--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:41:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplQ/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -686.18 -690.35
2 -686.18 -690.26
--------------------------------------
TOTAL -686.18 -690.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891952 0.091791 0.356776 1.492926 0.856596 1414.68 1457.84 1.001
r(A<->C){all} 0.171706 0.019796 0.000012 0.460638 0.138939 252.87 274.37 1.000
r(A<->G){all} 0.164955 0.019044 0.000022 0.443564 0.130478 189.53 216.66 1.003
r(A<->T){all} 0.156423 0.017182 0.000057 0.416916 0.122704 246.16 248.48 1.003
r(C<->G){all} 0.173185 0.020650 0.000077 0.468124 0.134488 231.22 334.95 1.001
r(C<->T){all} 0.169615 0.019927 0.000115 0.450104 0.132268 192.71 209.87 1.000
r(G<->T){all} 0.164116 0.017980 0.000006 0.422795 0.132137 155.92 213.02 1.000
pi(A){all} 0.235326 0.000353 0.197574 0.270429 0.235118 1236.05 1287.37 1.000
pi(C){all} 0.311761 0.000424 0.273215 0.353232 0.311398 1274.22 1281.05 1.000
pi(G){all} 0.312892 0.000416 0.272551 0.351762 0.312475 1165.77 1235.09 1.000
pi(T){all} 0.140021 0.000243 0.110820 0.171722 0.139352 1492.57 1496.79 1.000
alpha{1,2} 0.420672 0.236706 0.000187 1.440990 0.240545 1287.36 1300.21 1.000
alpha{3} 0.437439 0.221145 0.000202 1.413727 0.286054 1270.69 1271.29 1.000
pinvar{all} 0.996897 0.000015 0.990073 0.999999 0.998095 829.42 979.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -653.20654
Model 2: PositiveSelection -653.206538
Model 0: one-ratio -653.206535
Model 7: beta -653.206523
Model 8: beta&w>1 -653.206551
Model 0 vs 1 9.999999974752427E-6
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 5.600000008598727E-5
>C1
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C2
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C3
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C4
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C5
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C6
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=170
C1 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C2 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C3 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C4 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C5 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C6 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
**************************************************
C1 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C2 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C3 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C4 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C5 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C6 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
**************************************************
C1 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C2 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C3 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C4 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C5 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C6 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
**************************************************
C1 VEATSDEVAYTSEPDKAAEH
C2 VEATSDEVAYTSEPDKAAEH
C3 VEATSDEVAYTSEPDKAAEH
C4 VEATSDEVAYTSEPDKAAEH
C5 VEATSDEVAYTSEPDKAAEH
C6 VEATSDEVAYTSEPDKAAEH
********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 170 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 170 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5100]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5100]--->[5100]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.472 Mb, Max= 30.708 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C2 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C3 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C4 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C5 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C6 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
**************************************************
C1 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C2 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C3 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C4 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C5 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C6 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
**************************************************
C1 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C2 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C3 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C4 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C5 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C6 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
**************************************************
C1 VEATSDEVAYTSEPDKAAEH
C2 VEATSDEVAYTSEPDKAAEH
C3 VEATSDEVAYTSEPDKAAEH
C4 VEATSDEVAYTSEPDKAAEH
C5 VEATSDEVAYTSEPDKAAEH
C6 VEATSDEVAYTSEPDKAAEH
********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C2 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C3 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C4 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C5 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C6 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
**************************************************
C1 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C2 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C3 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C4 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C5 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C6 AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
**************************************************
C1 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C2 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C3 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C4 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C5 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C6 TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
**************************************************
C1 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C2 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C3 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C4 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C5 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C6 CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
**************************************************
C1 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C2 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C3 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C4 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C5 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C6 GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
**************************************************
C1 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C2 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C3 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C4 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C5 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C6 GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
**************************************************
C1 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C2 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C3 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C4 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C5 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C6 GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
**************************************************
C1 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C2 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C3 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C4 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C5 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C6 GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
**************************************************
C1 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C2 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C3 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C4 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C5 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C6 CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
**************************************************
C1 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C2 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C3 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C4 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C5 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C6 GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
**************************************************
C1 CGCCGAACAT
C2 CGCCGAACAT
C3 CGCCGAACAT
C4 CGCCGAACAT
C5 CGCCGAACAT
C6 CGCCGAACAT
**********
>C1
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C2
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C3
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C4
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C5
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C6
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C1
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C2
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C3
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C4
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C5
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C6
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 510 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790407
Setting output file names to "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1489751643
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0845803344
Seed = 345399571
Swapseed = 1579790407
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1141.404454 -- -24.965149
Chain 2 -- -1141.404279 -- -24.965149
Chain 3 -- -1141.404279 -- -24.965149
Chain 4 -- -1141.404454 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1141.404389 -- -24.965149
Chain 2 -- -1141.404279 -- -24.965149
Chain 3 -- -1141.404454 -- -24.965149
Chain 4 -- -1141.404279 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1141.404] (-1141.404) (-1141.404) (-1141.404) * [-1141.404] (-1141.404) (-1141.404) (-1141.404)
500 -- [-692.640] (-704.746) (-703.376) (-712.773) * [-702.750] (-703.885) (-701.329) (-715.571) -- 0:00:00
1000 -- [-692.553] (-694.909) (-701.686) (-702.684) * [-694.004] (-696.014) (-691.130) (-704.375) -- 0:00:00
1500 -- (-697.978) [-688.543] (-693.685) (-693.017) * [-691.684] (-697.738) (-690.702) (-700.540) -- 0:00:00
2000 -- [-693.913] (-695.144) (-695.334) (-695.685) * [-699.520] (-693.069) (-692.661) (-696.038) -- 0:00:00
2500 -- [-694.590] (-697.318) (-697.686) (-692.961) * (-695.025) [-693.202] (-694.117) (-693.633) -- 0:00:00
3000 -- (-705.102) [-692.798] (-694.526) (-693.815) * (-696.130) (-699.547) [-694.471] (-700.182) -- 0:00:00
3500 -- (-698.093) (-697.213) (-690.422) [-696.521] * (-693.763) [-694.763] (-694.970) (-692.713) -- 0:00:00
4000 -- (-694.853) (-695.008) (-690.376) [-693.768] * (-701.098) (-699.190) [-689.668] (-695.543) -- 0:00:00
4500 -- [-694.907] (-692.295) (-691.579) (-695.743) * (-697.538) [-694.098] (-696.595) (-694.828) -- 0:00:00
5000 -- (-693.983) [-692.994] (-694.170) (-693.056) * (-700.597) [-692.058] (-699.123) (-690.774) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-697.876) [-691.184] (-699.855) (-703.222) * (-692.133) [-693.826] (-692.908) (-686.032) -- 0:00:00
6000 -- (-703.054) (-700.157) (-696.783) [-696.696] * (-704.279) [-692.602] (-691.422) (-687.561) -- 0:00:00
6500 -- (-705.086) (-697.757) [-693.635] (-689.312) * [-692.722] (-694.109) (-692.818) (-685.783) -- 0:02:32
7000 -- (-699.610) [-699.251] (-704.170) (-696.343) * (-699.855) [-698.393] (-693.257) (-686.855) -- 0:02:21
7500 -- (-699.908) (-701.891) [-700.364] (-695.211) * [-689.262] (-696.688) (-696.018) (-690.722) -- 0:02:12
8000 -- (-699.340) (-708.608) [-689.663] (-692.597) * (-692.008) [-686.368] (-694.118) (-686.529) -- 0:02:04
8500 -- (-702.061) (-697.973) [-691.377] (-692.995) * (-701.102) (-686.391) [-702.409] (-686.644) -- 0:01:56
9000 -- (-702.061) [-692.613] (-698.544) (-695.487) * (-706.803) (-687.519) (-696.902) [-685.541] -- 0:01:50
9500 -- (-695.534) (-702.919) (-699.222) [-691.776] * (-700.446) (-688.467) [-698.818] (-691.543) -- 0:01:44
10000 -- (-698.107) (-697.668) [-704.481] (-689.705) * [-693.750] (-694.906) (-692.935) (-687.824) -- 0:01:39
Average standard deviation of split frequencies: 0.072920
10500 -- (-694.445) (-709.149) (-697.449) [-690.758] * (-694.067) (-693.425) (-694.042) [-687.672] -- 0:01:34
11000 -- (-699.321) [-691.409] (-719.010) (-692.163) * (-711.381) (-686.027) [-697.748] (-686.831) -- 0:01:29
11500 -- (-693.645) (-690.647) (-706.945) [-696.912] * [-693.397] (-685.361) (-703.816) (-687.503) -- 0:01:25
12000 -- [-699.279] (-690.085) (-693.790) (-692.683) * [-695.739] (-685.848) (-703.153) (-687.063) -- 0:01:22
12500 -- [-692.382] (-701.396) (-691.367) (-693.845) * (-694.191) (-687.457) (-692.854) [-685.244] -- 0:01:19
13000 -- [-700.972] (-714.093) (-685.645) (-692.899) * (-694.644) (-685.732) [-700.773] (-685.363) -- 0:01:15
13500 -- (-702.050) (-695.780) (-685.829) [-698.580] * (-699.447) (-685.727) [-697.800] (-685.343) -- 0:01:13
14000 -- (-692.827) (-691.514) [-689.276] (-692.456) * (-688.424) (-691.393) [-691.295] (-686.573) -- 0:01:10
14500 -- (-698.954) [-688.909] (-684.875) (-694.219) * (-699.754) [-687.433] (-700.476) (-687.059) -- 0:01:07
15000 -- (-693.908) (-685.862) (-688.101) [-692.032] * (-698.145) (-687.115) [-693.213] (-686.492) -- 0:01:05
Average standard deviation of split frequencies: 0.079084
15500 -- (-697.126) [-685.100] (-687.651) (-693.914) * (-697.326) [-687.155] (-694.018) (-686.584) -- 0:01:03
16000 -- (-705.309) (-685.477) (-688.072) [-695.338] * (-694.111) (-685.710) [-690.945] (-686.859) -- 0:01:01
16500 -- (-700.936) (-686.548) [-684.908] (-694.492) * (-691.990) [-687.140] (-696.753) (-687.878) -- 0:00:59
17000 -- [-692.665] (-689.071) (-691.166) (-711.583) * (-693.141) (-685.039) [-701.120] (-705.066) -- 0:00:57
17500 -- (-697.520) (-687.602) (-688.107) [-696.094] * (-694.709) (-685.110) [-693.494] (-691.298) -- 0:00:56
18000 -- (-694.036) (-685.947) (-687.207) [-694.600] * [-696.428] (-685.602) (-691.760) (-688.013) -- 0:00:54
18500 -- (-698.214) [-686.442] (-685.067) (-698.719) * (-693.602) (-686.700) [-697.283] (-686.214) -- 0:00:53
19000 -- (-692.160) (-685.091) [-686.016] (-697.161) * (-693.883) (-685.597) (-696.683) [-686.202] -- 0:00:51
19500 -- [-691.668] (-685.433) (-686.861) (-694.657) * (-694.252) (-685.711) [-697.018] (-688.478) -- 0:00:50
20000 -- (-695.857) (-687.129) (-689.364) [-692.908] * (-702.584) (-687.256) (-695.178) [-688.494] -- 0:00:49
Average standard deviation of split frequencies: 0.070964
20500 -- (-698.120) (-686.095) (-686.453) [-708.494] * [-701.587] (-686.878) (-690.771) (-688.422) -- 0:00:47
21000 -- (-695.376) [-687.369] (-691.313) (-702.495) * (-697.824) [-690.987] (-693.356) (-688.199) -- 0:00:46
21500 -- (-704.097) (-688.256) (-687.597) [-695.565] * (-696.661) [-688.777] (-698.728) (-687.028) -- 0:00:45
22000 -- [-693.532] (-688.637) (-685.774) (-697.214) * (-697.902) [-686.417] (-695.401) (-686.866) -- 0:00:44
22500 -- (-696.074) (-692.644) (-687.119) [-694.750] * (-696.962) (-691.432) (-690.423) [-685.700] -- 0:01:26
23000 -- (-705.144) (-687.188) [-687.480] (-693.394) * [-693.650] (-687.076) (-703.136) (-687.505) -- 0:01:24
23500 -- (-699.666) [-686.013] (-687.796) (-701.752) * (-692.233) [-684.899] (-703.489) (-685.280) -- 0:01:23
24000 -- (-693.561) (-686.506) [-689.782] (-700.850) * (-690.822) (-690.800) (-696.632) [-685.122] -- 0:01:21
24500 -- (-688.362) (-687.633) [-685.238] (-692.472) * [-691.795] (-689.254) (-698.165) (-685.948) -- 0:01:19
25000 -- (-687.517) (-687.944) [-687.145] (-699.856) * [-698.216] (-687.067) (-696.638) (-686.825) -- 0:01:18
Average standard deviation of split frequencies: 0.066178
25500 -- (-686.635) [-687.412] (-687.202) (-694.162) * (-696.108) [-685.129] (-703.314) (-690.577) -- 0:01:16
26000 -- (-685.971) (-689.487) (-688.609) [-695.134] * [-695.318] (-686.572) (-713.479) (-687.145) -- 0:01:14
26500 -- [-688.510] (-686.029) (-685.588) (-700.238) * (-707.867) (-686.719) (-687.970) [-686.280] -- 0:01:13
