [-603.049] (-608.936) (-603.422) * [-603.809] (-602.727) (-602.596) (-605.052) -- 0:00:03
945000 -- (-603.726) (-603.158) (-607.079) [-605.129] * [-604.847] (-605.793) (-603.356) (-606.014) -- 0:00:03
Average standard deviation of split frequencies: 0.009842
945500 -- (-603.621) (-604.267) (-603.356) [-603.922] * (-607.219) (-605.116) (-602.537) [-607.372] -- 0:00:03
946000 -- (-603.682) [-603.057] (-605.424) (-605.874) * (-608.247) (-604.166) [-605.399] (-604.447) -- 0:00:03
946500 -- (-604.658) (-604.018) (-602.198) [-604.171] * (-605.404) (-604.867) [-611.457] (-603.863) -- 0:00:03
947000 -- [-607.727] (-610.766) (-603.023) (-604.670) * (-606.453) [-607.550] (-604.275) (-603.751) -- 0:00:03
947500 -- (-603.046) (-601.966) (-605.880) [-603.214] * [-604.427] (-604.315) (-602.471) (-603.323) -- 0:00:03
948000 -- (-604.038) (-601.809) (-604.202) [-604.517] * (-609.756) [-603.527] (-605.299) (-603.409) -- 0:00:03
948500 -- (-603.419) (-603.765) [-604.333] (-605.047) * (-609.704) (-602.469) (-604.216) [-609.281] -- 0:00:03
949000 -- (-604.314) [-602.566] (-607.445) (-606.658) * (-607.819) (-603.934) [-606.009] (-608.308) -- 0:00:03
949500 -- (-606.055) (-604.329) [-603.914] (-602.838) * (-607.133) [-605.172] (-608.803) (-611.573) -- 0:00:03
950000 -- (-606.776) (-602.045) (-603.266) [-603.115] * [-603.652] (-602.774) (-606.405) (-606.826) -- 0:00:03
Average standard deviation of split frequencies: 0.009979
950500 -- [-605.809] (-602.130) (-603.760) (-603.381) * [-604.005] (-602.752) (-605.000) (-602.900) -- 0:00:03
951000 -- (-606.335) [-605.110] (-609.226) (-603.761) * [-604.592] (-608.003) (-606.188) (-603.945) -- 0:00:02
951500 -- [-602.213] (-605.278) (-609.076) (-603.720) * [-605.765] (-603.012) (-609.720) (-603.754) -- 0:00:02
952000 -- (-605.989) (-605.153) (-609.203) [-603.861] * (-602.756) (-603.961) [-605.332] (-609.190) -- 0:00:02
952500 -- (-603.436) (-604.299) (-605.644) [-602.152] * (-603.252) (-602.810) (-605.786) [-602.677] -- 0:00:02
953000 -- (-603.881) [-601.958] (-603.950) (-603.041) * [-607.168] (-605.291) (-606.428) (-604.965) -- 0:00:02
953500 -- (-602.557) [-602.396] (-604.328) (-603.163) * (-603.916) (-605.648) (-603.553) [-601.947] -- 0:00:02
954000 -- (-604.899) (-607.336) (-603.353) [-602.188] * (-604.225) [-604.473] (-603.167) (-604.621) -- 0:00:02
954500 -- (-603.175) (-603.791) (-602.586) [-604.217] * [-602.549] (-602.390) (-603.817) (-603.148) -- 0:00:02
955000 -- [-601.995] (-603.313) (-602.732) (-604.772) * (-605.216) (-607.354) (-603.794) [-605.377] -- 0:00:02
Average standard deviation of split frequencies: 0.009800
955500 -- (-602.858) [-603.402] (-602.972) (-603.657) * (-603.091) [-607.958] (-606.088) (-606.816) -- 0:00:02
956000 -- (-603.534) (-606.292) [-603.957] (-602.723) * (-604.202) [-609.358] (-603.358) (-603.883) -- 0:00:02
956500 -- (-603.948) (-606.211) (-608.617) [-601.977] * (-604.059) [-605.194] (-604.154) (-605.181) -- 0:00:02
957000 -- (-609.769) (-603.863) (-606.472) [-602.241] * (-604.861) (-607.230) [-605.127] (-604.317) -- 0:00:02
957500 -- (-607.528) [-603.368] (-603.348) (-604.249) * [-608.666] (-605.835) (-604.280) (-609.305) -- 0:00:02
958000 -- (-603.975) [-603.752] (-604.227) (-604.279) * (-602.416) [-603.625] (-605.341) (-603.778) -- 0:00:02
958500 -- [-606.157] (-603.784) (-603.844) (-602.652) * (-602.531) (-604.377) (-604.626) [-602.801] -- 0:00:02
959000 -- (-607.931) [-605.232] (-604.124) (-605.208) * [-602.902] (-605.073) (-603.987) (-602.008) -- 0:00:02
959500 -- (-604.679) [-606.419] (-603.249) (-604.060) * (-605.044) (-606.473) [-603.796] (-602.732) -- 0:00:02
960000 -- (-603.358) (-604.580) (-602.318) [-602.488] * [-607.140] (-605.733) (-605.553) (-604.450) -- 0:00:02
Average standard deviation of split frequencies: 0.010059
960500 -- (-604.513) (-606.764) (-606.558) [-605.562] * [-605.837] (-605.098) (-603.666) (-605.207) -- 0:00:02
961000 -- (-602.949) (-605.135) [-604.958] (-607.262) * (-605.304) (-603.044) (-605.080) [-602.717] -- 0:00:02
961500 -- [-602.864] (-603.826) (-607.292) (-603.921) * (-606.551) (-604.102) (-603.729) [-603.229] -- 0:00:02
962000 -- (-604.516) (-604.218) [-604.604] (-605.402) * (-603.644) [-604.113] (-605.347) (-604.306) -- 0:00:02
962500 -- (-604.831) [-602.916] (-605.057) (-602.214) * (-604.445) (-603.228) [-603.752] (-607.371) -- 0:00:02
963000 -- (-603.303) [-602.261] (-604.523) (-603.214) * (-602.426) (-607.174) (-604.440) [-604.373] -- 0:00:02
963500 -- (-604.623) (-603.932) [-603.248] (-608.043) * (-604.564) (-602.772) (-608.341) [-602.060] -- 0:00:02
964000 -- (-602.064) (-603.570) [-604.152] (-609.593) * [-605.327] (-603.366) (-604.786) (-605.259) -- 0:00:02
964500 -- (-602.403) (-604.600) (-605.096) [-604.236] * (-604.780) (-607.283) [-604.893] (-602.419) -- 0:00:02
965000 -- [-602.219] (-604.790) (-604.336) (-603.634) * (-603.435) (-603.992) [-603.116] (-605.287) -- 0:00:02
Average standard deviation of split frequencies: 0.009729
965500 -- [-604.108] (-603.540) (-605.089) (-604.680) * [-602.825] (-608.455) (-603.723) (-604.689) -- 0:00:02
966000 -- (-607.312) (-603.722) [-604.550] (-603.989) * [-603.111] (-603.984) (-604.695) (-605.404) -- 0:00:02
966500 -- [-604.062] (-603.872) (-605.185) (-603.703) * (-602.899) [-603.443] (-602.551) (-602.979) -- 0:00:02
967000 -- (-605.299) (-605.930) (-606.648) [-606.238] * (-602.952) (-610.787) [-604.642] (-604.563) -- 0:00:02