27000 -- (-691.086) (-688.978) [-685.675] (-695.992) * (-702.329) [-685.107] (-687.488) (-685.972) -- 0:01:12
27500 -- (-686.974) [-685.522] (-686.496) (-703.115) * [-691.549] (-685.354) (-687.509) (-687.502) -- 0:01:10
28000 -- (-690.410) (-686.475) [-685.225] (-693.658) * (-701.626) (-687.122) (-688.741) [-685.865] -- 0:01:09
28500 -- [-685.718] (-686.930) (-684.971) (-700.651) * [-694.756] (-689.236) (-688.244) (-686.475) -- 0:01:08
29000 -- (-690.290) (-689.983) [-684.848] (-701.068) * (-694.009) [-685.503] (-685.816) (-685.640) -- 0:01:06
29500 -- (-687.512) (-687.712) (-686.539) [-696.951] * (-690.292) [-686.826] (-686.331) (-687.851) -- 0:01:05
30000 -- (-688.422) [-690.692] (-687.683) (-694.721) * [-691.790] (-685.965) (-685.111) (-689.343) -- 0:01:04
Average standard deviation of split frequencies: 0.057096
30500 -- (-686.872) (-686.830) (-690.624) [-690.569] * (-703.493) (-688.679) (-693.149) [-689.190] -- 0:01:03
31000 -- [-692.566] (-686.852) (-687.888) (-703.070) * (-704.052) (-686.568) [-688.012] (-689.674) -- 0:01:02
31500 -- [-687.027] (-687.347) (-687.863) (-702.033) * (-699.849) [-685.995] (-687.203) (-685.710) -- 0:01:01
32000 -- (-687.452) (-686.339) [-685.874] (-705.281) * (-695.359) [-687.138] (-685.312) (-689.036) -- 0:01:00
32500 -- [-684.860] (-685.903) (-687.479) (-692.147) * (-695.957) (-686.365) (-690.105) [-688.150] -- 0:00:59
33000 -- [-685.849] (-689.913) (-686.459) (-694.184) * (-697.180) [-687.988] (-689.200) (-686.245) -- 0:00:58
33500 -- (-686.492) [-686.187] (-688.024) (-704.065) * (-702.626) [-688.525] (-686.498) (-688.153) -- 0:00:57
34000 -- (-690.339) [-687.685] (-691.125) (-687.955) * (-692.579) (-688.393) (-693.232) [-686.475] -- 0:00:56
34500 -- (-688.152) (-691.099) (-686.350) [-695.612] * (-700.173) (-685.343) (-685.759) [-689.132] -- 0:00:55
35000 -- (-690.029) [-685.527] (-687.277) (-705.506) * [-693.654] (-686.763) (-687.056) (-686.760) -- 0:00:55
Average standard deviation of split frequencies: 0.047140
35500 -- (-691.288) (-687.844) (-687.569) [-696.465] * (-695.028) [-687.316] (-686.866) (-689.115) -- 0:00:54
36000 -- (-693.721) [-686.726] (-686.016) (-692.342) * (-696.627) [-685.915] (-685.538) (-685.753) -- 0:00:53
36500 -- [-687.424] (-688.313) (-686.514) (-687.878) * [-692.862] (-685.627) (-686.673) (-688.288) -- 0:00:52
37000 -- (-687.727) (-695.407) (-687.272) [-687.457] * (-703.629) (-686.093) (-685.776) [-686.373] -- 0:00:52
37500 -- (-686.326) (-685.661) [-684.996] (-688.264) * (-695.267) [-686.091] (-686.613) (-686.108) -- 0:00:51
38000 -- (-686.326) [-686.384] (-687.288) (-687.452) * (-700.973) [-685.132] (-689.013) (-686.164) -- 0:00:50
38500 -- (-687.122) (-685.415) (-689.341) [-687.805] * (-697.178) (-687.365) [-685.943] (-686.935) -- 0:01:14
39000 -- (-686.542) [-685.550] (-687.443) (-686.590) * [-690.889] (-687.763) (-686.558) (-688.813) -- 0:01:13
39500 -- (-687.557) [-684.859] (-687.217) (-691.674) * [-690.536] (-685.559) (-689.795) (-685.645) -- 0:01:12
40000 -- (-686.410) (-684.896) [-687.001] (-689.249) * (-695.122) [-685.474] (-688.815) (-686.554) -- 0:01:12
Average standard deviation of split frequencies: 0.042097
40500 -- [-685.316] (-688.712) (-685.740) (-686.539) * (-692.928) [-685.856] (-686.347) (-687.061) -- 0:01:11
41000 -- [-685.029] (-687.135) (-686.242) (-686.598) * [-699.289] (-685.854) (-687.643) (-685.366) -- 0:01:10
41500 -- (-685.592) (-685.624) (-689.166) [-685.443] * (-692.415) (-687.075) [-685.309] (-687.818) -- 0:01:09
42000 -- [-691.483] (-686.547) (-686.765) (-686.901) * (-700.346) [-686.604] (-685.971) (-685.849) -- 0:01:08
42500 -- (-687.641) (-685.909) [-685.067] (-685.151) * (-687.848) (-687.507) [-685.199] (-685.851) -- 0:01:07
43000 -- (-688.471) (-687.539) (-688.393) [-687.362] * (-691.036) (-689.822) [-687.199] (-686.649) -- 0:01:06
43500 -- (-687.248) (-687.562) [-686.214] (-686.804) * (-685.828) (-689.837) (-688.507) [-689.407] -- 0:01:05
44000 -- (-685.762) (-689.134) (-685.453) [-688.256] * [-686.311] (-690.922) (-687.230) (-685.782) -- 0:01:05
44500 -- [-686.131] (-686.462) (-685.164) (-690.902) * (-685.579) (-690.925) [-686.401] (-686.371) -- 0:01:04
45000 -- (-686.041) (-688.573) [-686.123] (-693.768) * (-685.666) [-687.598] (-689.102) (-686.967) -- 0:01:03
Average standard deviation of split frequencies: 0.033073
45500 -- (-685.788) (-687.367) (-695.846) [-690.421] * (-689.163) (-689.201) (-686.963) [-685.076] -- 0:01:02
46000 -- [-685.167] (-688.039) (-692.826) (-685.646) * (-693.938) [-687.227] (-686.650) (-687.544) -- 0:01:02
46500 -- (-687.499) [-687.186] (-685.881) (-688.522) * (-689.752) (-690.943) [-688.451] (-687.584) -- 0:01:01
47000 -- (-686.830) [-685.746] (-685.187) (-689.539) * (-686.661) (-686.820) [-685.019] (-686.006) -- 0:01:00
47500 -- (-691.441) (-685.590) [-685.089] (-687.864) * (-689.150) (-685.270) (-687.639) [-686.390] -- 0:01:00
48000 -- [-686.644] (-688.127) (-685.681) (-689.940) * (-689.284) [-686.901] (-691.477) (-691.654) -- 0:00:59
48500 -- (-686.994) [-686.754] (-684.852) (-686.358) * (-686.619) (-687.715) [-689.889] (-685.846) -- 0:00:58
49000 -- (-687.002) [-686.178] (-688.967) (-688.763) * (-688.686) (-686.217) [-688.103] (-687.663) -- 0:00:58
49500 -- (-686.675) [-686.505] (-684.696) (-689.842) * (-688.408) (-686.023) (-688.491) [-686.144] -- 0:00:57
50000 -- (-687.256) (-685.462) (-684.771) [-685.650] * (-689.313) (-686.984) [-686.727] (-687.353) -- 0:00:57
Average standard deviation of split frequencies: 0.033495
50500 -- (-686.490) (-685.415) (-686.927) [-688.095] * (-688.087) [-686.250] (-685.965) (-686.465) -- 0:00:56
51000 -- [-686.205] (-690.063) (-685.663) (-688.879) * (-691.747) (-687.842) (-685.589) [-686.469] -- 0:00:55
51500 -- (-686.160) (-689.011) [-685.827] (-690.508) * (-694.470) (-685.305) (-688.372) [-687.946] -- 0:00:55
52000 -- [-688.337] (-687.090) (-686.555) (-689.984) * (-688.223) [-686.165] (-688.631) (-689.145) -- 0:00:54
52500 -- (-684.914) (-686.572) (-686.341) [-686.684] * [-686.652] (-684.483) (-687.389) (-688.417) -- 0:00:54
53000 -- (-690.678) [-685.792] (-687.315) (-684.862) * (-688.643) [-689.225] (-688.061) (-685.805) -- 0:00:53
53500 -- (-686.706) [-688.441] (-686.340) (-686.144) * (-687.636) (-689.492) (-687.849) [-692.008] -- 0:00:53
54000 -- (-688.674) [-687.722] (-684.824) (-686.529) * (-686.990) (-684.947) [-686.900] (-686.661) -- 0:00:52
54500 -- (-687.870) (-687.538) (-685.614) [-685.955] * [-685.925] (-685.212) (-688.653) (-686.163) -- 0:00:52
55000 -- (-692.160) [-687.260] (-686.766) (-685.917) * (-685.625) (-686.429) [-686.781] (-690.269) -- 0:00:51
Average standard deviation of split frequencies: 0.027258
55500 -- (-686.546) [-685.877] (-686.356) (-684.999) * [-685.148] (-686.091) (-690.807) (-685.579) -- 0:01:08
56000 -- [-686.882] (-685.739) (-688.085) (-687.241) * [-687.512] (-686.701) (-687.407) (-686.003) -- 0:01:07
56500 -- (-685.245) (-684.707) (-685.570) [-685.346] * [-687.215] (-685.476) (-687.515) (-688.112) -- 0:01:06
57000 -- [-685.512] (-685.421) (-688.277) (-686.159) * [-687.221] (-685.676) (-685.975) (-687.241) -- 0:01:06
57500 -- (-689.265) (-686.435) (-688.462) [-684.969] * [-685.549] (-692.000) (-685.862) (-686.695) -- 0:01:05
58000 -- (-693.539) [-689.984] (-687.256) (-685.502) * [-686.483] (-687.732) (-685.775) (-687.426) -- 0:01:04
58500 -- (-693.186) (-694.800) (-689.351) [-685.328] * (-689.482) (-686.132) [-686.158] (-685.996) -- 0:01:04
59000 -- (-686.451) (-689.424) (-686.219) [-687.628] * (-688.360) (-688.620) [-685.934] (-686.507) -- 0:01:03
59500 -- (-686.766) (-684.994) (-686.432) [-687.269] * (-688.154) (-688.486) (-688.322) [-685.836] -- 0:01:03
60000 -- (-685.830) (-689.750) (-690.133) [-687.100] * [-684.870] (-686.089) (-685.556) (-686.714) -- 0:01:02
Average standard deviation of split frequencies: 0.024421
60500 -- (-687.090) (-690.631) (-686.073) [-687.211] * (-685.032) (-684.608) [-690.288] (-686.895) -- 0:01:02
61000 -- [-685.457] (-694.890) (-689.500) (-685.739) * [-685.481] (-686.420) (-689.925) (-687.329) -- 0:01:01
61500 -- (-686.883) (-690.589) (-684.833) [-687.521] * (-687.587) (-687.908) (-687.320) [-685.682] -- 0:01:01
62000 -- [-685.305] (-688.877) (-685.562) (-686.792) * (-688.699) [-686.666] (-689.082) (-685.522) -- 0:01:00
62500 -- [-685.302] (-686.898) (-692.746) (-686.930) * (-685.128) [-687.414] (-689.696) (-686.311) -- 0:01:00
63000 -- (-688.596) (-688.825) [-688.073] (-688.766) * (-686.658) (-684.590) [-686.538] (-687.740) -- 0:00:59
63500 -- (-686.499) (-694.166) (-691.928) [-687.762] * (-686.195) (-684.589) (-687.812) [-687.057] -- 0:00:58
64000 -- (-689.801) (-686.249) (-690.255) [-688.574] * [-686.372] (-688.975) (-686.446) (-687.240) -- 0:00:58
64500 -- (-690.379) (-685.455) [-691.323] (-686.801) * (-686.949) (-685.924) [-685.551] (-684.902) -- 0:00:58
65000 -- (-687.571) (-685.043) (-686.592) [-686.256] * (-685.961) (-686.169) (-686.277) [-686.239] -- 0:00:57
Average standard deviation of split frequencies: 0.021427
65500 -- (-687.695) [-687.171] (-685.682) (-687.729) * (-686.712) [-686.323] (-685.741) (-685.619) -- 0:00:57
66000 -- [-686.444] (-687.810) (-686.588) (-691.122) * (-690.595) [-685.721] (-686.767) (-685.744) -- 0:00:56
66500 -- (-686.733) (-685.928) [-687.094] (-686.695) * (-689.308) (-684.719) (-688.483) [-686.405] -- 0:00:56
67000 -- [-687.979] (-687.398) (-686.625) (-685.202) * (-686.582) (-684.463) (-692.821) [-686.434] -- 0:00:55
67500 -- (-685.882) [-685.364] (-687.504) (-685.635) * (-686.145) (-688.272) (-687.322) [-687.770] -- 0:00:55
68000 -- (-687.739) [-688.695] (-687.961) (-691.178) * (-686.455) (-686.960) [-685.420] (-685.378) -- 0:00:54
68500 -- (-689.331) (-685.873) (-685.040) [-688.704] * (-688.001) (-686.314) [-688.885] (-687.762) -- 0:00:54
69000 -- (-685.968) (-688.176) (-684.939) [-687.195] * (-686.208) (-686.677) (-687.172) [-688.344] -- 0:00:53
69500 -- (-689.853) (-687.779) [-687.630] (-686.762) * (-688.007) (-690.110) [-686.374] (-688.449) -- 0:00:53
70000 -- (-688.245) [-688.882] (-686.435) (-687.994) * (-687.527) [-684.643] (-687.870) (-690.004) -- 0:00:53
Average standard deviation of split frequencies: 0.022347
70500 -- (-686.826) (-687.189) (-686.284) [-685.817] * (-685.643) [-685.291] (-689.222) (-686.088) -- 0:00:52
71000 -- (-687.099) (-688.227) (-687.280) [-687.899] * (-687.410) (-686.313) (-689.248) [-688.372] -- 0:00:52
71500 -- [-688.484] (-686.619) (-690.664) (-686.955) * (-687.567) (-685.705) [-685.531] (-686.514) -- 0:00:51
72000 -- [-685.267] (-689.478) (-689.009) (-690.097) * (-686.216) (-687.114) [-687.259] (-689.828) -- 0:00:51
72500 -- [-688.095] (-687.060) (-690.184) (-685.876) * (-686.177) [-685.397] (-687.699) (-685.867) -- 0:01:03
73000 -- (-687.108) (-686.550) (-690.099) [-685.240] * (-686.382) [-685.080] (-693.561) (-687.147) -- 0:01:03
73500 -- [-685.857] (-687.056) (-685.048) (-691.003) * [-685.772] (-685.730) (-693.798) (-689.840) -- 0:01:03
74000 -- [-684.940] (-686.394) (-686.730) (-690.925) * [-687.194] (-685.603) (-690.230) (-696.465) -- 0:01:02
74500 -- (-685.813) [-686.287] (-689.628) (-688.354) * [-685.481] (-687.197) (-686.884) (-690.231) -- 0:01:02
75000 -- [-686.302] (-688.165) (-689.343) (-687.965) * [-685.993] (-687.701) (-688.210) (-688.403) -- 0:01:01
Average standard deviation of split frequencies: 0.019587
75500 -- (-687.326) [-685.591] (-689.639) (-689.267) * (-686.713) (-689.591) [-686.681] (-687.272) -- 0:01:01
76000 -- [-686.627] (-687.736) (-689.050) (-686.705) * (-688.549) (-693.228) [-687.779] (-688.419) -- 0:01:00
76500 -- (-687.819) [-687.151] (-687.672) (-685.652) * (-689.099) (-687.064) (-688.663) [-687.715] -- 0:01:00
77000 -- (-689.407) [-685.476] (-686.873) (-685.787) * (-688.214) (-687.556) [-690.562] (-688.235) -- 0:00:59
77500 -- (-686.174) [-686.635] (-686.094) (-687.916) * (-686.132) [-685.475] (-687.729) (-688.332) -- 0:00:59
78000 -- (-686.827) (-688.164) [-686.403] (-687.219) * (-685.161) (-686.875) (-687.747) [-688.445] -- 0:00:59
78500 -- (-685.491) (-687.014) (-687.152) [-687.227] * (-686.349) (-686.401) [-689.875] (-685.100) -- 0:00:58
79000 -- (-685.509) (-688.922) (-686.166) [-685.915] * [-686.660] (-687.944) (-686.371) (-687.210) -- 0:00:58
79500 -- (-685.682) (-686.319) [-687.954] (-686.590) * (-685.774) (-687.296) (-687.267) [-686.642] -- 0:00:57
80000 -- (-688.047) (-686.441) [-687.573] (-686.908) * (-687.474) (-687.998) [-686.995] (-686.006) -- 0:00:57
Average standard deviation of split frequencies: 0.019480
80500 -- [-686.365] (-689.539) (-688.437) (-687.218) * (-686.447) [-687.987] (-686.815) (-688.083) -- 0:00:57
81000 -- (-686.509) (-687.263) (-695.042) [-685.988] * (-688.318) (-687.582) [-686.604] (-692.540) -- 0:00:56
81500 -- (-687.385) [-685.141] (-686.483) (-685.990) * (-687.553) [-685.353] (-686.482) (-687.392) -- 0:00:56
82000 -- [-686.345] (-686.281) (-687.134) (-688.559) * (-686.075) (-684.754) [-688.080] (-688.614) -- 0:00:55
82500 -- [-686.451] (-686.682) (-687.142) (-690.024) * (-685.675) (-686.221) [-686.402] (-691.077) -- 0:00:55
83000 -- (-686.413) [-686.397] (-687.717) (-687.668) * [-688.371] (-687.471) (-685.830) (-688.279) -- 0:00:55
83500 -- (-686.485) (-687.217) [-687.724] (-687.313) * (-692.649) (-685.624) (-687.354) [-684.935] -- 0:00:54
84000 -- (-686.570) (-688.806) [-688.048] (-687.587) * (-691.576) (-686.948) [-690.035] (-685.765) -- 0:00:54
84500 -- [-685.839] (-687.036) (-685.981) (-686.975) * [-687.075] (-685.851) (-685.785) (-686.343) -- 0:00:54
85000 -- (-687.915) (-686.755) (-688.933) [-685.633] * [-688.474] (-686.999) (-684.925) (-685.927) -- 0:00:53
Average standard deviation of split frequencies: 0.019733
85500 -- (-692.527) [-685.719] (-685.133) (-689.354) * [-688.629] (-693.320) (-686.317) (-688.196) -- 0:00:53
86000 -- [-687.121] (-687.539) (-685.361) (-685.401) * (-688.349) (-689.124) (-686.387) [-692.718] -- 0:00:53
86500 -- (-686.548) (-688.594) [-685.358] (-685.377) * (-686.143) [-688.839] (-686.488) (-685.585) -- 0:00:52
87000 -- (-685.567) (-694.350) (-687.909) [-686.799] * (-687.210) (-685.369) [-686.179] (-685.950) -- 0:00:52
87500 -- (-685.180) (-687.099) [-685.519] (-686.454) * (-685.029) (-690.690) [-687.481] (-686.380) -- 0:00:52
88000 -- [-686.341] (-686.080) (-688.389) (-687.083) * (-685.121) (-692.775) [-688.201] (-686.386) -- 0:00:51
88500 -- (-684.635) [-687.498] (-690.288) (-685.820) * [-685.296] (-687.415) (-691.392) (-686.708) -- 0:00:51
89000 -- [-688.143] (-686.790) (-685.132) (-686.492) * (-687.273) [-686.698] (-689.731) (-685.775) -- 0:01:01
89500 -- (-689.288) [-687.760] (-686.370) (-686.696) * (-688.579) (-687.665) [-686.260] (-686.299) -- 0:01:01
90000 -- (-686.786) [-688.751] (-691.040) (-686.258) * (-686.719) [-687.833] (-688.219) (-685.742) -- 0:01:00
Average standard deviation of split frequencies: 0.018608
90500 -- (-686.228) (-685.182) (-688.007) [-687.636] * (-686.740) (-685.756) [-685.993] (-687.275) -- 0:01:00
91000 -- [-689.264] (-686.138) (-687.768) (-685.807) * (-688.587) (-686.310) (-685.563) [-688.252] -- 0:00:59
91500 -- (-688.452) [-687.492] (-692.022) (-686.383) * (-688.014) [-688.311] (-686.153) (-688.825) -- 0:00:59
92000 -- (-687.428) [-686.014] (-687.663) (-687.696) * [-685.810] (-689.903) (-686.595) (-687.573) -- 0:00:59
92500 -- [-688.902] (-687.168) (-686.286) (-687.917) * (-686.341) (-687.887) [-685.676] (-686.064) -- 0:00:58
93000 -- (-686.539) [-685.160] (-686.739) (-687.720) * (-691.601) (-685.813) (-688.588) [-686.324] -- 0:00:58
93500 -- (-686.435) [-685.854] (-689.844) (-686.802) * (-690.079) (-687.915) (-687.863) [-687.044] -- 0:00:58
94000 -- [-688.510] (-688.749) (-686.077) (-685.702) * (-685.225) (-689.239) (-686.595) [-690.475] -- 0:00:57
94500 -- (-687.300) (-686.628) [-685.775] (-685.982) * (-685.165) [-687.494] (-686.610) (-685.931) -- 0:00:57
95000 -- (-690.666) (-686.737) (-686.717) [-687.500] * (-686.661) [-685.436] (-686.083) (-690.629) -- 0:00:57
Average standard deviation of split frequencies: 0.018091
95500 -- (-685.373) [-688.865] (-689.601) (-687.414) * [-687.538] (-692.369) (-685.585) (-688.291) -- 0:00:56
96000 -- (-685.117) (-685.557) [-687.071] (-686.912) * (-686.731) (-686.896) (-685.604) [-685.874] -- 0:00:56
96500 -- [-686.114] (-686.550) (-688.703) (-691.035) * (-685.552) (-686.292) (-687.823) [-690.265] -- 0:00:56
97000 -- (-686.306) (-688.348) [-685.834] (-685.290) * [-685.393] (-690.399) (-690.851) (-687.402) -- 0:00:55
97500 -- [-685.782] (-688.951) (-685.965) (-685.981) * [-685.512] (-690.860) (-690.806) (-687.615) -- 0:00:55
98000 -- [-685.014] (-688.382) (-687.066) (-685.391) * (-684.558) (-688.300) [-686.731] (-687.378) -- 0:00:55
98500 -- (-686.181) [-688.394] (-686.933) (-686.643) * (-686.746) [-686.489] (-685.466) (-688.671) -- 0:00:54
99000 -- (-688.000) (-685.774) [-686.186] (-686.781) * (-685.205) [-685.730] (-685.766) (-686.238) -- 0:00:54
99500 -- (-688.986) (-691.418) [-689.191] (-687.231) * (-689.591) (-688.051) (-684.749) [-686.252] -- 0:00:54
100000 -- (-689.921) [-686.695] (-686.055) (-685.886) * (-687.341) (-685.745) (-685.979) [-684.510] -- 0:00:54
Average standard deviation of split frequencies: 0.017629
100500 -- (-690.175) [-686.441] (-689.289) (-689.960) * (-684.998) (-686.983) (-685.282) [-684.958] -- 0:00:53
101000 -- (-687.339) (-686.637) [-686.807] (-687.329) * [-687.782] (-686.732) (-687.805) (-686.348) -- 0:00:53
101500 -- (-685.037) (-686.330) (-687.719) [-686.295] * (-692.495) [-685.323] (-687.932) (-688.058) -- 0:00:53
102000 -- [-685.245] (-685.039) (-688.017) (-692.340) * (-689.837) [-686.914] (-686.201) (-687.213) -- 0:00:52
102500 -- (-690.461) (-685.143) [-686.081] (-687.367) * (-690.811) (-685.385) (-687.198) [-687.434] -- 0:00:52
103000 -- (-686.260) (-684.857) [-685.318] (-687.957) * (-687.751) [-685.432] (-685.646) (-688.638) -- 0:00:52
103500 -- (-686.424) [-686.718] (-687.283) (-685.646) * (-686.140) [-686.062] (-688.941) (-685.373) -- 0:00:51
104000 -- (-688.644) [-686.253] (-685.712) (-686.633) * (-685.992) [-688.155] (-685.314) (-685.421) -- 0:00:51
104500 -- (-688.454) [-686.990] (-690.291) (-689.581) * [-686.322] (-688.814) (-685.315) (-685.334) -- 0:00:51
105000 -- (-686.920) (-686.060) [-686.017] (-687.374) * (-689.013) (-691.235) [-687.354] (-685.350) -- 0:00:51
Average standard deviation of split frequencies: 0.017566
105500 -- (-687.153) (-685.924) (-690.435) [-687.616] * (-689.519) (-687.980) (-686.271) [-688.339] -- 0:00:59
106000 -- [-685.800] (-685.570) (-688.471) (-686.072) * (-688.797) [-687.042] (-687.945) (-685.124) -- 0:00:59
106500 -- (-686.239) (-684.516) [-688.264] (-687.034) * (-690.200) (-686.303) (-688.958) [-686.808] -- 0:00:58
107000 -- [-684.858] (-687.470) (-686.108) (-688.417) * [-687.056] (-687.223) (-689.703) (-687.099) -- 0:00:58
107500 -- (-686.245) [-685.327] (-689.240) (-687.687) * [-685.728] (-688.787) (-688.152) (-685.825) -- 0:00:58
108000 -- (-687.369) (-688.044) [-689.730] (-685.409) * (-686.312) [-686.106] (-685.684) (-685.603) -- 0:00:57
108500 -- (-687.456) (-690.691) (-685.596) [-685.993] * (-685.347) [-686.024] (-685.684) (-685.421) -- 0:00:57
109000 -- (-687.075) (-686.853) [-685.330] (-687.170) * (-686.003) (-685.433) [-685.954] (-687.087) -- 0:00:57
109500 -- (-688.502) (-685.519) [-687.832] (-685.822) * [-685.298] (-686.367) (-685.323) (-685.982) -- 0:00:56
110000 -- (-685.687) (-686.547) (-685.894) [-685.960] * (-686.292) (-688.935) [-691.365] (-684.907) -- 0:00:56
Average standard deviation of split frequencies: 0.017487
110500 -- [-686.077] (-686.680) (-686.381) (-685.738) * (-688.047) [-687.887] (-688.925) (-688.015) -- 0:00:56
111000 -- (-688.437) [-685.631] (-688.105) (-684.991) * (-689.734) (-687.440) [-687.399] (-687.448) -- 0:00:56
111500 -- (-688.350) (-688.100) [-685.263] (-686.644) * (-688.190) (-686.303) [-687.746] (-687.046) -- 0:00:55
112000 -- (-687.996) (-692.051) (-690.378) [-687.077] * (-690.639) [-685.054] (-687.233) (-688.002) -- 0:00:55
112500 -- (-687.039) (-689.276) [-685.087] (-687.306) * (-687.652) (-691.057) (-687.729) [-687.687] -- 0:00:55
113000 -- (-686.472) (-690.087) (-685.457) [-686.938] * [-688.244] (-685.067) (-686.706) (-688.460) -- 0:00:54
113500 -- (-686.726) (-688.183) [-685.876] (-690.323) * (-688.622) (-686.647) (-685.953) [-686.597] -- 0:00:54
114000 -- [-685.814] (-689.102) (-686.228) (-689.771) * [-686.517] (-686.696) (-686.544) (-685.839) -- 0:00:54
114500 -- (-691.354) (-688.576) (-687.399) [-685.227] * (-686.320) (-687.778) (-687.444) [-684.600] -- 0:00:54
115000 -- [-689.339] (-692.037) (-687.405) (-688.187) * (-685.984) (-685.734) (-689.801) [-686.381] -- 0:00:53
Average standard deviation of split frequencies: 0.017158
115500 -- [-686.551] (-685.919) (-687.783) (-689.165) * (-686.730) [-687.704] (-685.474) (-685.882) -- 0:00:53
116000 -- (-687.541) (-686.941) (-686.701) [-689.843] * [-691.085] (-690.512) (-689.639) (-689.380) -- 0:00:53
116500 -- (-688.182) (-685.627) [-686.601] (-690.218) * [-688.403] (-690.962) (-685.607) (-689.063) -- 0:00:53
117000 -- (-688.423) (-685.720) [-689.391] (-686.067) * (-688.906) (-694.858) (-686.685) [-688.353] -- 0:00:52
117500 -- (-688.158) (-693.394) [-686.732] (-686.435) * (-688.769) (-685.895) [-685.014] (-687.979) -- 0:00:52
118000 -- (-685.224) [-686.739] (-685.688) (-688.213) * [-685.582] (-685.417) (-685.719) (-691.703) -- 0:00:52
118500 -- [-686.338] (-686.369) (-688.330) (-688.260) * (-688.849) [-688.595] (-685.255) (-687.242) -- 0:00:52
119000 -- (-686.347) (-687.171) [-684.768] (-688.391) * (-687.010) (-686.585) [-686.159] (-690.531) -- 0:00:51
119500 -- (-688.658) (-685.156) (-686.799) [-692.119] * (-688.282) [-687.636] (-687.210) (-686.817) -- 0:00:51
120000 -- (-685.894) (-687.261) (-686.133) [-691.229] * (-687.268) [-685.659] (-689.991) (-686.787) -- 0:00:51
Average standard deviation of split frequencies: 0.015627
120500 -- (-685.389) [-686.221] (-684.809) (-688.305) * (-689.090) (-688.620) (-688.101) [-685.018] -- 0:00:51
121000 -- (-687.025) [-686.220] (-685.550) (-687.947) * (-686.647) (-689.521) [-688.019] (-686.824) -- 0:00:50
121500 -- (-688.005) [-686.834] (-684.754) (-685.876) * [-685.240] (-693.667) (-685.422) (-688.165) -- 0:00:50
122000 -- [-687.875] (-685.527) (-685.896) (-686.717) * [-687.740] (-695.136) (-688.159) (-686.243) -- 0:00:50
122500 -- (-686.640) (-689.872) [-687.817] (-687.725) * (-687.281) [-686.349] (-686.874) (-686.369) -- 0:00:57
123000 -- [-686.079] (-687.388) (-686.684) (-685.767) * (-687.114) (-686.336) [-685.852] (-686.582) -- 0:00:57
123500 -- (-685.967) (-685.262) [-686.213] (-690.490) * [-688.188] (-685.175) (-685.966) (-685.845) -- 0:00:56
124000 -- (-685.935) [-689.659] (-687.878) (-690.098) * [-688.784] (-685.865) (-686.579) (-686.705) -- 0:00:56
124500 -- [-685.654] (-693.970) (-684.929) (-687.415) * (-687.458) [-686.988] (-691.614) (-689.750) -- 0:00:56
125000 -- [-685.370] (-689.215) (-685.339) (-693.215) * (-687.789) (-687.020) [-687.565] (-686.805) -- 0:00:56
Average standard deviation of split frequencies: 0.016004
125500 -- (-685.885) (-685.620) [-685.796] (-685.446) * (-685.714) (-687.250) [-686.850] (-685.643) -- 0:00:55
126000 -- (-691.883) [-685.786] (-685.635) (-686.158) * (-688.233) [-685.536] (-686.496) (-690.291) -- 0:00:55
126500 -- (-685.934) (-692.285) [-687.336] (-685.599) * (-685.576) (-686.695) [-686.569] (-687.257) -- 0:00:55
127000 -- (-685.899) (-693.221) (-687.901) [-685.325] * [-690.283] (-685.829) (-685.366) (-688.318) -- 0:00:54
127500 -- (-686.527) (-685.217) [-689.042] (-687.553) * (-689.672) (-685.815) [-685.854] (-688.066) -- 0:00:54
128000 -- (-693.377) (-685.635) (-686.707) [-685.377] * (-685.332) (-685.492) [-685.825] (-687.384) -- 0:00:54
128500 -- (-687.072) (-685.413) [-687.176] (-686.406) * (-686.186) [-687.169] (-688.497) (-686.412) -- 0:00:54
129000 -- (-687.191) (-687.197) (-685.522) [-687.411] * [-687.055] (-687.403) (-690.222) (-685.243) -- 0:00:54
129500 -- (-688.594) (-685.939) [-687.664] (-686.671) * (-687.164) (-685.919) [-688.274] (-685.816) -- 0:00:53
130000 -- [-684.785] (-685.667) (-686.498) (-686.015) * (-687.569) [-686.026] (-689.063) (-685.573) -- 0:00:53
Average standard deviation of split frequencies: 0.016765
130500 -- (-693.695) (-693.932) [-686.992] (-688.646) * [-684.911] (-685.912) (-687.545) (-686.529) -- 0:00:53
131000 -- [-684.760] (-686.628) (-688.022) (-686.374) * (-686.662) (-688.047) (-688.352) [-685.613] -- 0:00:53
131500 -- (-685.077) (-685.901) (-689.048) [-687.478] * (-685.023) [-687.079] (-686.861) (-685.769) -- 0:00:52
132000 -- (-688.792) (-686.520) (-688.299) [-685.504] * (-686.313) [-690.557] (-688.190) (-686.644) -- 0:00:52
132500 -- (-689.288) (-687.018) [-686.512] (-690.008) * (-688.037) (-687.702) (-686.626) [-688.293] -- 0:00:52
133000 -- (-687.707) (-687.250) [-685.835] (-689.319) * [-693.730] (-688.780) (-687.290) (-688.805) -- 0:00:52
133500 -- (-690.543) (-689.390) (-688.529) [-685.925] * [-687.973] (-687.747) (-684.995) (-693.784) -- 0:00:51
134000 -- (-688.946) (-688.412) [-688.802] (-686.031) * (-691.476) (-687.122) (-686.750) [-688.952] -- 0:00:51
134500 -- (-690.231) [-687.355] (-688.626) (-687.321) * (-686.764) (-687.882) [-686.265] (-689.379) -- 0:00:51
135000 -- (-689.306) [-686.742] (-689.471) (-685.787) * [-687.194] (-686.093) (-687.936) (-688.327) -- 0:00:51
Average standard deviation of split frequencies: 0.017739
135500 -- (-687.985) (-689.573) [-686.227] (-691.283) * (-684.998) [-688.351] (-687.435) (-685.297) -- 0:00:51
136000 -- (-685.735) (-686.407) [-691.417] (-685.607) * (-685.090) (-687.724) (-686.047) [-685.171] -- 0:00:50
136500 -- (-688.703) [-687.099] (-692.310) (-686.408) * (-685.313) [-685.660] (-685.327) (-691.868) -- 0:00:50
137000 -- [-686.933] (-687.905) (-688.675) (-685.676) * (-685.984) (-687.741) [-691.916] (-685.921) -- 0:00:50
137500 -- (-684.675) [-687.551] (-685.225) (-689.971) * (-686.448) [-689.542] (-691.639) (-687.778) -- 0:00:50
138000 -- (-685.656) (-693.363) [-684.587] (-685.481) * (-689.853) [-686.092] (-685.356) (-688.946) -- 0:00:49
138500 -- (-686.807) (-689.779) [-684.606] (-686.043) * (-688.529) (-686.333) [-686.866] (-686.448) -- 0:00:49
139000 -- [-685.642] (-687.728) (-685.247) (-685.395) * (-687.185) (-687.096) [-685.618] (-685.165) -- 0:00:49
139500 -- (-686.434) [-687.256] (-685.434) (-686.593) * (-685.374) (-685.853) (-685.841) [-685.306] -- 0:00:55
140000 -- (-685.568) (-687.283) (-689.307) [-686.211] * (-685.611) [-685.569] (-687.070) (-687.140) -- 0:00:55
Average standard deviation of split frequencies: 0.016756
140500 -- [-685.474] (-687.477) (-687.843) (-685.707) * [-690.601] (-686.740) (-686.759) (-686.531) -- 0:00:55
141000 -- [-686.363] (-686.783) (-688.801) (-691.088) * (-685.824) (-687.617) (-687.250) [-686.943] -- 0:00:54
141500 -- (-685.002) (-687.025) [-689.990] (-687.462) * (-685.268) (-686.503) (-687.323) [-685.486] -- 0:00:54
142000 -- (-688.269) [-685.981] (-689.564) (-687.781) * (-688.589) (-686.766) [-686.871] (-688.929) -- 0:00:54
142500 -- (-686.654) (-688.849) [-685.164] (-687.706) * (-685.316) [-685.820] (-688.379) (-686.909) -- 0:00:54
143000 -- (-685.113) (-690.412) (-690.104) [-685.982] * [-687.958] (-685.834) (-686.402) (-686.219) -- 0:00:53
143500 -- (-687.628) [-693.464] (-685.086) (-686.711) * (-685.325) [-686.894] (-686.144) (-687.256) -- 0:00:53
144000 -- (-688.307) (-687.942) (-685.628) [-687.421] * (-689.944) (-687.336) (-690.638) [-686.820] -- 0:00:53
144500 -- (-690.129) (-687.292) (-685.034) [-686.483] * (-687.404) [-686.230] (-690.583) (-685.958) -- 0:00:53
145000 -- (-685.463) [-689.289] (-688.536) (-686.050) * (-686.509) [-688.005] (-690.810) (-688.728) -- 0:00:53
Average standard deviation of split frequencies: 0.016862
145500 -- [-686.799] (-685.346) (-691.066) (-685.985) * (-685.951) [-688.226] (-688.754) (-689.781) -- 0:00:52
146000 -- (-688.023) [-684.749] (-686.135) (-684.742) * (-687.431) [-688.463] (-689.961) (-685.471) -- 0:00:52
146500 -- (-687.172) (-690.815) [-685.106] (-687.888) * [-685.313] (-689.290) (-688.014) (-687.963) -- 0:00:52
147000 -- (-685.048) [-688.346] (-685.015) (-689.366) * (-687.734) (-687.272) (-687.292) [-686.714] -- 0:00:52
147500 -- (-685.358) (-685.356) (-686.143) [-689.726] * [-686.523] (-685.140) (-688.262) (-686.327) -- 0:00:52
148000 -- (-686.855) (-686.692) (-687.346) [-687.589] * [-691.783] (-688.063) (-686.907) (-686.679) -- 0:00:51
148500 -- (-686.010) (-685.326) [-685.219] (-688.059) * [-687.980] (-686.459) (-685.875) (-690.201) -- 0:00:51
149000 -- (-685.814) (-689.536) [-687.901] (-689.115) * (-688.504) [-691.111] (-686.731) (-684.776) -- 0:00:51
149500 -- (-687.323) (-688.472) (-686.282) [-686.471] * [-686.342] (-687.114) (-685.796) (-684.922) -- 0:00:51
150000 -- [-685.840] (-687.433) (-687.908) (-685.742) * (-690.666) (-685.328) [-686.734] (-685.594) -- 0:00:51
Average standard deviation of split frequencies: 0.015828
150500 -- (-684.840) (-685.234) (-686.904) [-687.324] * (-694.291) [-685.734] (-692.567) (-686.246) -- 0:00:50
151000 -- [-685.304] (-686.762) (-687.272) (-685.126) * (-691.049) (-685.916) (-692.818) [-691.760] -- 0:00:50
151500 -- (-685.049) (-689.514) (-692.280) [-689.212] * (-688.497) [-685.821] (-685.130) (-688.087) -- 0:00:50
152000 -- (-688.700) (-685.398) [-696.403] (-688.894) * (-684.819) [-684.718] (-688.749) (-688.851) -- 0:00:50
152500 -- [-685.876] (-688.489) (-685.554) (-687.615) * (-687.529) (-685.715) (-688.281) [-685.226] -- 0:00:50
153000 -- [-686.918] (-687.684) (-686.080) (-693.394) * (-684.800) [-685.874] (-686.724) (-694.458) -- 0:00:49
153500 -- (-684.937) [-687.054] (-686.383) (-688.104) * [-684.647] (-685.606) (-687.656) (-690.706) -- 0:00:49
154000 -- (-685.787) (-689.550) [-685.589] (-688.706) * (-686.036) [-685.596] (-687.009) (-687.153) -- 0:00:49
154500 -- (-690.742) (-685.965) [-685.059] (-689.195) * (-687.935) [-685.319] (-685.222) (-687.224) -- 0:00:49
155000 -- (-685.880) (-686.361) [-687.100] (-689.520) * (-688.022) (-685.204) (-685.703) [-688.602] -- 0:00:49
Average standard deviation of split frequencies: 0.017124
155500 -- (-685.680) (-688.091) [-687.581] (-684.622) * [-690.202] (-686.840) (-686.301) (-688.933) -- 0:00:48
156000 -- (-689.027) [-686.401] (-685.319) (-686.203) * [-688.893] (-688.989) (-687.270) (-687.188) -- 0:00:54
156500 -- [-686.102] (-687.617) (-685.593) (-687.408) * (-686.021) [-685.301] (-686.021) (-687.780) -- 0:00:53
157000 -- (-686.628) (-690.073) [-687.210] (-687.183) * (-684.835) [-685.122] (-692.530) (-686.618) -- 0:00:53
157500 -- (-688.448) [-686.146] (-688.690) (-686.776) * (-685.832) [-685.754] (-686.832) (-688.712) -- 0:00:53
158000 -- (-688.550) (-687.456) (-687.633) [-688.392] * (-688.719) (-687.572) (-685.073) [-685.345] -- 0:00:53
158500 -- [-685.291] (-689.786) (-690.356) (-688.888) * (-687.896) (-687.100) [-685.271] (-685.345) -- 0:00:53
159000 -- (-689.384) [-688.214] (-685.513) (-691.724) * (-684.713) (-685.649) (-687.699) [-686.025] -- 0:00:52
159500 -- (-689.056) (-689.724) (-687.245) [-690.408] * (-690.170) (-686.617) (-686.226) [-686.191] -- 0:00:52
160000 -- [-685.031] (-686.521) (-685.700) (-689.064) * [-688.046] (-687.095) (-689.497) (-686.563) -- 0:00:52
Average standard deviation of split frequencies: 0.018376
160500 -- (-685.547) [-690.406] (-686.087) (-686.096) * [-685.968] (-686.668) (-693.455) (-685.964) -- 0:00:52
161000 -- (-689.278) (-691.163) [-685.944] (-691.047) * [-684.997] (-688.003) (-685.800) (-685.964) -- 0:00:52
161500 -- [-689.382] (-688.058) (-687.125) (-688.068) * [-687.090] (-690.757) (-690.519) (-686.282) -- 0:00:51
162000 -- (-687.932) (-687.117) (-687.001) [-685.662] * (-687.697) (-685.315) [-690.518] (-685.605) -- 0:00:51
162500 -- [-684.740] (-686.862) (-686.305) (-687.908) * (-687.604) (-689.730) (-690.361) [-686.133] -- 0:00:51
163000 -- (-688.093) (-686.033) [-686.131] (-686.520) * [-687.337] (-687.916) (-688.591) (-689.647) -- 0:00:51
163500 -- [-686.655] (-686.199) (-685.098) (-687.865) * (-686.452) (-686.226) [-687.516] (-688.009) -- 0:00:51
164000 -- (-685.880) (-687.489) [-685.895] (-688.104) * (-687.557) (-686.039) (-691.212) [-686.780] -- 0:00:50
164500 -- [-688.473] (-687.918) (-685.876) (-689.594) * [-689.739] (-685.948) (-686.075) (-686.769) -- 0:00:50
165000 -- (-686.244) [-685.281] (-685.898) (-692.582) * (-695.220) [-685.815] (-687.455) (-687.924) -- 0:00:50
Average standard deviation of split frequencies: 0.017323
165500 -- (-685.530) (-685.468) [-685.857] (-689.164) * (-690.506) (-685.222) [-686.846] (-693.218) -- 0:00:50
166000 -- (-686.351) [-689.352] (-690.458) (-689.087) * (-688.232) [-685.463] (-687.733) (-685.281) -- 0:00:50
166500 -- (-688.177) [-686.455] (-688.842) (-686.522) * (-688.188) [-686.883] (-687.044) (-689.242) -- 0:00:50
167000 -- (-692.508) [-685.205] (-685.733) (-690.508) * (-686.909) (-685.410) (-688.065) [-686.584] -- 0:00:49
167500 -- (-687.298) (-685.256) [-687.975] (-688.887) * (-688.099) [-685.328] (-686.502) (-685.801) -- 0:00:49
168000 -- (-686.295) (-685.466) (-687.034) [-688.949] * [-689.060] (-688.046) (-686.058) (-685.676) -- 0:00:49
168500 -- [-688.608] (-686.234) (-685.410) (-689.970) * [-688.737] (-690.126) (-685.049) (-686.901) -- 0:00:49