967500 -- (-603.531) (-602.353) [-602.921] (-603.781) * (-605.828) [-606.967] (-603.952) (-603.652) -- 0:00:01
968000 -- (-602.827) (-603.637) [-602.269] (-602.711) * (-606.673) [-605.080] (-606.752) (-605.696) -- 0:00:01
968500 -- (-603.603) [-603.676] (-605.815) (-604.992) * (-608.983) (-602.917) (-603.869) [-605.068] -- 0:00:01
969000 -- (-604.075) [-605.433] (-605.705) (-605.535) * (-607.789) (-602.589) [-603.691] (-603.241) -- 0:00:01
969500 -- [-603.920] (-602.721) (-604.089) (-606.929) * (-603.380) (-605.401) [-604.429] (-603.046) -- 0:00:01
970000 -- (-603.674) (-603.068) [-604.647] (-604.004) * [-603.704] (-604.702) (-605.070) (-604.661) -- 0:00:01
Average standard deviation of split frequencies: 0.009774
970500 -- [-604.351] (-602.578) (-602.780) (-602.917) * (-604.645) (-604.634) [-606.445] (-602.769) -- 0:00:01
971000 -- [-603.253] (-605.109) (-602.550) (-603.450) * (-605.632) (-603.211) (-606.530) [-606.635] -- 0:00:01
971500 -- (-604.336) [-604.148] (-603.607) (-603.839) * [-604.050] (-603.646) (-603.661) (-606.480) -- 0:00:01
972000 -- [-603.703] (-603.296) (-603.948) (-603.673) * [-603.946] (-607.298) (-603.928) (-607.116) -- 0:00:01
972500 -- (-604.230) (-604.349) [-603.813] (-603.446) * [-606.684] (-610.770) (-604.058) (-604.272) -- 0:00:01
973000 -- [-603.421] (-606.484) (-609.221) (-603.992) * (-602.371) (-605.635) [-602.535] (-604.271) -- 0:00:01
973500 -- [-604.878] (-604.168) (-604.934) (-603.901) * (-604.309) (-602.886) [-604.615] (-603.764) -- 0:00:01
974000 -- (-605.293) (-603.821) [-602.097] (-605.651) * [-605.248] (-603.501) (-606.014) (-610.529) -- 0:00:01
974500 -- (-604.538) (-602.909) [-601.946] (-604.123) * (-603.985) (-604.860) [-604.420] (-602.399) -- 0:00:01
975000 -- (-603.265) (-602.309) (-604.027) [-603.093] * (-605.578) (-602.654) [-602.403] (-607.169) -- 0:00:01
Average standard deviation of split frequencies: 0.009660
975500 -- (-605.553) (-602.792) (-605.569) [-603.930] * [-602.278] (-602.496) (-605.110) (-603.186) -- 0:00:01
976000 -- (-605.397) [-604.515] (-602.873) (-605.494) * [-603.363] (-604.765) (-603.891) (-609.936) -- 0:00:01
976500 -- (-604.115) [-602.931] (-602.969) (-607.101) * (-603.907) (-604.331) [-606.445] (-604.517) -- 0:00:01
977000 -- (-608.240) [-602.716] (-602.521) (-603.903) * (-604.618) (-604.369) (-603.709) [-602.363] -- 0:00:01
977500 -- (-602.436) (-603.236) [-603.395] (-604.575) * (-604.592) (-605.686) (-602.420) [-602.389] -- 0:00:01
978000 -- (-604.727) (-602.488) [-604.772] (-603.451) * (-603.581) [-604.763] (-605.517) (-602.965) -- 0:00:01
978500 -- [-605.197] (-606.886) (-603.411) (-603.277) * (-605.525) (-607.982) (-605.541) [-605.147] -- 0:00:01
979000 -- (-604.533) (-607.077) (-605.080) [-603.592] * (-604.604) (-602.470) [-602.366] (-604.027) -- 0:00:01
979500 -- (-603.338) (-605.065) [-605.083] (-607.579) * (-603.805) (-603.846) [-602.956] (-610.372) -- 0:00:01
980000 -- (-602.229) (-606.935) (-604.503) [-605.061] * [-603.220] (-603.219) (-603.379) (-606.364) -- 0:00:01
Average standard deviation of split frequencies: 0.009644
980500 -- (-603.437) (-605.454) [-604.222] (-610.474) * (-606.854) (-607.733) (-604.508) [-606.930] -- 0:00:01
981000 -- (-605.639) (-603.411) (-603.776) [-606.406] * (-606.607) (-604.641) [-606.162] (-605.245) -- 0:00:01
981500 -- (-604.684) [-603.756] (-604.931) (-604.116) * (-603.349) [-603.434] (-608.593) (-606.276) -- 0:00:01
982000 -- (-603.187) (-602.333) [-603.936] (-602.939) * [-603.354] (-603.816) (-606.046) (-606.018) -- 0:00:01
982500 -- (-606.293) (-603.000) [-605.081] (-607.029) * (-608.175) (-603.476) [-602.207] (-607.936) -- 0:00:01
983000 -- [-606.139] (-603.275) (-606.782) (-603.561) * (-610.084) (-604.424) [-602.255] (-605.963) -- 0:00:01
983500 -- (-605.766) [-603.791] (-607.616) (-606.951) * (-607.200) [-602.213] (-605.195) (-603.049) -- 0:00:01
984000 -- (-605.880) (-603.998) (-605.853) [-604.145] * [-606.074] (-602.955) (-602.547) (-602.594) -- 0:00:00
984500 -- (-605.803) [-603.437] (-602.903) (-607.588) * (-602.533) (-604.728) (-605.604) [-603.072] -- 0:00:00
985000 -- (-604.003) (-603.340) (-603.160) [-604.757] * (-602.969) [-604.812] (-603.513) (-607.581) -- 0:00:00
Average standard deviation of split frequencies: 0.009413
985500 -- (-606.481) (-603.167) [-603.206] (-604.709) * (-607.736) (-603.761) (-604.971) [-605.230] -- 0:00:00
986000 -- (-604.344) (-603.229) [-603.651] (-603.130) * [-604.823] (-606.498) (-602.931) (-603.802) -- 0:00:00
986500 -- (-603.545) [-605.380] (-607.515) (-602.260) * [-603.751] (-606.761) (-603.925) (-603.152) -- 0:00:00
987000 -- (-603.012) (-603.017) [-603.868] (-602.765) * (-605.545) (-604.864) (-604.488) [-603.429] -- 0:00:00
987500 -- (-608.843) [-604.850] (-603.379) (-602.813) * (-608.764) (-607.520) [-602.874] (-603.526) -- 0:00:00
988000 -- (-603.417) (-607.441) [-603.068] (-602.854) * (-602.206) [-605.676] (-602.450) (-604.154) -- 0:00:00
988500 -- (-605.368) (-609.442) (-607.278) [-603.740] * (-604.168) [-604.826] (-603.896) (-604.560) -- 0:00:00
989000 -- (-604.357) (-604.851) [-603.500] (-602.559) * (-606.342) [-603.711] (-603.819) (-605.499) -- 0:00:00
989500 -- (-607.779) (-604.620) [-603.250] (-603.354) * (-606.157) [-604.576] (-605.795) (-603.103) -- 0:00:00