169000 -- (-686.383) (-686.422) [-694.168] (-688.956) * (-688.713) [-686.077] (-684.946) (-686.432) -- 0:00:49
169500 -- (-687.842) (-687.257) (-692.360) [-685.190] * (-686.000) [-685.590] (-688.174) (-686.316) -- 0:00:48
170000 -- [-689.207] (-686.196) (-686.775) (-685.611) * [-686.543] (-687.291) (-687.663) (-686.360) -- 0:00:48
Average standard deviation of split frequencies: 0.015119
170500 -- (-688.979) (-685.886) (-688.138) [-685.272] * (-687.976) (-686.424) (-689.654) [-686.081] -- 0:00:48
171000 -- (-687.992) [-687.500] (-686.141) (-685.574) * [-685.530] (-690.460) (-685.367) (-688.994) -- 0:00:48
171500 -- (-687.045) [-685.559] (-685.783) (-685.393) * (-687.540) (-690.347) (-690.499) [-687.551] -- 0:00:48
172000 -- (-685.052) [-688.727] (-686.148) (-685.136) * (-688.278) (-690.865) (-686.159) [-684.961] -- 0:00:48
172500 -- [-685.117] (-688.129) (-688.211) (-688.539) * (-686.255) (-691.232) (-686.023) [-688.432] -- 0:00:52
173000 -- (-686.115) [-686.029] (-689.241) (-685.244) * (-688.201) [-686.055] (-685.495) (-688.624) -- 0:00:52
173500 -- (-686.416) [-689.880] (-698.254) (-686.690) * (-686.265) (-686.639) [-685.789] (-691.554) -- 0:00:52
174000 -- (-686.314) (-687.854) (-689.030) [-685.624] * (-688.103) [-689.460] (-686.412) (-685.595) -- 0:00:52
174500 -- (-686.647) [-686.205] (-687.251) (-686.625) * (-686.257) (-687.717) (-691.744) [-686.165] -- 0:00:52
175000 -- (-689.129) [-685.147] (-690.007) (-687.514) * (-686.745) (-689.129) [-688.605] (-690.521) -- 0:00:51
Average standard deviation of split frequencies: 0.016212
175500 -- [-685.125] (-685.073) (-689.055) (-686.807) * (-687.804) [-686.977] (-686.756) (-689.038) -- 0:00:51
176000 -- (-688.799) [-685.265] (-690.006) (-688.016) * (-690.120) [-689.242] (-685.585) (-685.571) -- 0:00:51
176500 -- [-685.751] (-685.685) (-691.789) (-686.782) * (-689.801) (-688.497) (-685.940) [-687.369] -- 0:00:51
177000 -- (-686.004) (-688.252) (-687.745) [-684.740] * (-684.861) (-691.385) [-686.293] (-687.346) -- 0:00:51
177500 -- (-685.955) (-688.508) (-687.245) [-685.952] * (-693.012) (-689.013) [-694.008] (-686.523) -- 0:00:50
178000 -- (-685.779) [-685.368] (-687.101) (-685.348) * (-685.578) [-685.640] (-686.569) (-689.108) -- 0:00:50
178500 -- (-685.491) (-685.339) [-686.674] (-687.291) * [-686.175] (-688.509) (-688.664) (-686.313) -- 0:00:50
179000 -- (-692.203) [-687.085] (-687.074) (-692.034) * (-686.934) (-688.800) (-685.865) [-687.324] -- 0:00:50
179500 -- (-688.203) [-685.374] (-686.514) (-687.728) * [-685.531] (-692.179) (-686.682) (-687.002) -- 0:00:50
180000 -- (-686.235) (-686.772) [-685.470] (-687.435) * [-689.002] (-687.659) (-687.347) (-685.267) -- 0:00:50
Average standard deviation of split frequencies: 0.016815
180500 -- [-685.806] (-685.743) (-686.505) (-686.891) * (-686.646) [-687.054] (-692.647) (-689.770) -- 0:00:49
181000 -- (-685.119) (-689.101) [-689.120] (-686.956) * (-686.749) (-688.017) [-687.972] (-686.746) -- 0:00:49
181500 -- (-686.254) [-684.974] (-686.844) (-687.306) * [-686.875] (-689.037) (-687.763) (-691.809) -- 0:00:49
182000 -- [-685.509] (-686.137) (-687.158) (-689.321) * (-685.226) [-688.166] (-686.912) (-691.398) -- 0:00:49
182500 -- (-687.091) (-686.824) [-686.257] (-689.264) * [-686.449] (-686.619) (-687.621) (-689.968) -- 0:00:49
183000 -- (-687.058) (-686.648) (-689.848) [-687.934] * (-684.864) [-686.182] (-686.484) (-687.772) -- 0:00:49
183500 -- (-685.460) (-684.942) (-687.233) [-688.049] * (-685.973) [-687.263] (-685.588) (-688.514) -- 0:00:48
184000 -- (-685.221) (-688.973) (-685.414) [-684.656] * (-687.356) (-687.042) (-686.085) [-689.433] -- 0:00:48
184500 -- (-686.894) [-689.603] (-685.486) (-685.872) * [-688.654] (-688.047) (-690.822) (-687.249) -- 0:00:48
185000 -- (-686.356) (-690.693) [-684.754] (-686.043) * (-685.632) [-686.280] (-690.677) (-686.530) -- 0:00:48
Average standard deviation of split frequencies: 0.017882
185500 -- (-686.437) (-688.616) (-685.306) [-688.500] * (-685.101) (-686.504) [-687.814] (-689.460) -- 0:00:48
186000 -- (-688.864) [-685.433] (-688.222) (-688.469) * (-686.544) (-685.748) [-686.689] (-687.034) -- 0:00:48
186500 -- (-691.127) (-687.550) [-687.178] (-685.357) * (-686.731) [-689.586] (-688.470) (-689.948) -- 0:00:47
187000 -- (-687.548) (-687.806) (-685.553) [-687.140] * (-685.788) (-690.845) [-684.879] (-687.080) -- 0:00:47
187500 -- (-686.839) (-687.806) [-687.090] (-685.362) * (-688.075) (-688.091) [-688.823] (-688.254) -- 0:00:47
188000 -- [-685.581] (-687.325) (-686.767) (-685.423) * (-693.575) (-687.030) (-687.406) [-686.208] -- 0:00:47
188500 -- (-684.859) (-688.045) [-686.055] (-685.476) * (-687.406) [-689.999] (-686.739) (-687.251) -- 0:00:47
189000 -- (-686.686) [-687.589] (-688.450) (-688.594) * [-687.875] (-687.957) (-686.425) (-689.430) -- 0:00:47
189500 -- (-686.690) [-688.351] (-687.413) (-687.936) * (-688.792) (-688.607) (-686.252) [-687.666] -- 0:00:51
190000 -- [-686.190] (-686.976) (-693.429) (-686.936) * (-687.614) (-686.286) [-685.806] (-688.658) -- 0:00:51
Average standard deviation of split frequencies: 0.018179
190500 -- (-685.879) (-690.968) [-686.622] (-689.448) * (-687.605) [-686.788] (-687.209) (-686.987) -- 0:00:50
191000 -- (-687.465) (-687.361) (-686.837) [-686.380] * [-686.449] (-685.539) (-686.691) (-686.427) -- 0:00:50
191500 -- (-688.009) (-686.466) [-686.329] (-689.015) * (-686.544) [-686.012] (-688.840) (-686.469) -- 0:00:50
192000 -- [-684.903] (-685.021) (-686.789) (-688.983) * (-687.328) [-687.762] (-687.264) (-688.669) -- 0:00:50
192500 -- (-684.856) (-686.891) [-688.385] (-694.342) * [-685.197] (-686.230) (-685.305) (-685.989) -- 0:00:50
193000 -- [-688.202] (-686.321) (-689.823) (-690.111) * [-688.632] (-685.888) (-687.461) (-687.218) -- 0:00:50
193500 -- (-686.447) (-688.922) (-689.119) [-686.489] * (-686.300) (-687.430) (-690.016) [-686.505] -- 0:00:50
194000 -- [-687.185] (-687.753) (-689.507) (-688.033) * (-686.024) (-686.164) [-685.308] (-686.236) -- 0:00:49
194500 -- [-687.358] (-687.847) (-693.534) (-687.604) * [-685.587] (-688.847) (-688.563) (-688.205) -- 0:00:49
195000 -- (-687.803) (-689.007) (-687.739) [-686.329] * (-685.822) (-687.963) (-692.336) [-688.354] -- 0:00:49
Average standard deviation of split frequencies: 0.017402
195500 -- (-691.160) (-685.865) (-686.544) [-685.244] * (-686.340) (-686.445) (-689.986) [-689.420] -- 0:00:49
196000 -- (-688.215) (-686.636) [-686.365] (-686.216) * (-685.803) (-686.427) [-685.903] (-689.776) -- 0:00:49
196500 -- (-685.876) [-687.146] (-688.261) (-689.754) * (-686.736) (-687.003) [-686.054] (-685.360) -- 0:00:49
197000 -- (-689.325) (-690.008) (-687.061) [-688.588] * (-685.388) (-686.500) [-686.981] (-686.239) -- 0:00:48
197500 -- (-686.778) (-689.600) (-686.993) [-687.352] * (-690.887) (-687.579) (-686.813) [-687.294] -- 0:00:48
198000 -- (-685.031) (-685.896) [-686.598] (-687.337) * (-689.596) (-689.436) (-687.294) [-685.195] -- 0:00:48
198500 -- (-688.333) (-685.939) (-689.733) [-686.672] * (-687.872) (-685.126) (-685.077) [-686.367] -- 0:00:48
199000 -- [-690.812] (-685.412) (-687.423) (-685.333) * (-688.385) [-685.141] (-685.963) (-687.452) -- 0:00:48
199500 -- (-691.353) (-686.895) (-686.246) [-686.262] * (-685.877) (-687.961) [-685.473] (-687.498) -- 0:00:48
200000 -- [-686.361] (-689.090) (-686.217) (-688.740) * (-685.077) (-686.520) (-687.075) [-688.599] -- 0:00:48
Average standard deviation of split frequencies: 0.017826
200500 -- (-686.555) (-690.029) [-687.625] (-686.855) * (-687.015) (-687.786) (-687.692) [-684.979] -- 0:00:47
201000 -- (-686.641) (-685.732) (-687.507) [-686.989] * (-686.717) (-685.212) (-693.415) [-687.119] -- 0:00:47
201500 -- [-687.118] (-685.973) (-685.650) (-687.842) * [-690.242] (-689.378) (-687.774) (-687.040) -- 0:00:47
202000 -- (-687.330) (-687.644) (-687.197) [-688.956] * (-688.182) [-687.059] (-689.576) (-690.715) -- 0:00:47
202500 -- (-687.004) (-686.929) [-685.407] (-686.013) * (-688.153) (-685.835) (-687.497) [-686.383] -- 0:00:47
203000 -- [-686.822] (-690.279) (-688.037) (-687.715) * (-696.998) (-686.189) [-689.930] (-685.270) -- 0:00:47
203500 -- (-686.505) (-685.301) [-688.550] (-685.813) * (-691.230) [-686.080] (-689.908) (-687.950) -- 0:00:46
204000 -- (-688.161) (-687.032) [-684.621] (-686.726) * (-687.280) [-685.857] (-685.906) (-687.753) -- 0:00:46
204500 -- (-687.452) [-685.542] (-684.641) (-687.077) * [-686.878] (-686.354) (-687.085) (-686.104) -- 0:00:46
205000 -- [-689.354] (-686.238) (-685.252) (-688.461) * (-691.548) [-685.301] (-686.442) (-688.006) -- 0:00:46
Average standard deviation of split frequencies: 0.017290
205500 -- [-688.915] (-688.755) (-687.237) (-687.621) * (-687.080) (-687.389) (-687.399) [-688.543] -- 0:00:46
206000 -- (-687.503) [-686.615] (-688.905) (-693.307) * (-686.070) (-687.321) [-686.022] (-687.494) -- 0:00:50
206500 -- (-685.763) [-686.477] (-685.601) (-690.621) * (-687.522) (-689.304) [-686.217] (-685.762) -- 0:00:49
207000 -- [-685.809] (-687.720) (-688.277) (-687.643) * (-684.985) (-689.743) (-686.267) [-685.361] -- 0:00:49
207500 -- (-688.747) (-689.848) (-686.550) [-686.650] * [-690.884] (-690.783) (-686.019) (-687.525) -- 0:00:49
208000 -- (-686.103) (-687.849) (-687.167) [-685.236] * [-684.778] (-687.722) (-685.439) (-684.908) -- 0:00:49
208500 -- (-690.638) (-687.214) (-685.329) [-685.812] * (-686.172) (-684.945) (-687.213) [-687.162] -- 0:00:49
209000 -- (-688.087) (-687.812) (-685.547) [-689.897] * (-687.362) (-693.612) [-685.893] (-686.926) -- 0:00:49
209500 -- [-687.229] (-685.912) (-687.091) (-695.103) * (-686.605) [-688.802] (-687.338) (-686.281) -- 0:00:49
210000 -- [-687.506] (-685.979) (-685.834) (-685.575) * (-688.095) (-687.050) (-687.442) [-689.100] -- 0:00:48
Average standard deviation of split frequencies: 0.015788
210500 -- (-688.032) (-686.196) (-685.812) [-685.196] * (-687.639) (-686.303) [-685.878] (-684.770) -- 0:00:48
211000 -- (-690.411) [-687.275] (-686.788) (-687.630) * (-685.214) (-684.972) [-688.161] (-686.648) -- 0:00:48
211500 -- (-688.688) (-688.703) [-684.696] (-687.018) * (-685.298) (-685.383) [-687.375] (-689.198) -- 0:00:48
212000 -- [-685.127] (-686.025) (-684.699) (-686.925) * (-687.909) (-687.592) [-687.004] (-689.451) -- 0:00:48
212500 -- [-686.825] (-685.816) (-684.822) (-686.806) * (-687.282) (-689.607) [-686.604] (-691.737) -- 0:00:48
213000 -- (-686.814) [-688.593] (-687.085) (-686.118) * (-686.769) [-686.714] (-686.960) (-688.716) -- 0:00:48
213500 -- (-687.024) (-688.780) [-688.100] (-685.645) * (-686.651) (-695.010) [-687.424] (-686.427) -- 0:00:47
214000 -- [-688.450] (-687.327) (-687.828) (-685.549) * [-686.597] (-685.922) (-684.825) (-687.158) -- 0:00:47
214500 -- [-689.685] (-686.579) (-692.066) (-688.596) * [-684.890] (-684.942) (-685.074) (-687.911) -- 0:00:47
215000 -- (-691.830) (-686.327) (-689.445) [-688.080] * (-689.287) [-690.472] (-686.763) (-685.051) -- 0:00:47
Average standard deviation of split frequencies: 0.015405
215500 -- (-696.151) [-690.055] (-688.090) (-685.152) * [-686.386] (-688.375) (-685.017) (-685.020) -- 0:00:47
216000 -- (-684.969) (-685.032) [-687.364] (-690.746) * (-685.507) (-685.419) [-689.213] (-685.393) -- 0:00:47
216500 -- (-689.098) (-688.686) (-686.700) [-692.169] * (-687.892) (-687.325) (-688.623) [-686.413] -- 0:00:47
217000 -- (-687.439) [-686.985] (-685.684) (-686.028) * (-687.598) (-686.273) (-686.846) [-685.288] -- 0:00:46
217500 -- (-688.094) (-685.740) (-685.859) [-685.931] * [-688.263] (-688.662) (-686.086) (-687.839) -- 0:00:46
218000 -- [-685.455] (-686.365) (-686.919) (-688.754) * (-692.816) (-687.361) [-686.961] (-685.469) -- 0:00:46
218500 -- (-688.587) (-685.554) [-686.838] (-689.717) * (-688.161) [-685.003] (-687.548) (-685.849) -- 0:00:46
219000 -- (-689.769) (-686.507) [-686.368] (-684.715) * [-687.316] (-687.662) (-685.744) (-687.114) -- 0:00:46
219500 -- [-686.902] (-691.505) (-684.812) (-685.437) * (-688.642) (-694.476) (-687.068) [-685.834] -- 0:00:46
220000 -- (-684.879) (-685.933) (-686.990) [-684.903] * (-688.932) [-686.081] (-687.323) (-685.487) -- 0:00:46
Average standard deviation of split frequencies: 0.015755
220500 -- (-686.578) (-685.652) [-687.482] (-686.999) * (-687.571) (-688.040) [-690.550] (-687.758) -- 0:00:45
221000 -- [-688.288] (-686.797) (-686.544) (-689.652) * [-687.202] (-687.113) (-687.624) (-687.058) -- 0:00:45
221500 -- [-688.948] (-687.565) (-685.469) (-692.465) * [-691.003] (-685.534) (-686.198) (-686.682) -- 0:00:45
222000 -- [-687.945] (-687.331) (-686.112) (-685.905) * (-686.494) (-686.556) (-687.644) [-685.966] -- 0:00:45
222500 -- (-686.956) [-685.663] (-685.811) (-687.992) * [-687.888] (-686.497) (-685.736) (-685.283) -- 0:00:48
223000 -- (-689.853) (-685.271) [-684.932] (-685.947) * (-686.025) (-694.754) (-685.690) [-685.143] -- 0:00:48
223500 -- (-685.662) [-684.628] (-686.884) (-687.668) * [-686.452] (-686.323) (-685.735) (-691.821) -- 0:00:48
224000 -- [-687.174] (-688.756) (-686.752) (-685.618) * (-687.382) (-693.971) [-686.627] (-690.295) -- 0:00:48
224500 -- (-688.866) (-686.989) (-686.479) [-685.553] * (-686.359) (-688.536) [-684.498] (-689.631) -- 0:00:48
225000 -- (-685.693) (-687.043) (-686.785) [-686.902] * (-685.082) (-688.276) [-684.961] (-687.669) -- 0:00:48
Average standard deviation of split frequencies: 0.015383
225500 -- (-687.668) (-687.511) (-686.102) [-687.923] * [-685.578] (-685.125) (-685.070) (-686.147) -- 0:00:48
226000 -- [-685.233] (-685.585) (-685.439) (-688.046) * (-687.258) (-689.714) (-689.266) [-688.722] -- 0:00:47
226500 -- [-687.107] (-687.312) (-688.333) (-690.357) * (-692.546) (-689.486) (-688.274) [-686.259] -- 0:00:47
227000 -- [-687.871] (-686.168) (-689.460) (-693.562) * (-684.934) (-687.274) (-686.710) [-686.040] -- 0:00:47
227500 -- [-686.778] (-686.203) (-687.268) (-685.589) * [-685.676] (-687.337) (-692.720) (-685.819) -- 0:00:47
228000 -- (-685.087) (-689.654) (-687.836) [-686.428] * [-686.115] (-687.680) (-687.788) (-685.101) -- 0:00:47
228500 -- (-685.267) (-687.097) (-688.836) [-687.777] * [-685.745] (-686.571) (-689.243) (-684.823) -- 0:00:47
229000 -- (-685.725) (-685.251) (-687.694) [-686.717] * [-685.953] (-686.769) (-688.782) (-685.138) -- 0:00:47
229500 -- (-685.300) [-688.675] (-685.290) (-687.521) * (-684.637) (-685.617) (-687.274) [-684.945] -- 0:00:47
230000 -- (-685.721) [-685.962] (-686.795) (-686.021) * (-688.646) (-686.079) (-687.926) [-686.249] -- 0:00:46
Average standard deviation of split frequencies: 0.014178
230500 -- (-690.371) [-685.835] (-685.106) (-687.156) * [-685.846] (-689.700) (-688.561) (-686.481) -- 0:00:46
231000 -- [-688.293] (-685.114) (-685.498) (-685.494) * (-688.148) (-686.989) [-688.239] (-687.401) -- 0:00:46
231500 -- (-687.332) (-686.598) (-686.064) [-686.203] * [-687.317] (-687.347) (-684.620) (-688.770) -- 0:00:46
232000 -- (-687.274) [-688.775] (-686.417) (-690.850) * (-688.047) (-685.439) [-685.536] (-687.285) -- 0:00:46
232500 -- (-687.171) [-684.952] (-691.837) (-690.790) * (-685.817) (-688.041) (-688.783) [-686.290] -- 0:00:46
233000 -- (-686.312) (-686.677) [-687.427] (-688.162) * [-685.814] (-689.066) (-687.364) (-689.950) -- 0:00:46
233500 -- (-684.776) (-684.627) [-685.910] (-687.703) * [-685.007] (-686.766) (-685.341) (-696.620) -- 0:00:45
234000 -- [-686.872] (-687.976) (-686.399) (-687.197) * (-689.836) (-685.859) [-684.817] (-686.516) -- 0:00:45
234500 -- (-688.347) (-686.236) (-685.465) [-685.127] * (-685.488) [-685.762] (-690.862) (-689.706) -- 0:00:45
235000 -- [-686.567] (-685.551) (-685.103) (-691.095) * (-690.111) (-685.643) [-687.710] (-686.441) -- 0:00:45
Average standard deviation of split frequencies: 0.014981
235500 -- [-686.308] (-685.875) (-688.994) (-689.126) * [-686.980] (-687.850) (-686.418) (-686.275) -- 0:00:45
236000 -- [-685.829] (-685.735) (-688.444) (-686.171) * [-687.435] (-687.465) (-692.368) (-684.963) -- 0:00:45
236500 -- (-685.667) (-685.795) (-684.957) [-686.510] * (-687.773) [-689.252] (-685.454) (-684.882) -- 0:00:45
237000 -- (-686.716) [-685.274] (-686.548) (-685.851) * (-687.073) (-687.287) (-685.495) [-685.749] -- 0:00:45
237500 -- (-689.050) (-685.222) [-690.451] (-684.940) * (-687.378) (-689.428) [-685.555] (-684.600) -- 0:00:44
238000 -- [-685.852] (-687.941) (-688.976) (-687.787) * [-692.231] (-689.707) (-686.476) (-686.784) -- 0:00:44
238500 -- (-686.210) (-691.459) (-687.600) [-685.944] * [-694.142] (-688.528) (-689.070) (-686.441) -- 0:00:44
239000 -- (-685.578) (-688.333) (-688.353) [-685.378] * (-694.123) (-690.395) (-686.761) [-684.924] -- 0:00:44