990000 -- (-607.023) (-606.092) [-602.586] (-603.032) * [-608.623] (-607.744) (-603.241) (-604.906) -- 0:00:00
Average standard deviation of split frequencies: 0.009666
990500 -- (-604.179) (-605.729) [-603.312] (-612.281) * (-604.811) [-604.690] (-603.785) (-604.681) -- 0:00:00
991000 -- (-604.558) [-602.308] (-603.839) (-608.217) * (-605.436) (-603.757) (-604.739) [-602.827] -- 0:00:00
991500 -- (-607.873) (-608.675) (-603.106) [-602.709] * (-606.150) (-603.542) [-605.732] (-603.287) -- 0:00:00
992000 -- [-605.755] (-611.310) (-603.567) (-606.180) * (-603.148) (-604.857) [-607.462] (-605.648) -- 0:00:00
992500 -- (-607.684) (-613.642) (-602.222) [-602.953] * (-603.389) (-606.991) [-604.898] (-603.483) -- 0:00:00
993000 -- (-606.373) (-609.279) (-601.938) [-602.761] * (-602.807) (-604.632) [-603.100] (-602.586) -- 0:00:00
993500 -- (-603.669) [-607.542] (-604.580) (-606.571) * (-604.567) [-602.736] (-603.075) (-602.911) -- 0:00:00
994000 -- [-604.552] (-607.508) (-604.257) (-604.844) * [-603.524] (-605.253) (-604.871) (-603.120) -- 0:00:00
994500 -- [-603.692] (-604.101) (-604.306) (-603.698) * [-603.705] (-602.626) (-604.742) (-603.112) -- 0:00:00
995000 -- (-602.441) (-606.853) [-604.078] (-605.042) * (-602.473) [-602.874] (-607.133) (-608.191) -- 0:00:00
Average standard deviation of split frequencies: 0.009525
995500 -- (-604.187) (-604.399) [-603.257] (-602.603) * (-603.494) (-603.104) (-605.148) [-604.736] -- 0:00:00
996000 -- [-604.188] (-608.478) (-602.435) (-605.762) * [-603.924] (-603.766) (-605.691) (-603.388) -- 0:00:00
996500 -- (-604.374) (-606.906) (-604.430) [-604.713] * (-604.107) [-602.394] (-603.662) (-607.325) -- 0:00:00
997000 -- [-603.601] (-605.130) (-614.182) (-603.766) * (-604.040) [-603.278] (-602.634) (-606.873) -- 0:00:00
997500 -- [-606.296] (-603.788) (-608.020) (-602.652) * [-604.083] (-605.973) (-603.191) (-604.674) -- 0:00:00
998000 -- (-604.420) [-604.443] (-607.165) (-604.665) * (-603.377) (-607.067) (-602.727) [-602.633] -- 0:00:00
998500 -- [-603.851] (-606.364) (-606.412) (-605.326) * (-604.264) (-605.484) [-601.962] (-606.314) -- 0:00:00
999000 -- [-604.054] (-603.407) (-604.003) (-604.013) * (-604.917) (-603.077) [-601.995] (-608.899) -- 0:00:00
999500 -- (-602.840) (-603.793) (-604.928) [-603.027] * [-604.351] (-604.046) (-604.113) (-603.601) -- 0:00:00
1000000 -- [-602.690] (-602.685) (-602.918) (-602.353) * (-602.669) (-603.590) [-604.138] (-604.605) -- 0:00:00
Average standard deviation of split frequencies: 0.009422
Analysis completed in 1 mins 1 seconds
Analysis used 59.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -601.72
Likelihood of best state for "cold" chain of run 2 was -601.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 65 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
33.0 % ( 30 %) Dirichlet(Pi{all})
34.4 % ( 31 %) Slider(Pi{all})
78.0 % ( 61 %) Multiplier(Alpha{1,2})
77.6 % ( 59 %) Multiplier(Alpha{3})
24.3 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.5 % ( 95 %) Nodeslider(V{all})
30.1 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.6 % ( 27 %) Dirichlet(Pi{all})
34.3 % ( 20 %) Slider(Pi{all})
78.8 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 50 %) Multiplier(Alpha{3})
23.7 % ( 16 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
69.8 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 82 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.3 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166943 0.82 0.67
3 | 166607 166117 0.84
4 | 166674 166718 166941
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167166 0.83 0.67
3 | 166070 166968 0.84
4 | 166256 166194 167346
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -603.39
| 1 2 2 |
| 1 2 1 2 |
| 1 1 1 11 |
| 1 22 1 2 2 2 2 |
| 11 2 1 *1 1 2 1 2 21 1|
| 2 1 12 2 1 12 1 11 12* 2|
| 2 2 2 2 2 2 1 2 2 2 2 1 |
|2 2 * 1 11 * 2 * 1 1 2 1 |
|1 1 2 2 2 2 2 1 1 2 1 1 2 |
| 1 2 1 2 1 1 11 1 2 1 * 1 1 |
| 1 2 2 2 21 |
| 1 2 |
| 2 2 2 |
| 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -605.19
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -603.41 -606.69
2 -603.43 -606.48
--------------------------------------
TOTAL -603.42 -606.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884346 0.087811 0.349787 1.447047 0.851087 1243.05 1372.03 1.000
r(A<->C){all} 0.161795 0.019550 0.000101 0.445047 0.124325 171.04 200.58 1.005
r(A<->G){all} 0.169363 0.020978 0.000061 0.468438 0.130141 159.96 165.42 1.000
r(A<->T){all} 0.173305 0.021172 0.000287 0.466521 0.135033 131.47 192.24 1.000
r(C<->G){all} 0.167415 0.019454 0.000005 0.461365 0.131933 302.20 386.76 1.016
r(C<->T){all} 0.168054 0.019995 0.000007 0.459478 0.129286 157.81 266.83 1.001
r(G<->T){all} 0.160068 0.018868 0.000002 0.443485 0.124643 223.99 257.23 1.000
pi(A){all} 0.253257 0.000444 0.211013 0.292368 0.253071 1179.97 1192.86 1.000
pi(C){all} 0.267374 0.000428 0.226649 0.307353 0.267136 1093.70 1145.50 1.000
pi(G){all} 0.291612 0.000456 0.249537 0.331716 0.291285 1202.18 1278.85 1.000
pi(T){all} 0.187756 0.000351 0.152591 0.225858 0.187032 1501.00 1501.00 1.000
alpha{1,2} 0.413763 0.240434 0.000227 1.390792 0.244296 1232.55 1240.69 1.000
alpha{3} 0.467090 0.235466 0.000312 1.463892 0.301254 1307.83 1333.39 1.000
pinvar{all} 0.996365 0.000018 0.988505 0.999999 0.997777 1163.02 1185.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- ....**
9 -- ..**..
10 -- .*..*.
11 -- ..*..*
12 -- .**.**
13 -- .*.***
14 -- ..****
15 -- ...**.
16 -- .**...
17 -- .*.*..
18 -- .****.
19 -- .*...*
20 -- .***.*
21 -- ...*.*
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.021199 0.140573 0.170553 2
8 450 0.149900 0.007537 0.144570 0.155230 2
9 447 0.148901 0.004240 0.145903 0.151899 2
10 443 0.147568 0.002355 0.145903 0.149234 2
11 440 0.146569 0.010364 0.139241 0.153897 2
12 437 0.145570 0.014604 0.135243 0.155896 2
13 433 0.144237 0.011777 0.135909 0.152565 2
14 431 0.143571 0.007066 0.138574 0.148568 2
15 428 0.142572 0.001884 0.141239 0.143904 2
16 425 0.141572 0.011777 0.133245 0.149900 2
17 420 0.139907 0.003769 0.137242 0.142572 2
18 414 0.137908 0.003769 0.135243 0.140573 2
19 412 0.137242 0.016959 0.125250 0.149234 2
20 407 0.135576 0.003298 0.133245 0.137908 2
21 393 0.130913 0.013662 0.121252 0.140573 2
22 269 0.089607 0.016488 0.077948 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099801 0.009668 0.000076 0.301870 0.071061 1.000 2
length{all}[2] 0.099146 0.009533 0.000005 0.287965 0.069889 1.000 2
length{all}[3] 0.096226 0.009519 0.000106 0.303496 0.065095 1.001 2
length{all}[4] 0.101439 0.010454 0.000024 0.305186 0.069496 1.000 2
length{all}[5] 0.098892 0.009692 0.000051 0.295176 0.067429 1.000 2
length{all}[6] 0.097221 0.009632 0.000063 0.297447 0.067494 1.000 2
length{all}[7] 0.097945 0.010248 0.000111 0.291903 0.064664 1.012 2
length{all}[8] 0.099230 0.009672 0.000404 0.291633 0.073783 0.999 2
length{all}[9] 0.101245 0.010069 0.000293 0.296593 0.068830 0.999 2
length{all}[10] 0.093661 0.009473 0.000044 0.322749 0.060634 0.999 2
length{all}[11] 0.110167 0.013736 0.000101 0.338904 0.073610 0.999 2
length{all}[12] 0.096911 0.008126 0.000044 0.277359 0.073239 1.015 2
length{all}[13] 0.097063 0.009931 0.000356 0.303703 0.066708 1.000 2
length{all}[14] 0.089668 0.006615 0.000054 0.249020 0.065386 0.998 2
length{all}[15] 0.092348 0.008879 0.000160 0.269628 0.066356 1.002 2
length{all}[16] 0.096775 0.009365 0.000032 0.296211 0.068099 0.998 2
length{all}[17] 0.100520 0.009253 0.000188 0.299088 0.070506 1.000 2
length{all}[18] 0.097471 0.009513 0.000004 0.303140 0.066269 0.998 2
length{all}[19] 0.101307 0.010416 0.000449 0.299382 0.070601 0.998 2
length{all}[20] 0.098720 0.007749 0.000164 0.294239 0.078686 1.001 2
length{all}[21] 0.095570 0.010158 0.000053 0.249337 0.067289 0.999 2
length{all}[22] 0.099769 0.009775 0.000053 0.272807 0.074847 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009422
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.015
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 438
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 146 / 146 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 146 / 146 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037056 0.067614 0.079066 0.050922 0.043571 0.031483 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -630.180387
Iterating by ming2
Initial: fx= 630.180387
x= 0.03706 0.06761 0.07907 0.05092 0.04357 0.03148 0.30000 1.30000
1 h-m-p 0.0000 0.0002 350.1933 +++ 603.197677 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0087 59.8208 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 321.1046 ++ 599.185538 m 0.0000 45 | 2/8
4 h-m-p 0.0002 0.0132 46.4769 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 287.2469 ++ 595.428566 m 0.0000 75 | 3/8
6 h-m-p 0.0003 0.0169 37.0888 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 248.8003 ++ 592.244229 m 0.0001 105 | 4/8
8 h-m-p 0.0004 0.0231 27.8045 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 203.1396 ++ 587.406859 m 0.0001 135 | 5/8
10 h-m-p 0.0009 0.0380 18.2721 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 143.8974 ++ 585.739160 m 0.0001 166 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 585.739160 m 8.0000 207 | 6/8
14 h-m-p 0.0011 0.5327 1.7057 +++++ 585.739139 m 0.5327 223 | 7/8
15 h-m-p 1.4111 8.0000 0.6078 ++ 585.739118 m 8.0000 234 | 7/8
16 h-m-p 1.6000 8.0000 0.6219 ++ 585.739114 m 8.0000 246 | 7/8
17 h-m-p 1.6000 8.0000 2.7080 ++ 585.739110 m 8.0000 258 | 7/8
18 h-m-p 1.6000 8.0000 2.4341 ++ 585.739109 m 8.0000 269 | 7/8
19 h-m-p 0.0033 0.0167 3185.7450 ---------Y 585.739109 0 0.0000 289 | 7/8
20 h-m-p 0.1000 8.0000 0.0000 Y 585.739109 0 0.0250 300 | 7/8
21 h-m-p 0.7806 8.0000 0.0000 -Y 585.739109 0 0.0488 313
Out..
lnL = -585.739109
314 lfun, 314 eigenQcodon, 1884 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097377 0.066084 0.065019 0.045166 0.105872 0.015698 0.000100 0.714862 0.457928
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.626438
np = 9
lnL0 = -641.883375
Iterating by ming2
Initial: fx= 641.883375
x= 0.09738 0.06608 0.06502 0.04517 0.10587 0.01570 0.00011 0.71486 0.45793
1 h-m-p 0.0000 0.0000 340.8852 ++ 641.225448 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 232.2833 +++ 628.395135 m 0.0003 27 | 2/9
3 h-m-p 0.0001 0.0006 131.0869 ++ 610.818463 m 0.0006 39 | 3/9
4 h-m-p 0.0003 0.0014 161.1964 ++ 593.661101 m 0.0014 51 | 4/9
5 h-m-p 0.0000 0.0000 426.1207 ++ 593.261579 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 11296.9940 ++ 590.172566 m 0.0000 75 | 5/9
7 h-m-p 0.0000 0.0000 6.8330
h-m-p: 3.12047347e-20 1.56023673e-19 6.83303170e+00 590.172566
.. | 5/9
8 h-m-p 0.0000 0.0001 209.1027 ++ 586.477094 m 0.0001 96 | 6/9
9 h-m-p 0.0001 0.0003 50.8798 ++ 585.739332 m 0.0003 108 | 7/9
10 h-m-p 1.6000 8.0000 0.0001 ++ 585.739331 m 8.0000 120 | 7/9
11 h-m-p 0.0160 8.0000 0.1168 +++++ 585.739171 m 8.0000 137 | 7/9
12 h-m-p 0.3993 1.9965 0.0473 ++ 585.739168 m 1.9965 151 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 585.739168 0 1.6000 165
Out..