239500 -- (-695.055) (-686.971) [-685.392] (-684.998) * (-691.518) [-686.582] (-687.596) (-687.217) -- 0:00:47
240000 -- [-688.062] (-685.739) (-686.198) (-687.804) * (-688.927) (-687.456) (-686.451) [-685.788] -- 0:00:47
Average standard deviation of split frequencies: 0.014446
240500 -- (-687.279) (-685.152) (-692.771) [-685.593] * (-686.892) [-686.266] (-685.664) (-685.059) -- 0:00:47
241000 -- (-689.079) [-690.410] (-693.735) (-689.840) * (-688.147) (-686.087) [-684.928] (-686.332) -- 0:00:47
241500 -- (-686.089) (-688.012) [-686.658] (-690.154) * [-692.355] (-685.532) (-686.429) (-691.512) -- 0:00:47
242000 -- (-688.621) (-685.883) (-686.980) [-686.834] * (-687.557) (-685.562) [-686.252] (-690.716) -- 0:00:46
242500 -- (-685.100) (-685.394) (-689.644) [-685.791] * (-689.270) (-691.168) [-685.089] (-686.971) -- 0:00:46
243000 -- (-685.670) (-685.250) (-686.836) [-687.105] * (-687.391) (-686.953) [-688.513] (-684.891) -- 0:00:46
243500 -- [-688.409] (-685.862) (-686.480) (-686.380) * (-687.483) (-686.413) [-686.808] (-687.443) -- 0:00:46
244000 -- (-686.650) (-691.611) [-687.407] (-685.342) * [-687.757] (-687.750) (-686.064) (-686.779) -- 0:00:46
244500 -- (-686.643) (-689.876) (-686.813) [-685.165] * (-686.843) (-686.292) [-685.130] (-686.100) -- 0:00:46
245000 -- [-685.969] (-689.201) (-684.969) (-686.253) * [-685.497] (-686.484) (-685.977) (-686.910) -- 0:00:46
Average standard deviation of split frequencies: 0.015450
245500 -- (-685.533) (-687.001) (-685.238) [-686.527] * (-687.589) [-687.363] (-690.665) (-685.656) -- 0:00:46
246000 -- [-687.186] (-686.466) (-685.336) (-685.603) * (-689.499) [-686.993] (-688.396) (-689.384) -- 0:00:45
246500 -- (-687.723) [-687.474] (-685.012) (-686.181) * (-689.037) [-686.376] (-690.826) (-684.905) -- 0:00:45
247000 -- (-685.673) [-688.056] (-685.281) (-685.094) * [-687.385] (-687.224) (-687.258) (-687.203) -- 0:00:45
247500 -- (-687.460) (-691.361) [-688.316] (-685.000) * (-690.696) (-689.762) (-685.398) [-688.227] -- 0:00:45
248000 -- [-687.669] (-686.751) (-688.422) (-685.554) * [-687.504] (-691.979) (-692.064) (-686.623) -- 0:00:45
248500 -- (-685.404) (-689.304) [-687.620] (-686.020) * (-688.557) [-686.515] (-688.032) (-686.834) -- 0:00:45
249000 -- (-687.189) [-694.856] (-685.128) (-686.990) * (-686.565) [-691.066] (-685.493) (-686.720) -- 0:00:45
249500 -- [-688.380] (-695.332) (-685.212) (-687.918) * [-687.065] (-691.723) (-686.904) (-686.291) -- 0:00:45
250000 -- (-688.050) (-690.481) [-687.597] (-688.191) * (-689.007) [-688.787] (-688.850) (-687.198) -- 0:00:45
Average standard deviation of split frequencies: 0.014810
250500 -- [-687.457] (-690.780) (-685.989) (-687.600) * [-688.983] (-694.297) (-687.492) (-687.040) -- 0:00:44
251000 -- (-690.646) [-689.344] (-688.629) (-690.033) * (-689.300) (-693.034) [-686.158] (-687.385) -- 0:00:44
251500 -- (-684.800) [-684.970] (-687.991) (-689.090) * (-686.406) [-687.347] (-685.220) (-691.067) -- 0:00:44
252000 -- (-685.104) (-685.675) [-687.949] (-686.241) * (-687.829) (-686.280) (-686.731) [-687.253] -- 0:00:44
252500 -- [-685.216] (-685.360) (-690.616) (-687.047) * (-688.308) (-694.955) [-688.057] (-687.389) -- 0:00:44
253000 -- [-685.373] (-685.821) (-690.183) (-687.001) * (-690.229) (-689.263) [-689.012] (-687.268) -- 0:00:44
253500 -- (-690.595) (-688.392) [-685.965] (-688.614) * [-685.019] (-687.872) (-692.344) (-688.308) -- 0:00:44
254000 -- (-687.249) (-685.994) [-686.423] (-689.095) * [-685.899] (-685.255) (-689.259) (-689.072) -- 0:00:44
254500 -- (-686.070) (-685.124) (-686.522) [-686.022] * [-687.091] (-686.872) (-688.097) (-687.820) -- 0:00:43
255000 -- (-685.097) (-687.426) [-686.021] (-690.823) * [-685.518] (-691.768) (-686.836) (-687.447) -- 0:00:43
Average standard deviation of split frequencies: 0.014406
255500 -- (-685.242) (-685.834) [-687.292] (-691.366) * (-689.302) (-689.312) (-691.486) [-686.420] -- 0:00:43
256000 -- [-688.624] (-687.274) (-687.000) (-686.782) * (-689.269) (-686.084) (-686.213) [-688.024] -- 0:00:46
256500 -- (-685.641) [-688.238] (-687.021) (-687.310) * [-685.182] (-686.092) (-688.699) (-689.859) -- 0:00:46
257000 -- (-686.999) [-687.576] (-687.764) (-686.740) * (-685.220) [-686.033] (-685.471) (-686.377) -- 0:00:46
257500 -- (-686.314) [-685.154] (-686.509) (-686.310) * (-685.007) [-685.349] (-691.003) (-686.375) -- 0:00:46
258000 -- [-686.285] (-686.793) (-686.588) (-686.654) * (-684.717) [-686.775] (-690.418) (-686.481) -- 0:00:46
258500 -- (-687.584) [-685.906] (-686.275) (-685.084) * (-689.130) (-686.385) (-688.213) [-697.236] -- 0:00:45
259000 -- (-686.642) (-685.554) [-685.212] (-684.743) * (-688.765) [-686.934] (-687.743) (-686.098) -- 0:00:45
259500 -- (-687.588) (-685.898) [-690.086] (-686.848) * (-687.409) [-687.936] (-686.999) (-686.432) -- 0:00:45
260000 -- (-686.837) (-687.667) [-687.225] (-687.108) * [-687.756] (-688.690) (-687.665) (-688.358) -- 0:00:45
Average standard deviation of split frequencies: 0.013510
260500 -- (-691.157) [-686.574] (-685.876) (-688.745) * (-687.377) (-689.823) [-685.023] (-689.905) -- 0:00:45
261000 -- (-688.119) (-686.040) (-687.457) [-688.996] * (-686.364) [-686.424] (-687.265) (-686.719) -- 0:00:45
261500 -- (-687.340) (-688.511) (-686.825) [-686.764] * (-686.737) (-687.985) (-685.878) [-686.356] -- 0:00:45
262000 -- (-686.130) [-688.771] (-686.957) (-687.579) * (-686.419) (-691.286) [-686.672] (-687.164) -- 0:00:45
262500 -- (-685.563) [-687.022] (-686.091) (-685.739) * (-688.699) (-692.620) (-687.246) [-687.540] -- 0:00:44
263000 -- (-685.241) (-689.435) (-686.910) [-685.603] * (-689.353) (-689.940) [-685.500] (-688.087) -- 0:00:44
263500 -- [-684.894] (-685.422) (-686.398) (-687.361) * (-686.110) [-685.776] (-685.623) (-691.078) -- 0:00:44
264000 -- [-686.102] (-686.602) (-686.400) (-689.656) * (-686.120) (-685.506) (-686.262) [-685.410] -- 0:00:44
264500 -- (-687.594) (-687.935) (-685.142) [-686.197] * [-686.371] (-685.130) (-686.135) (-687.425) -- 0:00:44
265000 -- (-689.017) (-687.029) [-687.011] (-691.202) * [-688.221] (-687.768) (-689.962) (-693.234) -- 0:00:44
Average standard deviation of split frequencies: 0.012799
265500 -- (-688.418) (-685.313) [-686.045] (-688.764) * (-688.407) (-686.738) [-685.420] (-688.917) -- 0:00:44
266000 -- (-687.042) [-685.436] (-693.349) (-686.863) * (-686.714) (-686.143) (-685.994) [-685.719] -- 0:00:44
266500 -- (-687.637) (-686.915) [-688.689] (-686.796) * (-690.019) (-686.226) [-685.998] (-685.155) -- 0:00:44
267000 -- (-691.698) (-687.122) (-691.182) [-686.387] * [-686.120] (-685.139) (-686.536) (-685.809) -- 0:00:43
267500 -- (-686.699) (-690.158) (-687.276) [-685.542] * (-686.277) [-685.177] (-687.321) (-685.476) -- 0:00:43
268000 -- (-684.909) (-686.280) (-686.925) [-687.774] * (-685.670) (-685.875) [-687.301] (-686.941) -- 0:00:43
268500 -- (-686.232) (-689.033) (-687.765) [-685.048] * [-687.061] (-692.301) (-686.174) (-688.442) -- 0:00:43
269000 -- (-687.435) [-688.820] (-686.541) (-685.048) * (-686.316) (-689.454) [-686.538] (-688.327) -- 0:00:43
269500 -- (-685.412) [-687.065] (-686.494) (-685.433) * (-685.152) (-689.280) [-687.774] (-689.006) -- 0:00:43
270000 -- (-690.290) (-687.916) (-688.544) [-685.799] * (-685.352) [-687.583] (-686.323) (-685.977) -- 0:00:43
Average standard deviation of split frequencies: 0.013256
270500 -- [-689.186] (-685.798) (-686.844) (-685.654) * (-686.717) (-685.965) (-689.266) [-685.612] -- 0:00:43
271000 -- [-687.409] (-686.625) (-687.206) (-687.591) * [-685.579] (-693.741) (-688.716) (-685.556) -- 0:00:43
271500 -- [-688.727] (-688.640) (-687.882) (-687.904) * (-688.830) [-685.867] (-691.653) (-689.042) -- 0:00:42
272000 -- (-688.543) (-687.656) [-687.056] (-689.133) * [-687.212] (-686.415) (-690.921) (-686.987) -- 0:00:42
272500 -- (-688.085) (-689.484) (-686.508) [-687.800] * [-686.936] (-690.821) (-687.023) (-686.519) -- 0:00:45
273000 -- (-688.997) [-686.218] (-689.109) (-687.602) * [-688.172] (-689.951) (-686.908) (-690.071) -- 0:00:45
273500 -- [-689.201] (-685.805) (-689.490) (-685.625) * (-685.654) [-687.438] (-687.339) (-686.702) -- 0:00:45
274000 -- [-687.976] (-685.329) (-686.594) (-685.191) * (-685.461) (-686.818) [-685.624] (-685.437) -- 0:00:45
274500 -- (-684.686) [-685.055] (-688.484) (-687.265) * [-685.086] (-686.805) (-688.512) (-686.293) -- 0:00:44
275000 -- [-686.456] (-685.925) (-686.680) (-685.413) * (-686.687) [-685.209] (-685.690) (-685.773) -- 0:00:44
Average standard deviation of split frequencies: 0.013474
275500 -- (-686.404) (-689.427) [-685.743] (-687.623) * [-687.000] (-685.209) (-688.451) (-686.736) -- 0:00:44
276000 -- (-688.592) [-686.589] (-686.457) (-692.195) * [-687.011] (-687.372) (-691.775) (-686.673) -- 0:00:44
276500 -- (-689.090) (-688.345) [-687.918] (-686.981) * (-689.541) (-685.809) [-689.724] (-686.379) -- 0:00:44
277000 -- (-687.063) [-688.614] (-688.129) (-689.590) * [-690.043] (-688.334) (-689.775) (-686.742) -- 0:00:44
277500 -- (-688.787) (-690.096) (-687.378) [-684.956] * [-687.551] (-687.608) (-685.618) (-685.173) -- 0:00:44
278000 -- (-690.391) (-691.831) (-687.261) [-685.474] * (-688.079) [-687.198] (-685.519) (-685.943) -- 0:00:44
278500 -- [-685.282] (-686.001) (-685.984) (-688.215) * (-685.127) (-688.251) (-690.284) [-685.428] -- 0:00:44
279000 -- [-687.170] (-688.087) (-685.871) (-685.953) * (-689.912) (-687.491) [-687.380] (-684.783) -- 0:00:43
279500 -- (-684.892) (-687.642) [-686.063] (-686.148) * (-685.706) (-687.229) [-687.933] (-684.813) -- 0:00:43
280000 -- [-684.882] (-685.098) (-694.411) (-693.770) * (-687.135) [-687.449] (-689.395) (-690.272) -- 0:00:43
Average standard deviation of split frequencies: 0.014326
280500 -- [-687.802] (-684.994) (-687.267) (-687.299) * (-687.033) [-689.851] (-689.103) (-690.050) -- 0:00:43
281000 -- (-686.947) (-685.431) [-686.876] (-689.674) * (-686.610) (-687.965) (-688.047) [-688.999] -- 0:00:43
281500 -- (-687.226) (-685.730) (-687.593) [-685.448] * (-688.063) (-691.289) (-688.584) [-687.312] -- 0:00:43
282000 -- (-686.752) [-686.540] (-685.745) (-687.146) * (-686.636) (-687.410) [-689.261] (-685.695) -- 0:00:43
282500 -- [-690.558] (-684.772) (-687.840) (-686.170) * (-686.366) (-690.032) [-688.446] (-686.638) -- 0:00:43
283000 -- (-685.677) (-686.962) [-689.792] (-687.258) * (-687.184) [-686.491] (-685.284) (-684.904) -- 0:00:43
283500 -- (-691.448) [-686.936] (-688.430) (-685.638) * [-687.992] (-687.077) (-685.444) (-689.535) -- 0:00:42
284000 -- [-687.485] (-686.148) (-686.552) (-686.217) * (-686.098) (-687.984) [-686.687] (-689.176) -- 0:00:42
284500 -- (-689.011) [-688.309] (-689.452) (-686.829) * (-685.421) (-693.108) [-684.802] (-687.201) -- 0:00:42
285000 -- (-686.736) (-689.501) (-689.212) [-686.680] * (-685.329) (-686.488) (-685.065) [-686.731] -- 0:00:42
Average standard deviation of split frequencies: 0.013962
285500 -- (-686.045) [-689.034] (-687.603) (-685.734) * (-687.004) (-685.688) [-688.504] (-685.769) -- 0:00:42
286000 -- [-687.500] (-686.878) (-685.643) (-686.169) * [-685.839] (-686.987) (-691.821) (-688.056) -- 0:00:42
286500 -- [-687.055] (-691.315) (-687.578) (-686.516) * (-688.337) (-685.847) (-688.948) [-686.465] -- 0:00:42
287000 -- (-686.412) (-691.407) (-685.279) [-688.935] * [-687.279] (-685.649) (-687.584) (-685.664) -- 0:00:42
287500 -- [-687.716] (-687.097) (-685.871) (-687.068) * (-687.154) [-686.292] (-687.946) (-686.995) -- 0:00:42
288000 -- (-686.498) [-686.511] (-687.678) (-686.156) * (-686.605) (-685.408) [-686.212] (-686.013) -- 0:00:42
288500 -- (-685.545) (-687.763) (-686.800) [-685.591] * (-687.330) [-685.653] (-686.958) (-685.924) -- 0:00:44
289000 -- (-686.093) [-686.722] (-687.805) (-687.206) * (-684.972) (-690.875) (-688.323) [-688.782] -- 0:00:44
289500 -- (-689.713) (-692.277) [-688.987] (-689.680) * (-684.992) (-692.639) [-685.176] (-685.475) -- 0:00:44
290000 -- (-692.006) (-689.236) [-686.576] (-685.657) * (-687.941) (-686.983) [-687.557] (-689.626) -- 0:00:44
Average standard deviation of split frequencies: 0.015169
290500 -- (-685.449) [-689.350] (-690.422) (-685.454) * (-686.025) (-685.459) (-686.755) [-687.357] -- 0:00:43
291000 -- (-685.283) (-685.229) (-690.267) [-685.550] * [-686.778] (-688.869) (-690.017) (-686.287) -- 0:00:43
291500 -- (-688.304) (-690.058) [-686.755] (-687.279) * (-686.328) [-687.408] (-690.256) (-690.309) -- 0:00:43
292000 -- (-686.709) (-691.507) (-685.846) [-686.180] * (-685.601) [-687.213] (-688.397) (-692.820) -- 0:00:43
292500 -- (-688.684) (-685.470) [-685.193] (-686.858) * [-685.620] (-685.371) (-686.124) (-691.654) -- 0:00:43
293000 -- [-685.277] (-686.760) (-688.686) (-687.273) * (-686.020) [-688.067] (-693.918) (-688.044) -- 0:00:43
293500 -- [-686.815] (-690.153) (-688.390) (-687.682) * [-685.515] (-686.218) (-687.724) (-693.509) -- 0:00:43
294000 -- [-685.532] (-687.498) (-686.384) (-688.463) * [-686.953] (-686.502) (-688.589) (-689.730) -- 0:00:43
294500 -- (-688.598) [-685.149] (-684.886) (-686.663) * [-685.120] (-686.372) (-688.701) (-690.373) -- 0:00:43
295000 -- (-685.644) (-687.380) (-687.053) [-686.281] * (-685.048) (-685.153) (-685.131) [-685.998] -- 0:00:43
Average standard deviation of split frequencies: 0.015738
295500 -- (-685.936) (-687.874) (-684.923) [-688.028] * (-686.670) (-689.726) (-684.944) [-687.430] -- 0:00:42
296000 -- (-687.212) (-686.896) (-685.213) [-686.205] * (-688.303) (-686.022) (-687.260) [-686.247] -- 0:00:42
296500 -- (-688.053) (-688.364) [-685.383] (-686.454) * (-686.185) (-685.864) [-684.742] (-687.574) -- 0:00:42
297000 -- (-689.643) (-690.435) [-689.912] (-691.048) * (-688.557) (-685.864) [-687.897] (-687.816) -- 0:00:42
297500 -- (-687.284) (-686.285) [-691.980] (-687.873) * (-687.236) (-686.398) [-688.431] (-689.245) -- 0:00:42
298000 -- [-685.257] (-685.260) (-689.481) (-688.619) * [-687.291] (-687.340) (-686.010) (-689.283) -- 0:00:42
298500 -- (-685.668) (-688.140) (-686.863) [-686.787] * [-685.808] (-688.419) (-686.755) (-688.342) -- 0:00:42
299000 -- [-686.642] (-687.490) (-684.969) (-688.014) * (-686.144) [-687.371] (-690.637) (-688.574) -- 0:00:42
299500 -- (-687.956) (-689.529) [-686.639] (-687.668) * [-686.465] (-687.146) (-687.535) (-687.766) -- 0:00:42
300000 -- (-687.806) (-685.461) [-686.707] (-685.788) * [-686.205] (-684.962) (-689.232) (-688.707) -- 0:00:42
Average standard deviation of split frequencies: 0.016140
300500 -- (-687.616) (-685.833) [-688.835] (-686.645) * (-688.019) (-686.061) (-685.797) [-688.785] -- 0:00:41
301000 -- [-685.315] (-688.516) (-687.682) (-686.613) * (-689.269) (-685.034) (-687.769) [-688.207] -- 0:00:41
301500 -- (-685.410) [-684.994] (-687.768) (-687.024) * (-685.838) (-688.485) [-690.242] (-686.805) -- 0:00:41
302000 -- [-687.186] (-685.603) (-688.767) (-687.805) * [-688.406] (-688.276) (-693.699) (-685.881) -- 0:00:41
302500 -- (-689.381) [-687.390] (-690.654) (-690.769) * (-694.364) (-690.281) [-691.994] (-685.074) -- 0:00:41
303000 -- [-686.028] (-687.799) (-687.708) (-688.157) * (-688.258) (-687.056) [-689.005] (-685.036) -- 0:00:41
303500 -- (-686.704) (-690.249) [-685.558] (-686.345) * (-685.521) (-686.369) (-686.505) [-688.437] -- 0:00:41
304000 -- (-688.137) [-686.677] (-685.429) (-688.578) * (-685.525) (-688.245) [-685.412] (-686.293) -- 0:00:41
304500 -- (-685.922) (-691.965) [-686.939] (-689.606) * (-689.211) (-686.195) (-685.315) [-686.658] -- 0:00:43
305000 -- (-686.444) (-688.487) (-687.665) [-690.251] * (-686.349) (-690.264) (-687.463) [-687.724] -- 0:00:43
Average standard deviation of split frequencies: 0.016090
305500 -- (-688.207) (-687.768) (-690.338) [-690.411] * (-692.009) (-685.712) [-685.164] (-685.775) -- 0:00:43
306000 -- (-688.031) (-685.908) (-687.319) [-686.111] * (-686.922) (-692.400) (-688.239) [-686.995] -- 0:00:43
306500 -- (-688.784) (-687.364) (-685.972) [-687.019] * [-688.812] (-689.736) (-687.951) (-686.136) -- 0:00:42
307000 -- (-686.984) (-686.553) [-686.434] (-685.294) * (-689.419) (-687.386) (-688.935) [-686.257] -- 0:00:42
307500 -- (-688.674) [-685.253] (-686.196) (-685.603) * [-687.381] (-685.681) (-686.830) (-690.846) -- 0:00:42
308000 -- (-692.350) (-686.775) [-686.304] (-690.638) * (-685.514) [-685.128] (-687.337) (-687.590) -- 0:00:42
308500 -- [-688.819] (-685.725) (-686.559) (-690.526) * (-686.955) [-686.657] (-686.618) (-686.488) -- 0:00:42
309000 -- (-687.022) [-688.346] (-686.874) (-688.202) * (-686.709) [-684.599] (-685.951) (-688.062) -- 0:00:42
309500 -- (-686.492) (-688.144) (-688.126) [-686.698] * [-688.040] (-685.204) (-685.555) (-688.450) -- 0:00:42