lnL = -585.739168
166 lfun, 498 eigenQcodon, 1992 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056415 0.037030 0.061179 0.060795 0.100353 0.024255 0.000100 0.827122 0.235438 0.157520 53.697998
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.959253
np = 11
lnL0 = -613.861032
Iterating by ming2
Initial: fx= 613.861032
x= 0.05641 0.03703 0.06118 0.06080 0.10035 0.02426 0.00011 0.82712 0.23544 0.15752 53.69800
1 h-m-p 0.0000 0.0000 109.8792 ++ 613.793034 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0365 17.5304 +++++ 604.108985 m 0.0365 33 | 2/11
3 h-m-p 0.0025 0.0126 11.6842 ++ 602.520709 m 0.0126 47 | 3/11
4 h-m-p 0.0001 0.0003 721.8346 ++ 597.358722 m 0.0003 61 | 4/11
5 h-m-p 0.0003 0.0015 83.8563 ++ 596.382050 m 0.0015 75 | 5/11
6 h-m-p 0.0004 0.0020 168.7479 ++ 594.689430 m 0.0020 89 | 6/11
7 h-m-p 0.0009 0.0069 358.5438 ++ 590.359480 m 0.0069 103 | 7/11
8 h-m-p 0.0004 0.0019 956.8065 ++ 585.739124 m 0.0019 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0040 ++ 585.739123 m 8.0000 131 | 8/11
10 h-m-p 0.0210 8.0000 1.5355 +++Y 585.739114 0 1.3461 151 | 8/11
11 h-m-p 1.6000 8.0000 0.1717 Y 585.739114 0 3.1799 165 | 8/11
12 h-m-p 1.6000 8.0000 0.0265 Y 585.739114 0 1.2398 182 | 8/11
13 h-m-p 1.6000 8.0000 0.0018 Y 585.739114 0 1.0787 199 | 8/11
14 h-m-p 1.6000 8.0000 0.0007 ++ 585.739114 m 8.0000 216 | 8/11
15 h-m-p 1.6000 8.0000 0.0012 ++ 585.739114 m 8.0000 233 | 8/11
16 h-m-p 0.4765 8.0000 0.0199 +C 585.739114 0 2.1414 251 | 8/11
17 h-m-p 1.6000 8.0000 0.0006 ++ 585.739114 m 8.0000 268 | 8/11
18 h-m-p 0.0160 8.0000 1.1537 +++++ 585.739109 m 8.0000 288 | 8/11
19 h-m-p 1.6000 8.0000 0.1799 ++ 585.739109 m 8.0000 302 | 8/11
20 h-m-p 1.6000 8.0000 0.3869 ++ 585.739109 m 8.0000 319 | 8/11
21 h-m-p 1.6000 8.0000 0.1679 +Y 585.739109 0 4.4294 337 | 8/11
22 h-m-p 1.6000 8.0000 0.0097 ++ 585.739109 m 8.0000 354 | 8/11
23 h-m-p 0.0906 8.0000 0.8544 +++Y 585.739109 0 6.3915 374 | 8/11
24 h-m-p 1.0206 8.0000 5.3504 -C 585.739109 0 0.0638 392 | 8/11
25 h-m-p 1.4835 8.0000 0.2301 -----C 585.739109 0 0.0004 411 | 8/11
26 h-m-p 0.0160 8.0000 0.0864 +++C 585.739109 0 1.0240 431 | 8/11
27 h-m-p 0.2813 8.0000 0.3146 Y 585.739109 0 0.0452 448 | 8/11
28 h-m-p 1.6000 8.0000 0.0059 ------C 585.739109 0 0.0001 471 | 8/11
29 h-m-p 0.5290 8.0000 0.0000 +C 585.739109 0 2.1160 489 | 8/11
30 h-m-p 0.1041 8.0000 0.0000 -------------Y 585.739109 0 0.0000 519
Out..
lnL = -585.739109
520 lfun, 2080 eigenQcodon, 9360 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -585.735880 S = -585.735722 -0.000060
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:03
did 20 / 50 patterns 0:03
did 30 / 50 patterns 0:03
did 40 / 50 patterns 0:03
did 50 / 50 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080713 0.100841 0.084338 0.033372 0.073899 0.068553 0.000100 1.016645 1.837754
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.327587
np = 9
lnL0 = -647.829871
Iterating by ming2
Initial: fx= 647.829871
x= 0.08071 0.10084 0.08434 0.03337 0.07390 0.06855 0.00011 1.01664 1.83775
1 h-m-p 0.0000 0.0000 329.5981 ++ 647.459693 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0393 26.5383 ++++YYYCCCCC 647.068950 7 0.0209 41 | 1/9
3 h-m-p 0.0220 0.1102 2.4390 -------------.. | 1/9
4 h-m-p 0.0000 0.0003 322.7582 +++ 617.537416 m 0.0003 77 | 2/9
5 h-m-p 0.0053 0.1145 15.2377 ------------.. | 2/9
6 h-m-p 0.0000 0.0002 311.1627 +++ 594.614556 m 0.0002 112 | 3/9
7 h-m-p 0.0062 0.2013 10.3085 ------------.. | 3/9
8 h-m-p 0.0000 0.0000 291.4443 ++ 591.732138 m 0.0000 146 | 4/9
9 h-m-p 0.0007 0.3074 12.4202 -----------.. | 4/9
10 h-m-p 0.0000 0.0000 253.6577 ++ 588.980655 m 0.0000 179 | 5/9
11 h-m-p 0.0008 0.3762 11.9800 -----------.. | 5/9
12 h-m-p 0.0000 0.0000 208.1925 ++ 587.989153 m 0.0000 212 | 6/9
13 h-m-p 0.0010 0.4823 10.4959 -----------.. | 6/9
14 h-m-p 0.0000 0.0001 147.1830 ++ 585.739266 m 0.0001 245 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 ++ 585.739266 m 8.0000 257 | 7/9
16 h-m-p 0.0160 8.0000 0.0338 -------C 585.739266 0 0.0000 278 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 ----N 585.739266 0 0.0000 296 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 Y 585.739266 0 0.0040 310 | 7/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 585.739266 m 8.0000 327 | 7/9
20 h-m-p 0.0160 8.0000 0.7897 +++++ 585.739261 m 8.0000 344 | 7/9
21 h-m-p 1.6000 8.0000 0.3920 ++ 585.739260 m 8.0000 358 | 7/9
22 h-m-p 0.8710 8.0000 3.6008 ++ 585.739259 m 8.0000 372 | 7/9
23 h-m-p 1.6000 8.0000 2.6050 ++ 585.739259 m 8.0000 384 | 7/9
24 h-m-p 0.1920 0.9598 63.2151 --------Y 585.739259 0 0.0000 404 | 7/9
25 h-m-p 1.6000 8.0000 0.0000 --------C 585.739259 0 0.0000 424 | 7/9
26 h-m-p 0.2025 8.0000 0.0000 -------N 585.739259 0 0.0000 445
Out..
lnL = -585.739259
446 lfun, 4906 eigenQcodon, 26760 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094641 0.109496 0.082162 0.062514 0.011590 0.032428 0.000100 0.900000 0.817747 1.170531 53.133087
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 2.003394
np = 11
lnL0 = -606.495703
Iterating by ming2
Initial: fx= 606.495703
x= 0.09464 0.10950 0.08216 0.06251 0.01159 0.03243 0.00011 0.90000 0.81775 1.17053 53.13309
1 h-m-p 0.0000 0.0000 90.8965 ++ 606.453395 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 208.6843 ++ 604.272113 m 0.0001 30 | 2/11
3 h-m-p 0.0020 0.0234 13.2341 +YCYYCCC 597.803584 6 0.0175 55 | 2/11
4 h-m-p 0.0017 0.0083 11.7991 ++ 597.074065 m 0.0083 69 | 3/11
5 h-m-p 0.0003 0.0016 51.0681 ++ 596.670971 m 0.0016 83 | 4/11
6 h-m-p 0.0002 0.0008 179.3096 ++ 595.636966 m 0.0008 97 | 5/11
7 h-m-p 0.0001 0.0007 478.1454 ++ 593.249413 m 0.0007 111 | 6/11
8 h-m-p 0.0001 0.0007 264.3951 ++ 591.582854 m 0.0007 125 | 7/11
9 h-m-p 0.0000 0.0000 6931.2451 ++ 587.442548 m 0.0000 139 | 7/11
10 h-m-p 0.1962 8.0000 1.3630
QuantileBeta(0.15, 0.00500, 2.30549) = 1.126100e-160 2000 rounds
---------------.. | 7/11
11 h-m-p 0.0000 0.0001 275.7356 ++ 585.739172 m 0.0001 180 | 8/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 585.739172 m 8.0000 194 | 8/11
13 h-m-p 0.0160 8.0000 0.0466 +++++ 585.739121 m 8.0000 214 | 8/11
14 h-m-p 1.6000 8.0000 0.0172 ++ 585.739118 m 8.0000 231 | 8/11
15 h-m-p 0.6691 8.0000 0.2058 ++ 585.739110 m 8.0000 248 | 8/11
16 h-m-p 1.6000 8.0000 0.1294 ++ 585.739109 m 8.0000 265 | 8/11
17 h-m-p 0.2888 1.4438 0.9160 ++ 585.739109 m 1.4438 282 | 9/11
18 h-m-p 0.4505 8.0000 2.8654 +++ 585.739109 m 8.0000 300 | 9/11
19 h-m-p 1.6000 8.0000 8.4927 ++ 585.739108 m 8.0000 314 | 9/11
20 h-m-p 1.6000 8.0000 14.5580 ---------C 585.739108 0 0.0000 337 | 9/11
21 h-m-p 1.6000 8.0000 0.0000 ----Y 585.739108 0 0.0006 355 | 9/11
22 h-m-p 0.4588 8.0000 0.0000 ----C 585.739108 0 0.0004 375
Out..
lnL = -585.739108
376 lfun, 4512 eigenQcodon, 24816 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -585.735781 S = -585.735708 -0.000032
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:16
did 20 / 50 patterns 0:17
did 30 / 50 patterns 0:17
did 40 / 50 patterns 0:17
did 50 / 50 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=146
NC_011896_1_WP_010908567_1_1966_MLBR_RS09330 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
NC_002677_1_NP_302246_1_1118_rplO VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE
**************************************************
NC_011896_1_WP_010908567_1_1966_MLBR_RS09330 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
NC_002677_1_NP_302246_1_1118_rplO GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400 GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK
**************************************************
NC_011896_1_WP_010908567_1_1966_MLBR_RS09330 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
NC_002677_1_NP_302246_1_1118_rplO KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400 KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
**********************************************
>NC_011896_1_WP_010908567_1_1966_MLBR_RS09330 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC >NC_002677_1_NP_302246_1_1118_rplO GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC >NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC >NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC >NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC >NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400 GTGACGATTAAGCTGCACGACCTGCAACCTGCGCGCGGGTCGAAAACTAC ACGTACCCGGGTCGGCCGCGGTGAGGCCTCGAAAGGCAAGACGGCTGGCC GCGGTACCAAGGGTACCAAAGCCCGTAAGCAGGTACCAGTGACCTTTGAG GGCGGGCAGATGCCAATCCACATGCGGTTGCCTAAGCTGAAGGGATTCCG GAATCGATTACGGACAGAATATGCGGTCGTCAATGTCGGTGACATAAGCC GGCTGTTCCCTGAAGGCGGCACAATCAGCGTAAACGACTTAGTCGCCAAG AAAGCTATTCGTAAAAACTCATTGGTTAAAATTCTAGGTGACGGCAAGCT GACTGTCAAAGTCACCCTGTCCGCGCATAAGTTCAGCGGCAGTGCGCGTC ACAAGATCACCGTAGCTGGCGGCTCTGTTACCGAGCTC
>NC_011896_1_WP_010908567_1_1966_MLBR_RS09330 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL >NC_002677_1_NP_302246_1_1118_rplO VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL >NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL >NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL >NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL >NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400 VTIKLHDLQPARGSKTTRTRVGRGEASKGKTAGRGTKGTKARKQVPVTFE GGQMPIHMRLPKLKGFRNRLRTEYAVVNVGDISRLFPEGGTISVNDLVAK KAIRKNSLVKILGDGKLTVKVTLSAHKFSGSARHKITVAGGSVTEL
#NEXUS
[ID: 0793890995]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908567_1_1966_MLBR_RS09330
NC_002677_1_NP_302246_1_1118_rplO
NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355
NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425
NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135
NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908567_1_1966_MLBR_RS09330,
2 NC_002677_1_NP_302246_1_1118_rplO,
3 NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355,
4 NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425,
5 NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135,
6 NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07106122,2:0.06988855,3:0.06509452,4:0.06949639,5:0.06742885,6:0.06749422);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07106122,2:0.06988855,3:0.06509452,4:0.06949639,5:0.06742885,6:0.06749422);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -603.41 -606.69
2 -603.43 -606.48
--------------------------------------
TOTAL -603.42 -606.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884346 0.087811 0.349787 1.447047 0.851087 1243.05 1372.03 1.000
r(A<->C){all} 0.161795 0.019550 0.000101 0.445047 0.124325 171.04 200.58 1.005
r(A<->G){all} 0.169363 0.020978 0.000061 0.468438 0.130141 159.96 165.42 1.000
r(A<->T){all} 0.173305 0.021172 0.000287 0.466521 0.135033 131.47 192.24 1.000
r(C<->G){all} 0.167415 0.019454 0.000005 0.461365 0.131933 302.20 386.76 1.016
r(C<->T){all} 0.168054 0.019995 0.000007 0.459478 0.129286 157.81 266.83 1.001
r(G<->T){all} 0.160068 0.018868 0.000002 0.443485 0.124643 223.99 257.23 1.000
pi(A){all} 0.253257 0.000444 0.211013 0.292368 0.253071 1179.97 1192.86 1.000
pi(C){all} 0.267374 0.000428 0.226649 0.307353 0.267136 1093.70 1145.50 1.000
pi(G){all} 0.291612 0.000456 0.249537 0.331716 0.291285 1202.18 1278.85 1.000
pi(T){all} 0.187756 0.000351 0.152591 0.225858 0.187032 1501.00 1501.00 1.000