310000 -- (-686.462) (-686.789) [-685.953] (-688.615) * [-687.083] (-689.907) (-690.007) (-689.390) -- 0:00:42
Average standard deviation of split frequencies: 0.016781
310500 -- (-684.759) (-688.880) (-688.023) [-688.572] * (-686.778) [-687.385] (-693.278) (-687.150) -- 0:00:42
311000 -- (-686.203) [-688.908] (-686.466) (-686.313) * (-686.393) [-689.349] (-687.325) (-688.744) -- 0:00:42
311500 -- (-685.603) (-686.360) [-686.024] (-688.188) * [-685.756] (-687.091) (-685.454) (-685.445) -- 0:00:41
312000 -- (-687.841) (-688.671) (-686.301) [-686.354] * (-685.266) (-685.266) [-686.466] (-686.617) -- 0:00:41
312500 -- (-685.652) (-685.469) (-687.577) [-687.741] * (-688.168) [-686.227] (-688.446) (-687.795) -- 0:00:41
313000 -- (-685.523) [-684.809] (-686.108) (-687.757) * (-685.582) (-688.238) (-687.472) [-686.401] -- 0:00:41
313500 -- (-689.451) (-685.697) [-684.889] (-685.931) * (-686.751) [-688.145] (-687.073) (-688.936) -- 0:00:41
314000 -- [-685.043] (-688.948) (-689.075) (-686.164) * (-686.263) [-685.065] (-685.453) (-685.626) -- 0:00:41
314500 -- [-685.681] (-688.019) (-686.705) (-685.907) * (-688.270) (-686.803) (-685.584) [-686.508] -- 0:00:41
315000 -- (-686.228) (-685.625) (-686.145) [-690.479] * (-689.845) (-685.811) [-686.804] (-685.606) -- 0:00:41
Average standard deviation of split frequencies: 0.016761
315500 -- (-686.751) (-686.196) (-685.854) [-687.326] * [-687.802] (-687.414) (-686.432) (-688.142) -- 0:00:41
316000 -- [-685.510] (-687.904) (-687.207) (-690.010) * (-685.463) (-687.567) [-687.860] (-689.067) -- 0:00:41
316500 -- (-685.795) [-685.673] (-685.885) (-686.153) * [-685.308] (-689.212) (-685.580) (-688.306) -- 0:00:41
317000 -- (-687.911) [-685.981] (-686.351) (-686.739) * (-684.776) (-690.950) [-685.289] (-688.022) -- 0:00:40
317500 -- (-686.697) (-687.637) [-686.399] (-686.115) * (-685.583) (-686.660) (-684.967) [-686.817] -- 0:00:40
318000 -- (-687.611) [-686.486] (-685.629) (-688.189) * (-689.417) (-693.581) [-686.922] (-685.120) -- 0:00:40
318500 -- (-685.467) (-686.500) [-688.214] (-685.612) * [-686.205] (-687.852) (-687.469) (-688.310) -- 0:00:40
319000 -- (-687.011) (-685.600) [-688.598] (-688.405) * [-687.710] (-685.702) (-685.503) (-687.654) -- 0:00:40
319500 -- (-686.070) (-688.526) (-685.123) [-684.933] * (-686.567) [-685.931] (-686.120) (-692.954) -- 0:00:40
320000 -- (-685.927) (-687.176) [-685.123] (-685.270) * (-686.065) [-684.882] (-687.906) (-689.230) -- 0:00:40
Average standard deviation of split frequencies: 0.016517
320500 -- (-688.795) (-687.928) [-685.840] (-685.665) * (-687.489) (-686.276) (-684.752) [-687.377] -- 0:00:40
321000 -- (-687.100) (-692.634) [-686.129] (-687.862) * (-685.179) (-686.474) [-686.134] (-690.167) -- 0:00:40
321500 -- (-686.301) [-686.742] (-688.797) (-686.997) * (-688.197) (-686.334) [-689.858] (-689.508) -- 0:00:42
322000 -- (-690.185) (-689.322) (-690.619) [-684.942] * (-688.095) (-687.973) [-684.672] (-698.418) -- 0:00:42
322500 -- (-685.908) (-688.468) [-688.580] (-688.074) * (-688.012) [-687.704] (-685.242) (-686.971) -- 0:00:42
323000 -- (-690.634) (-686.528) (-689.522) [-686.149] * [-687.361] (-695.451) (-687.032) (-686.330) -- 0:00:41
323500 -- (-687.701) (-687.005) [-684.943] (-685.336) * (-685.621) (-695.056) (-689.321) [-685.909] -- 0:00:41
324000 -- [-687.958] (-689.147) (-686.137) (-686.464) * (-686.629) (-690.246) (-685.427) [-688.194] -- 0:00:41
324500 -- (-684.879) (-686.689) (-688.916) [-684.742] * (-691.843) (-686.407) [-685.900] (-685.927) -- 0:00:41
325000 -- [-685.434] (-685.806) (-686.794) (-685.855) * (-685.913) [-685.718] (-687.284) (-684.753) -- 0:00:41
Average standard deviation of split frequencies: 0.015736
325500 -- [-686.997] (-687.261) (-685.741) (-687.506) * (-686.248) (-687.413) (-685.524) [-685.683] -- 0:00:41
326000 -- (-690.743) [-686.496] (-695.524) (-690.052) * [-687.865] (-686.909) (-686.364) (-686.387) -- 0:00:41
326500 -- (-686.078) [-685.943] (-687.083) (-690.058) * (-685.989) (-685.126) (-689.758) [-687.286] -- 0:00:41
327000 -- (-690.603) (-687.279) (-686.331) [-686.289] * (-686.250) [-685.132] (-686.858) (-685.897) -- 0:00:41
327500 -- (-686.659) (-685.176) [-686.748] (-686.986) * (-686.695) (-688.194) [-685.220] (-690.283) -- 0:00:41
328000 -- [-685.737] (-686.606) (-685.956) (-686.734) * (-690.112) (-687.465) (-687.348) [-686.236] -- 0:00:40
328500 -- (-692.582) (-687.062) [-687.229] (-686.576) * (-689.279) (-686.669) (-686.541) [-685.890] -- 0:00:40
329000 -- [-688.016] (-686.944) (-689.871) (-688.012) * (-686.146) (-686.967) [-686.906] (-687.915) -- 0:00:40
329500 -- [-688.326] (-688.027) (-688.164) (-685.310) * [-684.722] (-686.600) (-687.910) (-690.165) -- 0:00:40
330000 -- (-689.977) (-687.855) [-689.028] (-685.308) * [-685.278] (-691.513) (-688.121) (-687.306) -- 0:00:40
Average standard deviation of split frequencies: 0.014843
330500 -- (-689.493) (-692.133) [-687.577] (-685.187) * (-686.048) (-691.787) [-684.906] (-686.949) -- 0:00:40
331000 -- (-687.697) [-687.235] (-688.230) (-686.763) * (-686.943) (-686.687) (-685.437) [-686.793] -- 0:00:40
331500 -- (-689.592) [-686.641] (-685.630) (-686.349) * (-688.138) [-687.837] (-685.892) (-685.639) -- 0:00:40
332000 -- (-687.282) [-688.229] (-686.334) (-685.626) * (-688.932) (-686.556) (-686.052) [-691.054] -- 0:00:40
332500 -- [-687.855] (-688.374) (-685.777) (-685.990) * (-686.373) (-685.121) [-685.599] (-689.117) -- 0:00:40
333000 -- [-685.149] (-686.082) (-688.066) (-687.152) * (-687.606) (-685.359) (-685.728) [-687.968] -- 0:00:40
333500 -- (-685.993) (-685.554) (-686.200) [-687.149] * (-686.024) (-686.543) (-687.981) [-685.742] -- 0:00:39
334000 -- (-686.634) (-685.102) (-688.089) [-686.032] * (-687.759) [-685.272] (-686.452) (-687.697) -- 0:00:39
334500 -- [-686.467] (-686.954) (-687.643) (-686.561) * (-687.075) (-685.024) [-686.269] (-686.365) -- 0:00:39
335000 -- (-685.961) (-687.539) [-685.748] (-689.245) * (-688.885) (-686.133) (-686.049) [-685.854] -- 0:00:39
Average standard deviation of split frequencies: 0.012978
335500 -- (-685.476) (-687.127) (-690.347) [-688.014] * (-685.857) (-687.171) [-685.281] (-687.881) -- 0:00:39
336000 -- (-687.070) (-686.665) [-685.465] (-685.471) * (-687.712) [-688.510] (-685.472) (-685.880) -- 0:00:39
336500 -- (-688.626) (-691.963) (-688.270) [-688.079] * [-688.668] (-687.309) (-687.878) (-689.216) -- 0:00:39
337000 -- (-687.493) (-685.490) (-687.352) [-687.500] * (-687.279) [-686.461] (-686.911) (-687.308) -- 0:00:39
337500 -- (-691.539) (-685.501) [-686.848] (-686.228) * (-686.324) (-687.965) [-686.571] (-687.723) -- 0:00:39
338000 -- (-687.594) (-685.200) (-691.831) [-686.456] * [-684.937] (-687.568) (-685.233) (-686.876) -- 0:00:41
338500 -- (-689.824) (-684.898) (-688.626) [-685.912] * (-685.926) (-685.854) [-685.766] (-694.272) -- 0:00:41
339000 -- (-687.954) (-686.035) [-688.882] (-687.454) * [-684.558] (-688.824) (-686.936) (-686.095) -- 0:00:40
339500 -- [-685.234] (-689.548) (-686.981) (-687.860) * (-686.076) (-690.588) [-690.129] (-691.284) -- 0:00:40
340000 -- (-686.784) (-685.230) (-684.988) [-687.176] * [-690.742] (-685.662) (-686.689) (-688.154) -- 0:00:40
Average standard deviation of split frequencies: 0.013405
340500 -- [-687.706] (-686.424) (-686.076) (-687.463) * (-685.619) (-687.073) [-686.620] (-686.332) -- 0:00:40
341000 -- (-688.159) (-686.553) (-685.173) [-686.691] * (-685.301) (-685.646) [-684.932] (-686.890) -- 0:00:40
341500 -- (-688.109) (-687.848) (-687.264) [-685.515] * (-687.048) (-685.175) [-685.636] (-686.447) -- 0:00:40
342000 -- [-687.191] (-690.956) (-686.325) (-685.478) * (-686.995) (-687.550) (-685.525) [-687.738] -- 0:00:40
342500 -- (-686.377) (-690.512) (-684.903) [-687.595] * (-687.158) [-685.633] (-690.068) (-687.293) -- 0:00:40
343000 -- (-686.001) (-688.773) [-685.480] (-685.196) * (-685.728) (-686.371) [-687.950] (-686.328) -- 0:00:40
343500 -- (-689.101) (-690.140) (-686.293) [-686.239] * (-685.317) (-685.444) [-687.802] (-686.867) -- 0:00:40
344000 -- [-687.484] (-687.118) (-687.348) (-688.511) * [-686.247] (-686.160) (-686.012) (-687.236) -- 0:00:40
344500 -- (-691.195) (-685.114) [-685.831] (-687.848) * [-685.332] (-687.923) (-686.155) (-687.266) -- 0:00:39
345000 -- (-686.881) [-686.826] (-684.965) (-687.944) * (-686.072) [-689.409] (-686.339) (-685.383) -- 0:00:39
Average standard deviation of split frequencies: 0.013304
345500 -- (-688.327) [-685.944] (-685.932) (-687.648) * [-688.956] (-689.017) (-686.175) (-688.733) -- 0:00:39
346000 -- (-686.224) [-686.174] (-685.897) (-686.410) * (-687.227) (-687.941) (-685.506) [-687.268] -- 0:00:39
346500 -- (-685.713) [-687.742] (-685.630) (-686.013) * [-687.057] (-692.513) (-686.657) (-689.182) -- 0:00:39
347000 -- [-687.207] (-687.050) (-687.646) (-686.214) * (-693.218) [-685.825] (-686.277) (-689.148) -- 0:00:39
347500 -- (-687.571) [-685.707] (-687.904) (-686.195) * (-686.038) (-685.046) [-691.158] (-690.225) -- 0:00:39
348000 -- [-687.432] (-685.872) (-689.094) (-687.612) * (-685.626) [-686.015] (-685.743) (-686.261) -- 0:00:39
348500 -- (-685.522) (-685.035) [-685.593] (-685.806) * (-685.433) (-685.848) (-685.536) [-687.363] -- 0:00:39
349000 -- (-684.564) (-688.176) [-689.795] (-685.694) * (-685.594) (-686.257) (-686.079) [-689.249] -- 0:00:39
349500 -- (-684.658) (-687.232) [-686.777] (-687.941) * [-687.397] (-686.437) (-686.703) (-685.906) -- 0:00:39
350000 -- (-685.418) [-685.141] (-689.600) (-687.759) * (-684.668) [-689.332] (-688.083) (-689.262) -- 0:00:39
Average standard deviation of split frequencies: 0.012731
350500 -- (-687.614) (-685.951) (-686.813) [-687.509] * [-688.723] (-687.847) (-688.139) (-688.026) -- 0:00:38
351000 -- [-686.534] (-688.806) (-688.365) (-687.766) * (-689.314) (-687.448) (-685.099) [-685.692] -- 0:00:38
351500 -- (-686.385) [-687.441] (-685.795) (-685.254) * (-688.116) (-685.519) [-686.035] (-685.243) -- 0:00:38
352000 -- [-685.354] (-686.728) (-687.133) (-686.310) * [-690.678] (-686.895) (-691.648) (-687.027) -- 0:00:38
352500 -- (-687.297) [-686.945] (-688.023) (-689.111) * (-688.802) (-686.309) (-685.979) [-686.704] -- 0:00:38
353000 -- [-693.740] (-687.608) (-689.855) (-686.897) * [-686.630] (-689.791) (-685.404) (-688.098) -- 0:00:38
353500 -- [-687.872] (-685.661) (-687.839) (-688.431) * [-686.837] (-685.440) (-685.343) (-689.464) -- 0:00:38
354000 -- [-685.703] (-687.304) (-686.535) (-688.816) * (-689.069) [-687.478] (-686.923) (-687.883) -- 0:00:38
354500 -- (-684.832) [-686.063] (-686.953) (-686.154) * (-689.325) (-687.546) [-685.874] (-685.968) -- 0:00:38
355000 -- (-684.877) [-687.428] (-687.265) (-689.150) * (-687.232) [-690.299] (-690.006) (-685.728) -- 0:00:39
Average standard deviation of split frequencies: 0.013573
355500 -- (-687.389) [-687.378] (-684.994) (-688.144) * (-686.986) [-685.731] (-688.472) (-686.616) -- 0:00:39
356000 -- (-693.080) [-685.606] (-688.736) (-686.292) * (-687.041) (-686.299) (-688.454) [-686.616] -- 0:00:39
356500 -- [-687.163] (-684.721) (-688.611) (-687.190) * (-688.222) [-686.116] (-686.454) (-693.432) -- 0:00:39
357000 -- (-687.432) (-686.639) (-690.553) [-687.499] * (-688.951) (-685.837) (-688.883) [-685.587] -- 0:00:39
357500 -- (-690.462) (-686.404) (-692.276) [-688.344] * [-688.964] (-687.121) (-688.274) (-689.221) -- 0:00:39
358000 -- [-687.058] (-686.779) (-690.210) (-686.004) * (-691.008) (-686.234) [-685.678] (-687.446) -- 0:00:39
358500 -- [-686.223] (-685.334) (-689.594) (-686.475) * (-695.813) [-684.944] (-685.119) (-686.446) -- 0:00:39
359000 -- [-685.109] (-688.731) (-690.644) (-686.946) * [-684.796] (-685.388) (-691.074) (-688.245) -- 0:00:39
359500 -- [-685.573] (-687.197) (-686.544) (-686.969) * (-685.222) (-685.404) [-687.885] (-685.929) -- 0:00:39
360000 -- (-688.090) (-686.408) [-687.667] (-685.991) * (-685.543) (-687.907) (-685.048) [-685.672] -- 0:00:39
Average standard deviation of split frequencies: 0.014070
360500 -- [-686.741] (-692.627) (-686.544) (-686.761) * (-685.506) (-686.011) (-690.040) [-687.062] -- 0:00:39
361000 -- (-688.156) (-689.853) [-684.531] (-685.665) * (-685.075) [-685.303] (-686.490) (-687.910) -- 0:00:38
361500 -- (-690.712) (-690.224) (-689.486) [-686.295] * (-690.558) (-684.968) [-686.634] (-685.957) -- 0:00:38
362000 -- (-687.263) (-686.833) (-688.195) [-687.051] * (-685.541) (-685.896) (-690.288) [-686.156] -- 0:00:38
362500 -- (-688.984) (-691.322) (-690.178) [-687.763] * (-685.342) [-686.607] (-689.766) (-685.861) -- 0:00:38
363000 -- [-686.399] (-692.167) (-687.842) (-686.472) * (-687.963) (-685.906) (-687.254) [-685.760] -- 0:00:38
363500 -- [-684.872] (-686.150) (-688.006) (-684.899) * [-687.063] (-686.302) (-686.192) (-691.140) -- 0:00:38
364000 -- [-688.511] (-685.357) (-687.768) (-684.644) * (-686.816) [-685.427] (-689.063) (-687.983) -- 0:00:38
364500 -- (-692.428) (-685.776) (-688.723) [-687.973] * [-688.653] (-687.135) (-687.695) (-686.262) -- 0:00:38
365000 -- (-693.042) (-687.011) [-687.332] (-688.105) * [-686.402] (-687.608) (-688.276) (-685.037) -- 0:00:38
Average standard deviation of split frequencies: 0.013183
365500 -- (-690.496) (-687.622) (-688.885) [-688.722] * (-686.066) (-684.773) (-685.197) [-685.574] -- 0:00:38
366000 -- [-689.462] (-689.744) (-687.394) (-690.204) * (-687.295) (-684.918) (-690.429) [-685.298] -- 0:00:38
366500 -- (-687.591) (-686.663) (-685.055) [-685.510] * (-686.813) (-687.646) (-687.682) [-686.917] -- 0:00:38
367000 -- (-686.169) [-684.848] (-686.752) (-685.503) * [-687.239] (-690.932) (-687.442) (-688.658) -- 0:00:37
367500 -- (-688.826) [-686.835] (-685.639) (-685.849) * [-685.993] (-684.848) (-686.037) (-687.931) -- 0:00:37
368000 -- (-686.279) (-687.277) (-686.831) [-687.399] * (-687.092) [-685.939] (-693.083) (-684.883) -- 0:00:37
368500 -- (-684.993) (-686.790) (-686.509) [-690.801] * (-687.589) (-686.855) [-689.274] (-686.508) -- 0:00:37
369000 -- (-685.865) (-685.027) (-688.995) [-685.589] * (-687.584) (-688.059) (-685.393) [-685.114] -- 0:00:37
369500 -- (-685.366) [-686.997] (-688.013) (-685.243) * (-691.289) (-685.436) [-686.628] (-687.707) -- 0:00:37
370000 -- (-687.345) (-690.645) (-690.297) [-685.071] * (-688.779) [-686.156] (-691.163) (-689.255) -- 0:00:37
Average standard deviation of split frequencies: 0.012867
370500 -- (-687.043) [-685.995] (-687.086) (-687.958) * (-687.233) (-686.155) (-686.500) [-687.031] -- 0:00:37
371000 -- (-685.500) [-690.415] (-685.179) (-686.583) * (-687.341) (-688.701) (-686.558) [-686.032] -- 0:00:38
371500 -- (-685.357) (-689.901) [-687.399] (-686.074) * (-687.719) [-686.710] (-685.399) (-687.874) -- 0:00:38
372000 -- (-689.425) [-687.774] (-690.212) (-684.633) * (-685.917) (-687.206) (-687.008) [-689.191] -- 0:00:38
372500 -- (-688.824) (-687.761) (-689.192) [-684.727] * (-688.542) (-687.895) [-689.680] (-691.033) -- 0:00:38
373000 -- (-687.429) (-687.814) (-688.749) [-688.502] * (-687.326) (-687.544) (-687.823) [-687.243] -- 0:00:38
373500 -- (-685.786) [-687.342] (-686.139) (-687.777) * (-687.770) [-686.208] (-685.080) (-689.018) -- 0:00:38
374000 -- (-692.413) (-687.731) [-685.240] (-687.552) * [-684.650] (-685.585) (-687.525) (-688.026) -- 0:00:38
374500 -- (-686.815) [-686.121] (-689.800) (-686.179) * (-686.732) [-687.506] (-686.833) (-686.685) -- 0:00:38
375000 -- (-685.212) (-687.640) (-692.257) [-684.616] * (-686.690) (-686.902) (-685.053) [-685.651] -- 0:00:38
Average standard deviation of split frequencies: 0.013349
375500 -- (-686.273) (-686.275) (-688.848) [-688.218] * [-685.192] (-687.313) (-686.147) (-685.240) -- 0:00:38
376000 -- (-687.742) (-685.051) [-685.606] (-685.049) * (-690.974) (-688.955) [-687.331] (-687.045) -- 0:00:38
376500 -- [-686.919] (-686.680) (-685.388) (-687.760) * (-686.945) (-687.708) [-687.290] (-687.915) -- 0:00:38
377000 -- [-689.786] (-685.881) (-685.721) (-685.129) * (-687.609) (-685.764) [-686.094] (-686.064) -- 0:00:38
377500 -- (-685.853) [-686.517] (-684.833) (-685.415) * (-689.622) (-685.463) [-686.867] (-686.503) -- 0:00:37
378000 -- (-688.000) (-686.591) (-687.937) [-686.783] * (-686.573) (-687.102) [-686.163] (-686.578) -- 0:00:37
378500 -- (-686.195) [-688.839] (-691.542) (-687.897) * (-686.026) [-685.873] (-688.878) (-696.604) -- 0:00:37
379000 -- [-686.806] (-685.669) (-685.504) (-691.230) * (-687.668) (-688.301) (-686.930) [-687.033] -- 0:00:37
379500 -- (-686.823) (-687.610) [-684.868] (-685.820) * (-687.697) (-685.118) [-686.445] (-686.746) -- 0:00:37
380000 -- (-690.309) [-689.018] (-684.987) (-686.986) * (-686.098) (-686.551) [-686.407] (-686.240) -- 0:00:37