alpha{1,2} 0.413763 0.240434 0.000227 1.390792 0.244296 1232.55 1240.69 1.000
alpha{3} 0.467090 0.235466 0.000312 1.463892 0.301254 1307.83 1333.39 1.000
pinvar{all} 0.996365 0.000018 0.988505 0.999999 0.997777 1163.02 1185.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplO/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 146
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 0 0 0 0 0 0 | CAG 2 2 2 2 2 2 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 7 7 7 7 7 7 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 7 7 7 7 7 7 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 10 10 10 10 10 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 0 0 0 0 0 0 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 3 3 3 3 3 3 | GAC 4 4 4 4 4 4 | GGC 10 10 10 10 10 10
GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908567_1_1966_MLBR_RS09330
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
#2: NC_002677_1_NP_302246_1_1118_rplO
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
#3: NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
#4: NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
#5: NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
#6: NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 24
CTC 6 | CCC 0 | CAC 18 | CGC 18
CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 6
CTG 36 | CCG 0 | CAG 12 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 6
ATC 18 | ACC 42 | AAC 12 | AGC 18
ATA 6 | ACA 18 | Lys K AAA 42 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 0 | Gly G GGT 30
GTC 42 | GCC 18 | GAC 24 | GGC 60
GTA 18 | GCA 0 | Glu E GAA 12 | GGA 6
GTG 12 | GCG 24 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09589 C:0.22603 A:0.32877 G:0.34932
position 2: T:0.26712 C:0.23288 A:0.26027 G:0.23973
position 3: T:0.19863 C:0.34247 A:0.17123 G:0.28767
Average T:0.18721 C:0.26712 A:0.25342 G:0.29224
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -585.739109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 53.133087
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908567_1_1966_MLBR_RS09330: 0.000004, NC_002677_1_NP_302246_1_1118_rplO: 0.000004, NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355: 0.000004, NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425: 0.000004, NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135: 0.000004, NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 53.13309
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
7..2 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
7..3 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
7..4 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
7..5 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
7..6 0.000 347.2 90.8 53.1331 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -585.739168 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.663514 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908567_1_1966_MLBR_RS09330: 0.000004, NC_002677_1_NP_302246_1_1118_rplO: 0.000004, NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355: 0.000004, NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425: 0.000004, NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135: 0.000004, NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66351 0.33649
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 347.2 90.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -585.739109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.001061 0.001817 0.000001 52.622212
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908567_1_1966_MLBR_RS09330: 0.000004, NC_002677_1_NP_302246_1_1118_rplO: 0.000004, NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355: 0.000004, NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425: 0.000004, NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135: 0.000004, NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00106 0.00182 0.99712
w: 0.00000 1.00000 52.62221
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
7..2 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
7..3 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
7..4 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
7..5 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
7..6 0.000 347.2 90.8 52.4726 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908567_1_1966_MLBR_RS09330)
Pr(w>1) post mean +- SE for w
1 V 0.997** 52.473
2 T 0.997** 52.473
3 I 0.997** 52.473
4 K 0.997** 52.473
5 L 0.997** 52.473
6 H 0.997** 52.473
7 D 0.997** 52.473
8 L 0.997** 52.473
9 Q 0.997** 52.473
10 P 0.997** 52.473
11 A 0.997** 52.473
12 R 0.997** 52.473
13 G 0.997** 52.473
14 S 0.997** 52.473
15 K 0.997** 52.473
16 T 0.997** 52.473
17 T 0.997** 52.473
18 R 0.997** 52.473
19 T 0.997** 52.473
20 R 0.997** 52.473
21 V 0.997** 52.473
22 G 0.997** 52.473
23 R 0.997** 52.473
24 G 0.997** 52.473
25 E 0.997** 52.473
26 A 0.997** 52.473
27 S 0.997** 52.473
28 K 0.997** 52.473
29 G 0.997** 52.473
30 K 0.997** 52.473
31 T 0.997** 52.473
32 A 0.997** 52.473
33 G 0.997** 52.473
34 R 0.997** 52.473
35 G 0.997** 52.473
36 T 0.997** 52.473
37 K 0.997** 52.473
38 G 0.997** 52.473
39 T 0.997** 52.473
40 K 0.997** 52.473
41 A 0.997** 52.473
42 R 0.997** 52.473
43 K 0.997** 52.473
44 Q 0.997** 52.473
45 V 0.997** 52.473
46 P 0.997** 52.473
47 V 0.997** 52.473
48 T 0.997** 52.473
49 F 0.997** 52.473
50 E 0.997** 52.473
51 G 0.997** 52.473
52 G 0.997** 52.473
53 Q 0.997** 52.473
54 M 0.997** 52.473
55 P 0.997** 52.473
56 I 0.997** 52.473
57 H 0.997** 52.473
58 M 0.997** 52.473
59 R 0.997** 52.473
60 L 0.997** 52.473
61 P 0.997** 52.473
62 K 0.997** 52.473
63 L 0.997** 52.473
64 K 0.997** 52.473
65 G 0.997** 52.473
66 F 0.997** 52.473
67 R 0.997** 52.473
68 N 0.997** 52.473
69 R 0.997** 52.473
70 L 0.997** 52.473
71 R 0.997** 52.473
72 T 0.997** 52.473
73 E 0.997** 52.473
74 Y 0.997** 52.473
75 A 0.997** 52.473
76 V 0.997** 52.473
77 V 0.997** 52.473
78 N 0.997** 52.473
79 V 0.997** 52.473
80 G 0.997** 52.473
81 D 0.997** 52.473
82 I 0.997** 52.473
83 S 0.997** 52.473
84 R 0.997** 52.473
85 L 0.997** 52.473
86 F 0.997** 52.473
87 P 0.997** 52.473
88 E 0.997** 52.473
89 G 0.997** 52.473
90 G 0.997** 52.473
91 T 0.997** 52.473
92 I 0.997** 52.473
93 S 0.997** 52.473
94 V 0.997** 52.473
95 N 0.997** 52.473
96 D 0.997** 52.473
97 L 0.997** 52.473
98 V 0.997** 52.473
99 A 0.997** 52.473
100 K 0.997** 52.473
101 K 0.997** 52.473
102 A 0.997** 52.473
103 I 0.997** 52.473
104 R 0.997** 52.473
105 K 0.997** 52.473
106 N 0.997** 52.473
107 S 0.997** 52.473
108 L 0.997** 52.473