Average standard deviation of split frequencies: 0.013140
380500 -- (-690.642) [-688.409] (-685.095) (-685.479) * [-685.630] (-688.103) (-685.276) (-689.718) -- 0:00:37
381000 -- (-692.818) (-686.306) (-687.630) [-687.022] * (-686.667) (-687.866) [-690.538] (-688.015) -- 0:00:37
381500 -- (-686.829) (-689.570) (-685.494) [-685.649] * [-684.994] (-688.427) (-689.625) (-687.195) -- 0:00:37
382000 -- (-688.611) (-686.845) [-685.473] (-688.448) * (-686.418) [-689.506] (-685.065) (-687.371) -- 0:00:37
382500 -- (-689.816) (-685.949) (-688.233) [-685.704] * (-686.328) (-687.605) (-685.343) [-686.634] -- 0:00:37
383000 -- (-686.080) [-686.481] (-685.398) (-689.352) * (-685.650) (-687.355) [-685.208] (-688.739) -- 0:00:37
383500 -- [-686.312] (-687.070) (-686.678) (-690.512) * (-685.650) [-684.701] (-686.718) (-689.688) -- 0:00:36
384000 -- (-687.626) (-687.038) [-685.872] (-691.245) * (-685.214) (-689.107) [-685.170] (-686.921) -- 0:00:36
384500 -- (-687.116) [-686.802] (-687.281) (-689.473) * (-685.456) (-690.942) [-686.806] (-686.873) -- 0:00:36
385000 -- (-687.493) (-689.446) (-685.008) [-686.666] * (-688.672) [-686.666] (-686.043) (-689.247) -- 0:00:36
Average standard deviation of split frequencies: 0.013773
385500 -- [-687.760] (-688.702) (-688.231) (-686.060) * (-688.955) [-689.192] (-687.411) (-686.373) -- 0:00:36
386000 -- (-687.989) (-685.820) [-686.803] (-686.719) * [-686.611] (-686.406) (-689.690) (-690.797) -- 0:00:36
386500 -- (-688.759) [-685.342] (-686.285) (-691.579) * (-685.449) (-687.751) (-689.963) [-686.885] -- 0:00:36
387000 -- [-687.099] (-685.282) (-687.264) (-687.543) * (-687.934) (-686.872) (-690.886) [-687.884] -- 0:00:36
387500 -- (-687.657) (-687.865) [-685.651] (-684.986) * (-684.965) (-687.225) (-686.785) [-685.643] -- 0:00:36
388000 -- (-686.510) [-689.646] (-690.258) (-685.288) * (-687.011) [-686.126] (-687.324) (-686.658) -- 0:00:37
388500 -- [-684.970] (-686.266) (-688.247) (-687.364) * (-697.159) (-685.223) (-685.643) [-686.068] -- 0:00:37
389000 -- (-687.979) (-687.091) (-689.570) [-686.885] * (-694.154) (-686.965) (-685.552) [-687.119] -- 0:00:37
389500 -- (-688.666) [-686.905] (-688.374) (-689.059) * (-699.311) (-688.144) (-686.897) [-686.430] -- 0:00:37
390000 -- (-690.369) [-687.798] (-686.482) (-688.119) * [-691.277] (-685.369) (-685.502) (-686.982) -- 0:00:37
Average standard deviation of split frequencies: 0.014346
390500 -- (-684.508) (-686.975) [-686.195] (-685.800) * [-685.256] (-686.081) (-685.785) (-690.064) -- 0:00:37
391000 -- (-685.865) (-685.711) [-687.937] (-690.742) * (-687.819) [-689.040] (-685.984) (-690.863) -- 0:00:37
391500 -- [-685.796] (-685.890) (-689.162) (-685.436) * (-689.793) [-686.394] (-686.393) (-689.312) -- 0:00:37
392000 -- (-685.363) (-688.444) (-688.836) [-686.952] * [-688.205] (-687.986) (-689.810) (-687.960) -- 0:00:37
392500 -- (-685.598) [-686.977] (-685.068) (-692.457) * (-685.919) [-688.390] (-690.201) (-691.737) -- 0:00:37
393000 -- (-685.055) (-686.603) (-685.038) [-686.143] * (-687.102) [-685.008] (-687.091) (-686.036) -- 0:00:37
393500 -- (-686.958) (-690.849) [-686.596] (-688.560) * (-686.413) (-685.327) [-687.652] (-685.986) -- 0:00:36
394000 -- (-688.257) (-685.970) (-688.022) [-688.236] * (-686.648) (-685.252) (-687.785) [-687.296] -- 0:00:36
394500 -- (-687.694) [-685.596] (-686.004) (-691.700) * (-686.925) (-689.696) (-687.606) [-687.973] -- 0:00:36
395000 -- (-685.407) [-686.832] (-687.055) (-692.155) * (-688.469) (-689.956) [-685.397] (-688.021) -- 0:00:36
Average standard deviation of split frequencies: 0.014087
395500 -- (-686.411) [-686.930] (-688.361) (-687.586) * (-686.313) (-685.117) (-689.084) [-686.729] -- 0:00:36
396000 -- (-685.309) (-686.180) [-686.921] (-687.532) * [-686.899] (-688.657) (-685.824) (-685.902) -- 0:00:36
396500 -- (-685.245) [-686.510] (-687.394) (-687.031) * (-685.546) (-689.802) (-685.665) [-687.263] -- 0:00:36
397000 -- (-687.790) (-686.223) [-686.189] (-688.887) * (-685.674) (-689.867) (-685.501) [-686.991] -- 0:00:36
397500 -- (-685.347) [-690.172] (-689.698) (-688.679) * (-686.132) (-686.673) (-686.465) [-685.563] -- 0:00:36
398000 -- (-687.368) (-690.785) [-689.023] (-686.620) * [-686.373] (-685.389) (-687.446) (-686.637) -- 0:00:36
398500 -- [-685.434] (-685.353) (-689.752) (-684.963) * (-690.245) [-686.083] (-686.408) (-688.358) -- 0:00:36
399000 -- (-686.833) (-690.098) (-684.846) [-685.594] * (-687.022) (-686.268) (-686.247) [-687.052] -- 0:00:36
399500 -- (-686.978) [-687.510] (-685.226) (-686.329) * (-687.815) (-687.054) (-687.488) [-688.590] -- 0:00:36
400000 -- (-687.150) [-687.408] (-686.967) (-688.087) * (-686.711) [-685.888] (-687.139) (-689.853) -- 0:00:36
Average standard deviation of split frequencies: 0.013726
400500 -- (-687.302) [-686.791] (-686.205) (-686.878) * (-686.198) (-685.731) [-685.492] (-686.419) -- 0:00:35
401000 -- (-689.447) (-686.270) (-695.175) [-685.880] * (-688.529) (-687.612) [-686.062] (-684.823) -- 0:00:35
401500 -- [-689.079] (-685.603) (-690.892) (-685.590) * [-686.213] (-690.755) (-685.536) (-685.445) -- 0:00:35
402000 -- (-689.922) (-690.113) [-689.940] (-688.325) * [-686.234] (-688.613) (-685.348) (-687.382) -- 0:00:35
402500 -- (-687.363) (-687.893) [-685.928] (-691.120) * (-685.913) (-692.714) [-684.936] (-684.732) -- 0:00:35
403000 -- (-687.782) [-685.562] (-685.655) (-686.942) * (-686.529) (-692.882) (-686.637) [-687.207] -- 0:00:35
403500 -- (-694.427) [-687.620] (-686.327) (-685.646) * (-687.719) (-688.067) (-686.317) [-688.470] -- 0:00:35
404000 -- (-688.375) [-685.819] (-685.444) (-686.465) * (-684.757) [-690.982] (-688.829) (-686.123) -- 0:00:35
404500 -- (-686.270) [-686.622] (-685.300) (-686.344) * (-686.270) (-686.209) (-686.979) [-685.939] -- 0:00:35
405000 -- [-685.809] (-686.207) (-688.222) (-686.182) * [-686.017] (-684.873) (-687.415) (-685.046) -- 0:00:36
Average standard deviation of split frequencies: 0.013159
405500 -- (-686.040) [-687.001] (-686.463) (-690.023) * (-689.071) (-685.592) (-695.397) [-687.062] -- 0:00:36
406000 -- (-689.436) (-689.326) (-687.581) [-688.950] * (-687.837) (-691.681) (-690.819) [-687.645] -- 0:00:36
406500 -- (-685.845) [-684.639] (-689.270) (-688.159) * (-686.694) [-686.364] (-689.147) (-687.060) -- 0:00:36
407000 -- (-688.120) (-686.556) (-687.603) [-687.211] * (-688.178) (-687.434) [-688.055] (-685.555) -- 0:00:36
407500 -- (-687.121) [-685.145] (-687.566) (-685.934) * (-688.927) (-686.115) [-685.668] (-687.120) -- 0:00:36
408000 -- [-685.995] (-686.217) (-689.342) (-686.322) * (-688.381) (-686.450) [-685.566] (-687.649) -- 0:00:36
408500 -- (-688.057) (-688.608) (-686.921) [-686.512] * [-686.792] (-685.639) (-688.469) (-689.152) -- 0:00:36
409000 -- (-689.563) [-685.974] (-688.113) (-685.158) * [-687.367] (-685.850) (-686.702) (-692.690) -- 0:00:36
409500 -- (-685.654) (-686.938) (-690.098) [-689.291] * (-685.468) (-686.084) [-686.470] (-686.215) -- 0:00:36
410000 -- [-685.575] (-693.763) (-685.680) (-686.786) * (-690.442) [-690.853] (-685.621) (-685.545) -- 0:00:35
Average standard deviation of split frequencies: 0.013392
410500 -- [-684.680] (-686.092) (-692.697) (-686.480) * [-688.566] (-687.199) (-687.184) (-687.399) -- 0:00:35
411000 -- (-687.491) (-684.954) [-687.972] (-688.144) * [-687.398] (-686.212) (-688.480) (-689.269) -- 0:00:35
411500 -- [-689.135] (-686.598) (-688.207) (-689.405) * (-688.165) [-685.107] (-686.956) (-687.378) -- 0:00:35
412000 -- (-691.461) [-686.771] (-684.789) (-689.277) * (-688.556) (-690.570) [-687.024] (-688.012) -- 0:00:35
412500 -- [-690.550] (-684.982) (-689.161) (-686.105) * (-686.356) (-687.693) (-688.109) [-685.454] -- 0:00:35
413000 -- (-691.967) [-685.784] (-684.855) (-685.073) * (-687.433) (-690.402) [-686.350] (-686.436) -- 0:00:35
413500 -- (-687.427) (-685.433) [-689.663] (-685.211) * (-686.448) (-689.830) (-690.345) [-685.329] -- 0:00:35
414000 -- (-686.185) (-684.949) (-686.685) [-685.121] * (-685.273) (-685.160) (-686.743) [-686.654] -- 0:00:35
414500 -- (-689.224) (-687.198) [-686.642] (-684.829) * (-685.349) (-687.665) [-688.414] (-685.420) -- 0:00:35
415000 -- (-687.897) (-688.087) (-685.595) [-686.675] * [-687.718] (-685.803) (-689.011) (-685.793) -- 0:00:35
Average standard deviation of split frequencies: 0.013332
415500 -- (-690.548) (-686.494) (-687.293) [-686.735] * [-687.843] (-687.166) (-686.680) (-685.799) -- 0:00:35
416000 -- [-686.286] (-687.315) (-685.060) (-687.618) * (-690.980) [-686.698] (-688.192) (-687.451) -- 0:00:35
416500 -- [-685.761] (-686.843) (-687.697) (-687.441) * [-687.703] (-688.236) (-689.750) (-685.216) -- 0:00:35
417000 -- (-690.660) [-693.835] (-688.319) (-689.088) * (-688.126) (-685.167) [-686.187] (-685.484) -- 0:00:34
417500 -- (-693.448) (-689.215) [-686.977] (-696.173) * (-687.075) [-684.965] (-691.714) (-685.874) -- 0:00:34
418000 -- (-688.080) (-688.416) (-686.480) [-691.019] * [-687.600] (-685.041) (-687.467) (-691.329) -- 0:00:34
418500 -- (-685.702) (-688.407) [-685.238] (-686.864) * (-686.160) (-686.449) (-688.583) [-686.414] -- 0:00:34
419000 -- (-687.226) (-685.813) (-685.690) [-685.277] * (-687.242) (-686.222) [-690.186] (-688.857) -- 0:00:34
419500 -- (-685.911) (-685.861) [-686.107] (-687.570) * [-688.841] (-686.307) (-688.537) (-689.242) -- 0:00:34
420000 -- [-685.990] (-688.139) (-687.397) (-686.446) * (-685.798) (-687.214) (-687.586) [-686.973] -- 0:00:34
Average standard deviation of split frequencies: 0.013579
420500 -- (-695.451) (-685.715) (-687.166) [-686.368] * [-686.016] (-688.604) (-687.315) (-686.634) -- 0:00:35
421000 -- (-685.759) (-685.999) (-689.959) [-684.881] * (-688.865) (-685.844) (-688.669) [-684.905] -- 0:00:35
421500 -- (-684.738) (-687.219) (-687.009) [-685.028] * [-685.297] (-686.669) (-693.375) (-686.030) -- 0:00:35
422000 -- (-684.698) (-685.854) [-688.166] (-693.417) * (-685.725) (-689.277) [-688.926] (-689.540) -- 0:00:35
422500 -- [-687.494] (-686.345) (-685.329) (-689.515) * [-687.085] (-688.828) (-687.097) (-686.716) -- 0:00:35
423000 -- (-686.033) (-688.042) [-686.062] (-689.978) * (-686.983) [-687.926] (-687.885) (-689.659) -- 0:00:35
423500 -- [-687.427] (-687.997) (-686.954) (-687.939) * (-687.545) [-688.049] (-691.168) (-686.430) -- 0:00:35
424000 -- (-685.135) (-687.091) (-686.572) [-685.903] * [-686.289] (-687.353) (-688.388) (-685.087) -- 0:00:35
424500 -- (-686.066) (-686.071) (-686.737) [-686.612] * [-687.087] (-685.555) (-685.833) (-686.277) -- 0:00:35
425000 -- [-688.418] (-685.287) (-686.605) (-686.526) * (-688.828) (-685.677) [-687.252] (-689.763) -- 0:00:35
Average standard deviation of split frequencies: 0.013735
425500 -- [-688.517] (-686.169) (-686.671) (-685.795) * [-686.619] (-685.499) (-686.710) (-686.540) -- 0:00:35
426000 -- (-688.150) (-685.577) [-686.822] (-687.036) * (-688.371) (-687.208) (-690.661) [-688.463] -- 0:00:35
426500 -- (-685.025) [-688.360] (-686.286) (-687.314) * (-686.815) (-685.983) (-685.990) [-686.439] -- 0:00:34
427000 -- (-690.744) (-686.303) [-689.599] (-686.414) * (-687.316) (-686.376) (-690.890) [-686.922] -- 0:00:34
427500 -- (-686.326) (-685.732) (-686.362) [-686.119] * (-686.552) (-687.875) [-685.420] (-687.012) -- 0:00:34
428000 -- (-686.556) (-690.471) [-685.611] (-686.535) * (-685.609) [-686.047] (-688.054) (-689.009) -- 0:00:34
428500 -- (-690.418) (-684.869) (-687.716) [-686.566] * (-686.471) (-689.580) [-688.405] (-688.021) -- 0:00:34
429000 -- (-687.447) (-685.226) (-685.973) [-687.892] * [-687.607] (-684.619) (-686.740) (-691.181) -- 0:00:34
429500 -- (-686.388) (-685.055) [-684.910] (-686.575) * (-688.056) [-687.001] (-688.385) (-693.025) -- 0:00:34
430000 -- (-686.297) (-686.816) (-684.852) [-685.011] * [-686.834] (-687.385) (-687.132) (-685.988) -- 0:00:34
Average standard deviation of split frequencies: 0.013843
430500 -- (-685.162) [-686.324] (-686.258) (-692.351) * (-688.063) (-685.789) (-687.728) [-688.824] -- 0:00:34
431000 -- [-684.959] (-685.869) (-685.938) (-695.082) * [-687.227] (-684.808) (-688.266) (-685.245) -- 0:00:34
431500 -- (-689.619) [-688.213] (-686.299) (-687.798) * (-688.123) [-684.843] (-690.062) (-686.152) -- 0:00:34
432000 -- (-686.005) (-691.251) (-685.128) [-688.370] * (-686.359) (-684.883) [-686.557] (-691.099) -- 0:00:34
432500 -- [-685.634] (-685.351) (-690.250) (-686.485) * [-686.067] (-685.349) (-689.900) (-689.520) -- 0:00:34
433000 -- (-687.004) [-691.992] (-689.743) (-686.717) * (-685.072) (-684.757) [-685.626] (-686.846) -- 0:00:34
433500 -- [-686.014] (-690.958) (-687.757) (-686.599) * (-687.156) (-687.166) (-686.896) [-686.666] -- 0:00:33
434000 -- (-686.138) (-688.319) [-685.945] (-686.051) * (-690.020) (-687.137) [-687.556] (-687.976) -- 0:00:33
434500 -- (-684.892) (-686.002) [-686.005] (-685.872) * (-687.110) [-684.625] (-685.731) (-685.062) -- 0:00:33
435000 -- (-685.068) [-685.950] (-687.290) (-685.658) * (-687.852) (-685.883) [-687.300] (-687.851) -- 0:00:33
Average standard deviation of split frequencies: 0.013801
435500 -- (-686.972) [-684.930] (-686.957) (-690.023) * (-689.771) [-686.559] (-685.370) (-689.893) -- 0:00:33
436000 -- (-686.930) [-684.899] (-685.977) (-687.600) * (-686.607) [-687.475] (-685.607) (-687.358) -- 0:00:33
436500 -- (-685.515) (-687.904) (-686.688) [-686.756] * [-687.431] (-686.609) (-685.266) (-689.161) -- 0:00:33
437000 -- (-686.160) (-685.125) [-685.526] (-687.467) * (-687.545) (-685.224) (-685.993) [-692.778] -- 0:00:34
437500 -- (-687.313) (-687.634) (-690.829) [-687.777] * (-686.689) (-689.125) [-685.038] (-686.975) -- 0:00:34
438000 -- (-687.221) (-687.013) (-690.421) [-686.905] * (-687.506) (-686.591) [-685.959] (-686.945) -- 0:00:34
438500 -- [-686.098] (-687.555) (-685.008) (-685.841) * (-686.240) (-687.880) [-686.820] (-686.185) -- 0:00:34
439000 -- (-686.804) [-686.866] (-686.299) (-687.648) * (-686.216) (-686.961) [-685.135] (-689.555) -- 0:00:34
439500 -- (-686.543) [-691.164] (-684.900) (-687.338) * (-686.539) (-685.870) [-684.989] (-686.626) -- 0:00:34
440000 -- (-686.794) [-689.179] (-688.891) (-693.594) * (-685.089) (-687.811) [-686.542] (-685.148) -- 0:00:34
Average standard deviation of split frequencies: 0.013439
440500 -- [-685.370] (-688.770) (-687.040) (-686.954) * (-685.041) (-684.660) [-685.228] (-685.216) -- 0:00:34
441000 -- (-685.758) (-691.340) (-685.630) [-686.582] * [-685.029] (-688.918) (-688.070) (-688.135) -- 0:00:34
441500 -- (-692.082) (-691.262) [-687.220] (-685.012) * (-686.379) (-689.643) (-685.415) [-685.174] -- 0:00:34
442000 -- (-687.685) [-686.692] (-687.101) (-685.565) * (-688.113) (-689.090) (-687.702) [-685.516] -- 0:00:34
442500 -- [-686.078] (-685.829) (-686.896) (-685.359) * [-685.460] (-689.403) (-689.917) (-685.736) -- 0:00:34
443000 -- (-685.647) (-686.355) (-685.534) [-685.241] * [-684.983] (-691.411) (-687.657) (-684.907) -- 0:00:33
443500 -- (-685.080) (-698.676) [-688.362] (-686.253) * (-685.232) (-687.391) (-686.123) [-685.163] -- 0:00:33
444000 -- (-685.385) (-698.128) [-688.581] (-690.973) * [-685.484] (-686.833) (-687.923) (-684.784) -- 0:00:33
444500 -- (-686.566) (-691.374) [-687.261] (-690.464) * (-685.058) [-686.996] (-686.714) (-686.154) -- 0:00:33
445000 -- (-686.485) [-689.413] (-687.595) (-686.684) * (-685.404) (-691.072) [-687.639] (-689.031) -- 0:00:33
Average standard deviation of split frequencies: 0.014114
445500 -- (-686.587) (-688.224) (-685.807) [-686.283] * [-685.651] (-689.641) (-690.498) (-689.710) -- 0:00:33
446000 -- (-688.349) (-686.311) [-686.008] (-691.378) * (-686.137) [-687.453] (-685.575) (-685.817) -- 0:00:33
446500 -- (-688.012) (-686.754) (-686.000) [-686.181] * (-687.582) (-685.518) (-692.510) [-688.209] -- 0:00:33
447000 -- (-686.864) (-692.683) (-686.720) [-686.363] * (-690.065) [-685.279] (-695.214) (-688.166) -- 0:00:33
447500 -- (-685.533) (-688.538) [-687.749] (-687.052) * [-686.887] (-685.840) (-686.888) (-685.574) -- 0:00:33
448000 -- [-686.084] (-686.630) (-686.625) (-687.862) * [-685.046] (-687.215) (-685.994) (-688.101) -- 0:00:33
448500 -- [-686.239] (-687.862) (-687.420) (-688.667) * (-688.104) (-687.234) [-685.335] (-685.584) -- 0:00:33
449000 -- [-686.644] (-686.291) (-685.434) (-689.551) * (-687.345) (-687.508) (-686.766) [-686.690] -- 0:00:33
449500 -- [-688.272] (-689.896) (-690.070) (-688.889) * (-686.725) [-686.875] (-688.438) (-689.630) -- 0:00:33
450000 -- (-688.117) (-687.485) (-690.070) [-687.548] * [-688.724] (-690.166) (-687.528) (-686.394) -- 0:00:33
Average standard deviation of split frequencies: 0.014710
450500 -- (-685.838) [-685.179] (-688.408) (-687.952) * (-687.629) (-690.317) [-691.050] (-689.075) -- 0:00:32