109 V 0.997** 52.473
110 K 0.997** 52.473
111 I 0.997** 52.473
112 L 0.997** 52.473
113 G 0.997** 52.473
114 D 0.997** 52.473
115 G 0.997** 52.473
116 K 0.997** 52.473
117 L 0.997** 52.473
118 T 0.997** 52.473
119 V 0.997** 52.473
120 K 0.997** 52.473
121 V 0.997** 52.473
122 T 0.997** 52.473
123 L 0.997** 52.473
124 S 0.997** 52.473
125 A 0.997** 52.473
126 H 0.997** 52.473
127 K 0.997** 52.473
128 F 0.997** 52.473
129 S 0.997** 52.473
130 G 0.997** 52.473
131 S 0.997** 52.473
132 A 0.997** 52.473
133 R 0.997** 52.473
134 H 0.997** 52.473
135 K 0.997** 52.473
136 I 0.997** 52.473
137 T 0.997** 52.473
138 V 0.997** 52.473
139 A 0.997** 52.473
140 G 0.997** 52.473
141 G 0.997** 52.473
142 S 0.997** 52.473
143 V 0.997** 52.473
144 T 0.997** 52.473
145 E 0.997** 52.473
146 L 0.997** 52.473
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908567_1_1966_MLBR_RS09330)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -585.739259 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 18.335385 58.039806
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908567_1_1966_MLBR_RS09330: 0.000004, NC_002677_1_NP_302246_1_1118_rplO: 0.000004, NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355: 0.000004, NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425: 0.000004, NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135: 0.000004, NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 18.33539 q = 58.03981
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.16421 0.18978 0.20593 0.21932 0.23169 0.24397 0.25695 0.27175 0.29074 0.32372
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
7..2 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
7..3 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
7..4 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
7..5 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
7..6 0.000 347.2 90.8 0.2398 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -585.739108 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 2.033873 148.457661
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908567_1_1966_MLBR_RS09330: 0.000004, NC_002677_1_NP_302246_1_1118_rplO: 0.000004, NZ_LVXE01000061_1_WP_010908567_1_2376_A3216_RS12355: 0.000004, NZ_LYPH01000044_1_WP_010908567_1_1767_A8144_RS08425: 0.000004, NZ_CP029543_1_WP_010908567_1_1991_DIJ64_RS10135: 0.000004, NZ_AP014567_1_WP_010908567_1_2044_JK2ML_RS10400: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.03387
(p1 = 0.99999) w = 148.45766
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 148.45766
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
7..2 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
7..3 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
7..4 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
7..5 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
7..6 0.000 347.2 90.8 148.4562 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908567_1_1966_MLBR_RS09330)
Pr(w>1) post mean +- SE for w
1 V 1.000** 148.456
2 T 1.000** 148.456
3 I 1.000** 148.456
4 K 1.000** 148.456
5 L 1.000** 148.456
6 H 1.000** 148.456
7 D 1.000** 148.456
8 L 1.000** 148.456
9 Q 1.000** 148.456
10 P 1.000** 148.456
11 A 1.000** 148.456
12 R 1.000** 148.456
13 G 1.000** 148.456
14 S 1.000** 148.456
15 K 1.000** 148.456
16 T 1.000** 148.456
17 T 1.000** 148.456
18 R 1.000** 148.456
19 T 1.000** 148.456
20 R 1.000** 148.456
21 V 1.000** 148.456
22 G 1.000** 148.456
23 R 1.000** 148.456
24 G 1.000** 148.456
25 E 1.000** 148.456
26 A 1.000** 148.456
27 S 1.000** 148.456
28 K 1.000** 148.456
29 G 1.000** 148.456
30 K 1.000** 148.456
31 T 1.000** 148.456
32 A 1.000** 148.456
33 G 1.000** 148.456
34 R 1.000** 148.456
35 G 1.000** 148.456
36 T 1.000** 148.456
37 K 1.000** 148.456
38 G 1.000** 148.456
39 T 1.000** 148.456
40 K 1.000** 148.456
41 A 1.000** 148.456
42 R 1.000** 148.456
43 K 1.000** 148.456
44 Q 1.000** 148.456
45 V 1.000** 148.456
46 P 1.000** 148.456
47 V 1.000** 148.456
48 T 1.000** 148.456
49 F 1.000** 148.456
50 E 1.000** 148.456
51 G 1.000** 148.456
52 G 1.000** 148.456
53 Q 1.000** 148.456
54 M 1.000** 148.456
55 P 1.000** 148.456
56 I 1.000** 148.456
57 H 1.000** 148.456
58 M 1.000** 148.456
59 R 1.000** 148.456
60 L 1.000** 148.456
61 P 1.000** 148.456
62 K 1.000** 148.456
63 L 1.000** 148.456
64 K 1.000** 148.456
65 G 1.000** 148.456
66 F 1.000** 148.456
67 R 1.000** 148.456
68 N 1.000** 148.456
69 R 1.000** 148.456
70 L 1.000** 148.456
71 R 1.000** 148.456
72 T 1.000** 148.456
73 E 1.000** 148.456
74 Y 1.000** 148.456
75 A 1.000** 148.456
76 V 1.000** 148.456
77 V 1.000** 148.456
78 N 1.000** 148.456
79 V 1.000** 148.456
80 G 1.000** 148.456
81 D 1.000** 148.456
82 I 1.000** 148.456
83 S 1.000** 148.456
84 R 1.000** 148.456
85 L 1.000** 148.456
86 F 1.000** 148.456
87 P 1.000** 148.456
88 E 1.000** 148.456
89 G 1.000** 148.456
90 G 1.000** 148.456
91 T 1.000** 148.456
92 I 1.000** 148.456
93 S 1.000** 148.456
94 V 1.000** 148.456
95 N 1.000** 148.456
96 D 1.000** 148.456
97 L 1.000** 148.456
98 V 1.000** 148.456
99 A 1.000** 148.456
100 K 1.000** 148.456
101 K 1.000** 148.456
102 A 1.000** 148.456
103 I 1.000** 148.456
104 R 1.000** 148.456
105 K 1.000** 148.456
106 N 1.000** 148.456
107 S 1.000** 148.456
108 L 1.000** 148.456
109 V 1.000** 148.456
110 K 1.000** 148.456
111 I 1.000** 148.456
112 L 1.000** 148.456
113 G 1.000** 148.456
114 D 1.000** 148.456
115 G 1.000** 148.456
116 K 1.000** 148.456
117 L 1.000** 148.456
118 T 1.000** 148.456
119 V 1.000** 148.456
120 K 1.000** 148.456
121 V 1.000** 148.456
122 T 1.000** 148.456
123 L 1.000** 148.456
124 S 1.000** 148.456
125 A 1.000** 148.456
126 H 1.000** 148.456
127 K 1.000** 148.456
128 F 1.000** 148.456
129 S 1.000** 148.456
130 G 1.000** 148.456
131 S 1.000** 148.456
132 A 1.000** 148.456
133 R 1.000** 148.456
134 H 1.000** 148.456
135 K 1.000** 148.456
136 I 1.000** 148.456
137 T 1.000** 148.456
138 V 1.000** 148.456
139 A 1.000** 148.456
140 G 1.000** 148.456
141 G 1.000** 148.456
142 S 1.000** 148.456
143 V 1.000** 148.456
144 T 1.000** 148.456
145 E 1.000** 148.456
146 L 1.000** 148.456
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908567_1_1966_MLBR_RS09330)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -585.739168 Model 2: PositiveSelection -585.739109 Model 0: one-ratio -585.739109 Model 7: beta -585.739259 Model 8: beta&w>1 -585.739108 Model 0 vs 1 1.1799999992945231E-4 Model 2 vs 1 1.1799999992945231E-4 Model 8 vs 7 3.019999999196443E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