451000 -- (-686.140) (-687.070) [-688.456] (-688.218) * [-686.236] (-688.195) (-687.146) (-689.081) -- 0:00:32
451500 -- (-687.412) (-684.705) [-687.620] (-688.470) * (-685.947) (-694.094) (-687.404) [-687.118] -- 0:00:32
452000 -- (-685.708) [-684.840] (-686.549) (-687.119) * [-685.436] (-686.755) (-686.289) (-687.293) -- 0:00:32
452500 -- (-684.707) [-684.840] (-685.601) (-685.447) * (-690.663) (-688.661) [-685.686] (-686.365) -- 0:00:32
453000 -- (-686.578) (-686.317) [-685.919] (-687.337) * [-686.593] (-689.611) (-689.245) (-686.273) -- 0:00:32
453500 -- (-686.721) [-687.083] (-687.917) (-690.837) * (-687.006) [-687.775] (-688.184) (-685.597) -- 0:00:32
454000 -- (-686.224) (-686.748) [-689.293] (-688.747) * [-685.953] (-686.341) (-686.998) (-685.564) -- 0:00:33
454500 -- [-687.912] (-688.772) (-689.064) (-687.568) * [-687.225] (-685.686) (-687.214) (-687.227) -- 0:00:33
455000 -- (-691.591) (-688.743) [-685.340] (-688.261) * (-685.319) [-686.192] (-688.123) (-686.132) -- 0:00:33
Average standard deviation of split frequencies: 0.014731
455500 -- (-689.006) (-687.215) [-686.585] (-686.330) * [-687.070] (-686.352) (-689.465) (-684.515) -- 0:00:33
456000 -- (-686.490) (-687.777) (-685.140) [-685.118] * (-688.601) [-685.487] (-685.763) (-685.891) -- 0:00:33
456500 -- [-686.716] (-688.199) (-684.644) (-693.159) * (-686.251) [-686.597] (-687.467) (-686.355) -- 0:00:33
457000 -- [-687.236] (-692.459) (-687.348) (-687.889) * (-684.980) (-689.740) [-686.290] (-685.316) -- 0:00:33
457500 -- (-688.374) (-690.000) [-685.297] (-688.496) * (-686.529) (-685.014) (-693.543) [-686.603] -- 0:00:33
458000 -- [-686.486] (-688.226) (-689.902) (-686.042) * [-689.551] (-686.423) (-688.340) (-687.027) -- 0:00:33
458500 -- (-686.155) (-685.204) [-686.203] (-684.719) * (-688.609) (-689.357) (-689.291) [-685.694] -- 0:00:33
459000 -- (-684.860) (-686.129) (-686.808) [-686.688] * [-685.769] (-688.279) (-690.478) (-687.356) -- 0:00:33
459500 -- (-685.607) [-685.337] (-684.856) (-685.710) * (-686.832) (-687.593) [-689.569] (-687.310) -- 0:00:32
460000 -- (-686.690) (-686.729) (-687.978) [-687.738] * (-686.152) (-687.249) (-687.816) [-688.617] -- 0:00:32
Average standard deviation of split frequencies: 0.014902
460500 -- (-685.048) (-688.452) [-685.696] (-686.417) * (-686.458) (-686.169) (-687.706) [-687.203] -- 0:00:32
461000 -- (-685.461) (-688.620) [-686.440] (-686.040) * (-686.159) (-689.718) (-686.186) [-686.209] -- 0:00:32
461500 -- (-686.927) [-685.663] (-687.597) (-686.605) * (-686.081) (-685.431) (-686.345) [-685.985] -- 0:00:32
462000 -- (-688.692) (-685.109) [-686.724] (-686.962) * (-685.842) (-686.811) (-687.800) [-688.918] -- 0:00:32
462500 -- (-689.893) (-689.414) [-685.869] (-688.357) * (-685.830) [-686.501] (-686.553) (-685.744) -- 0:00:32
463000 -- (-687.335) [-688.341] (-685.464) (-687.912) * [-687.087] (-688.119) (-684.746) (-686.134) -- 0:00:32
463500 -- (-691.540) (-689.733) [-685.599] (-690.475) * (-687.099) (-687.468) (-685.305) [-685.577] -- 0:00:32
464000 -- (-691.123) (-687.859) (-687.469) [-688.979] * (-699.521) [-686.046] (-686.983) (-685.192) -- 0:00:32
464500 -- (-687.225) [-685.277] (-687.285) (-687.413) * (-687.741) (-688.099) (-686.203) [-688.953] -- 0:00:32
465000 -- [-685.613] (-691.106) (-689.320) (-686.408) * (-687.101) (-685.981) [-687.092] (-690.461) -- 0:00:32
Average standard deviation of split frequencies: 0.014099
465500 -- (-686.872) (-687.418) (-685.159) [-685.112] * (-690.481) (-685.860) (-686.432) [-687.458] -- 0:00:32
466000 -- (-685.105) (-689.015) (-686.560) [-684.733] * (-686.525) (-685.594) (-687.514) [-689.699] -- 0:00:32
466500 -- (-687.576) [-686.162] (-686.616) (-685.499) * (-687.680) (-687.192) [-686.136] (-686.876) -- 0:00:32
467000 -- (-687.888) (-685.605) [-686.783] (-685.753) * [-689.040] (-689.543) (-687.675) (-686.606) -- 0:00:31
467500 -- [-686.917] (-686.140) (-686.528) (-687.249) * (-686.512) [-686.469] (-685.551) (-697.757) -- 0:00:31
468000 -- (-686.589) (-687.048) (-686.963) [-686.311] * (-686.623) (-688.897) (-685.687) [-687.326] -- 0:00:31
468500 -- (-685.985) [-684.804] (-687.650) (-687.560) * (-688.044) (-687.088) [-685.114] (-689.526) -- 0:00:31
469000 -- (-686.071) [-686.458] (-685.741) (-685.692) * [-686.835] (-689.351) (-687.129) (-687.096) -- 0:00:31
469500 -- (-685.664) [-685.271] (-686.255) (-689.279) * (-689.095) (-687.328) (-689.945) [-684.919] -- 0:00:31
470000 -- (-686.008) (-688.867) (-687.632) [-685.429] * (-688.188) (-689.556) [-687.574] (-687.418) -- 0:00:31
Average standard deviation of split frequencies: 0.014335
470500 -- (-685.991) [-687.155] (-686.171) (-685.894) * (-686.258) [-687.623] (-690.588) (-687.445) -- 0:00:32
471000 -- (-685.745) (-691.362) [-686.240] (-685.066) * (-687.590) [-686.355] (-685.137) (-686.333) -- 0:00:32
471500 -- (-688.262) (-685.586) (-690.754) [-685.908] * (-685.457) [-686.123] (-685.398) (-688.419) -- 0:00:32
472000 -- (-687.517) [-686.951] (-684.830) (-691.227) * (-686.233) (-685.804) (-686.183) [-687.200] -- 0:00:32
472500 -- (-692.504) (-685.078) [-687.639] (-687.639) * (-693.702) (-686.411) (-688.697) [-689.131] -- 0:00:32
473000 -- [-690.481] (-691.522) (-688.051) (-685.299) * (-686.665) (-686.946) (-688.000) [-687.679] -- 0:00:32
473500 -- (-685.237) (-686.651) (-688.866) [-688.884] * (-689.691) (-687.395) (-686.271) [-685.793] -- 0:00:32
474000 -- [-686.625] (-685.860) (-697.004) (-692.426) * [-686.108] (-687.393) (-685.188) (-688.421) -- 0:00:32
474500 -- (-686.564) (-685.868) (-689.775) [-685.539] * (-686.921) (-688.326) [-685.713] (-687.812) -- 0:00:32
475000 -- [-686.559] (-686.829) (-689.918) (-686.480) * (-685.235) [-685.317] (-687.711) (-686.753) -- 0:00:32
Average standard deviation of split frequencies: 0.013803
475500 -- (-685.034) [-686.360] (-686.469) (-686.420) * (-689.679) (-685.879) (-690.044) [-688.371] -- 0:00:31
476000 -- (-685.499) (-685.708) [-684.525] (-690.853) * [-686.012] (-686.095) (-690.716) (-687.225) -- 0:00:31
476500 -- [-685.437] (-685.146) (-685.462) (-685.483) * [-687.363] (-686.787) (-690.534) (-690.358) -- 0:00:31
477000 -- (-686.671) (-688.730) (-687.820) [-688.868] * (-689.952) (-687.034) (-686.218) [-685.038] -- 0:00:31
477500 -- (-686.753) (-689.166) [-689.283] (-687.018) * (-689.474) (-686.232) (-688.178) [-688.308] -- 0:00:31
478000 -- (-687.986) [-687.404] (-687.573) (-687.767) * (-684.923) (-688.271) [-687.290] (-687.505) -- 0:00:31
478500 -- (-686.542) (-688.587) [-687.589] (-691.986) * (-684.838) (-692.272) [-685.928] (-687.276) -- 0:00:31
479000 -- (-685.342) [-688.989] (-686.944) (-690.433) * (-685.561) [-689.452] (-687.402) (-690.070) -- 0:00:31
479500 -- [-685.209] (-685.582) (-686.990) (-686.768) * (-685.042) (-689.764) [-686.603] (-687.165) -- 0:00:31
480000 -- [-687.688] (-686.183) (-685.678) (-686.566) * (-685.275) [-687.653] (-686.965) (-685.871) -- 0:00:31
Average standard deviation of split frequencies: 0.013669
480500 -- [-686.833] (-689.959) (-685.249) (-685.940) * (-685.741) (-685.471) [-685.844] (-689.894) -- 0:00:31
481000 -- (-686.325) (-687.801) (-687.607) [-687.425] * [-685.849] (-687.002) (-688.880) (-686.690) -- 0:00:31
481500 -- (-687.486) (-685.807) (-689.528) [-685.659] * (-685.219) [-686.861] (-686.524) (-685.688) -- 0:00:31
482000 -- (-684.962) (-685.164) (-688.336) [-686.528] * (-689.602) [-686.168] (-686.137) (-685.235) -- 0:00:31
482500 -- [-685.799] (-691.533) (-688.371) (-685.385) * (-687.295) (-686.283) [-685.883] (-686.591) -- 0:00:31
483000 -- (-685.987) (-687.877) [-686.480] (-692.206) * (-685.823) (-687.140) [-685.311] (-687.044) -- 0:00:31
483500 -- (-687.133) (-688.259) (-686.981) [-685.672] * (-687.843) (-688.652) [-684.942] (-688.739) -- 0:00:30
484000 -- (-690.270) [-689.244] (-686.520) (-687.388) * [-685.943] (-687.002) (-685.485) (-687.009) -- 0:00:30
484500 -- (-687.096) [-688.765] (-685.497) (-686.195) * (-684.643) [-685.075] (-688.825) (-687.841) -- 0:00:30
485000 -- (-686.216) (-688.466) [-685.437] (-685.159) * (-687.902) (-685.331) (-691.067) [-687.308] -- 0:00:30
Average standard deviation of split frequencies: 0.012670
485500 -- (-685.742) [-687.243] (-686.089) (-687.213) * (-689.432) (-687.749) (-687.564) [-688.806] -- 0:00:30
486000 -- (-689.775) (-685.539) (-687.953) [-687.161] * (-686.628) (-691.071) (-685.018) [-685.905] -- 0:00:30
486500 -- (-688.325) (-686.210) [-685.205] (-685.750) * (-686.273) [-688.124] (-684.969) (-686.706) -- 0:00:30
487000 -- (-686.757) (-686.384) [-685.380] (-685.089) * (-685.409) (-691.606) (-691.168) [-688.607] -- 0:00:30
487500 -- [-686.081] (-686.445) (-690.598) (-684.663) * [-686.890] (-689.757) (-691.031) (-686.662) -- 0:00:31
488000 -- (-687.960) [-686.507] (-697.839) (-687.351) * (-688.770) (-688.650) [-687.171] (-686.433) -- 0:00:31
488500 -- (-690.347) (-691.648) [-686.456] (-686.749) * (-688.788) (-685.059) [-685.577] (-686.458) -- 0:00:31
489000 -- (-689.691) [-685.267] (-688.405) (-687.233) * (-686.871) (-684.970) (-687.761) [-688.364] -- 0:00:31
489500 -- (-686.508) (-690.351) [-687.985] (-688.625) * (-685.942) [-686.418] (-685.798) (-687.446) -- 0:00:31
490000 -- (-685.885) (-689.095) (-688.075) [-685.012] * (-687.328) (-686.405) (-687.048) [-685.762] -- 0:00:31
Average standard deviation of split frequencies: 0.012790
490500 -- (-687.669) (-688.492) [-687.669] (-685.254) * (-687.531) [-686.951] (-687.054) (-686.998) -- 0:00:31
491000 -- (-688.059) [-689.787] (-687.079) (-684.894) * (-686.076) (-685.330) (-685.605) [-686.477] -- 0:00:31
491500 -- (-689.906) (-689.727) [-689.039] (-690.117) * (-686.979) (-685.627) [-687.938] (-686.813) -- 0:00:31
492000 -- [-688.112] (-686.326) (-685.929) (-688.638) * (-687.295) [-685.873] (-688.756) (-688.869) -- 0:00:30
492500 -- [-687.059] (-687.446) (-686.496) (-688.463) * (-689.559) (-688.739) [-687.595] (-687.466) -- 0:00:30
493000 -- (-685.732) (-692.659) [-686.284] (-685.314) * (-688.154) (-688.831) (-686.067) [-685.965] -- 0:00:30
493500 -- (-689.264) [-685.508] (-688.038) (-686.830) * (-687.383) (-689.910) [-685.762] (-685.672) -- 0:00:30
494000 -- (-687.625) [-686.689] (-690.207) (-686.751) * (-686.367) (-688.104) (-686.231) [-686.953] -- 0:00:30
494500 -- (-685.710) [-690.534] (-686.516) (-686.761) * (-686.788) [-688.262] (-686.123) (-687.722) -- 0:00:30
495000 -- (-685.108) [-688.549] (-690.996) (-686.531) * (-686.064) (-687.617) [-684.969] (-686.445) -- 0:00:30
Average standard deviation of split frequencies: 0.012474
495500 -- (-688.978) (-687.164) (-687.485) [-688.235] * (-688.364) [-689.105] (-688.612) (-687.977) -- 0:00:30
496000 -- [-686.614] (-685.556) (-688.483) (-687.616) * [-690.773] (-686.547) (-689.662) (-686.447) -- 0:00:30
496500 -- [-686.836] (-687.376) (-688.845) (-686.467) * (-689.082) (-685.992) [-688.873] (-686.407) -- 0:00:30
497000 -- (-686.519) (-690.627) [-686.073] (-687.236) * [-689.627] (-687.693) (-685.414) (-686.631) -- 0:00:30
497500 -- (-687.444) [-688.553] (-685.771) (-685.293) * (-689.735) (-690.940) [-685.293] (-688.934) -- 0:00:30
498000 -- [-687.971] (-687.791) (-685.523) (-687.178) * [-686.296] (-689.917) (-690.012) (-688.860) -- 0:00:30
498500 -- (-691.421) (-686.340) [-686.734] (-686.653) * [-687.337] (-688.519) (-687.796) (-689.659) -- 0:00:30
499000 -- (-685.861) (-685.999) [-686.561] (-686.941) * (-690.520) (-685.186) (-686.774) [-685.562] -- 0:00:30
499500 -- (-690.092) (-685.842) (-688.536) [-687.980] * [-688.879] (-686.549) (-688.334) (-688.426) -- 0:00:30
500000 -- (-686.728) [-686.852] (-685.995) (-692.736) * (-691.575) (-686.613) [-685.722] (-685.091) -- 0:00:30
Average standard deviation of split frequencies: 0.012123
500500 -- [-687.226] (-685.436) (-688.085) (-685.405) * (-688.342) (-687.052) [-686.772] (-686.564) -- 0:00:29
501000 -- [-686.603] (-690.383) (-688.564) (-686.264) * (-687.078) (-686.427) (-689.211) [-687.922] -- 0:00:29
501500 -- (-687.522) (-685.414) (-688.861) [-687.251] * [-689.126] (-686.343) (-691.419) (-688.099) -- 0:00:29
502000 -- (-687.913) [-687.533] (-689.317) (-686.159) * (-688.989) (-685.311) (-687.656) [-685.547] -- 0:00:29
502500 -- (-689.669) (-685.273) [-689.033] (-686.164) * [-688.265] (-686.174) (-686.100) (-686.584) -- 0:00:29
503000 -- (-690.835) [-686.340] (-691.648) (-686.023) * (-687.785) (-685.624) [-686.231] (-685.200) -- 0:00:29
503500 -- [-686.356] (-685.100) (-686.959) (-687.842) * (-688.041) (-688.677) [-685.796] (-687.378) -- 0:00:29
504000 -- (-685.615) (-685.043) [-687.861] (-689.099) * [-686.340] (-685.837) (-686.218) (-687.544) -- 0:00:29
504500 -- (-685.202) (-686.129) (-689.372) [-688.303] * [-685.804] (-685.491) (-685.601) (-687.089) -- 0:00:30
505000 -- (-688.316) (-687.000) [-689.851] (-687.431) * (-685.294) [-687.422] (-685.745) (-687.212) -- 0:00:30
Average standard deviation of split frequencies: 0.012169
505500 -- (-686.917) (-689.364) [-687.533] (-690.767) * (-685.261) (-687.610) (-685.563) [-685.752] -- 0:00:30
506000 -- [-685.984] (-689.916) (-688.441) (-688.039) * (-688.062) [-687.968] (-689.783) (-685.606) -- 0:00:30
506500 -- (-686.834) [-686.836] (-690.119) (-685.673) * [-686.098] (-686.521) (-687.566) (-687.133) -- 0:00:30
507000 -- (-686.791) (-684.887) (-687.518) [-689.422] * (-685.943) (-686.685) (-688.797) [-686.306] -- 0:00:30
507500 -- (-686.195) [-684.878] (-692.936) (-689.922) * (-688.384) [-685.890] (-686.024) (-685.121) -- 0:00:30
508000 -- (-694.244) (-685.106) [-685.546] (-687.682) * [-685.025] (-687.606) (-686.213) (-692.518) -- 0:00:30
508500 -- (-688.235) (-685.637) (-686.637) [-691.166] * (-684.996) (-688.807) (-688.028) [-688.995] -- 0:00:29
509000 -- (-685.693) (-687.805) [-689.886] (-687.536) * [-686.563] (-686.365) (-685.595) (-685.092) -- 0:00:29
509500 -- (-687.366) (-689.637) [-687.782] (-686.889) * (-685.742) [-685.664] (-688.169) (-687.577) -- 0:00:29
510000 -- [-686.211] (-687.432) (-686.571) (-686.293) * [-685.763] (-686.899) (-688.484) (-688.403) -- 0:00:29
Average standard deviation of split frequencies: 0.012174
510500 -- (-686.646) [-686.077] (-685.768) (-685.408) * (-685.433) [-688.682] (-687.631) (-685.972) -- 0:00:29
511000 -- [-687.183] (-685.654) (-688.897) (-686.737) * [-685.036] (-687.507) (-686.902) (-686.546) -- 0:00:29
511500 -- (-687.263) (-688.396) [-685.230] (-687.300) * (-687.513) [-686.302] (-685.560) (-688.574) -- 0:00:29
512000 -- (-687.313) [-686.093] (-685.003) (-685.905) * (-689.399) [-687.840] (-684.639) (-690.839) -- 0:00:29
512500 -- (-686.328) [-686.296] (-685.675) (-689.367) * [-686.651] (-685.458) (-690.034) (-690.456) -- 0:00:29
513000 -- (-685.199) (-689.998) (-686.497) [-686.353] * (-685.744) [-688.987] (-691.051) (-690.538) -- 0:00:29
513500 -- (-685.509) (-688.408) (-687.505) [-690.610] * [-690.017] (-685.922) (-687.025) (-688.385) -- 0:00:29
514000 -- [-687.014] (-688.041) (-688.163) (-686.150) * [-687.069] (-686.295) (-686.144) (-685.797) -- 0:00:29
514500 -- (-685.094) (-687.381) (-688.428) [-686.006] * [-684.790] (-688.148) (-688.118) (-686.674) -- 0:00:29
515000 -- (-686.912) [-687.275] (-687.763) (-685.466) * (-685.691) [-686.242] (-685.487) (-690.572) -- 0:00:29
Average standard deviation of split frequencies: 0.012219
515500 -- (-686.577) [-685.234] (-688.455) (-689.650) * (-685.614) [-685.120] (-685.034) (-688.496) -- 0:00:29
516000 -- (-690.875) [-687.630] (-686.204) (-689.040) * [-687.852] (-685.874) (-686.874) (-687.703) -- 0:00:29
516500 -- (-691.897) (-685.527) [-685.862] (-687.842) * (-692.095) (-685.925) (-685.970) [-687.457] -- 0:00:29
517000 -- (-686.879) [-685.615] (-686.411) (-686.789) * (-691.173) (-686.465) (-688.239) [-686.531] -- 0:00:28
517500 -- [-687.845] (-686.790) (-690.648) (-686.244) * (-690.480) [-687.333] (-688.089) (-686.693) -- 0:00:28
518000 -- (-687.020) (-687.276) [-687.480] (-685.248) * [-690.470] (-686.431) (-686.517) (-689.256) -- 0:00:28
518500 -- (-687.315) (-688.308) (-692.112) [-687.570] * (-684.974) [-686.004] (-686.277) (-686.810) -- 0:00:28
519000 -- (-692.942) [-685.678] (-688.302) (-686.438) * (-685.473) (-689.911) [-690.553] (-684.935) -- 0:00:28
519500 -- (-691.994) (-688.002) (-685.776) [-685.769] * (-684.792) [-689.562] (-686.463) (-687.031) -- 0:00:28
520000 -- (-689.444) (-688.154) (-688.072) [-688.672] * (-686.544) (-685.409) [-688.946] (-687.021) -- 0:00:28
Average standard deviation of split frequencies: 0.012449
520500 -- [-686.278] (-686.754) (-688.729) (-685.415) * (-689.692) (-685.420) [-687.288] (-685.234) -- 0:00:28
521000 -- (-685.969) (-686.572) [-688.770] (-685.980) * [-689.785] (-684.929) (-686.083) (-686.801) -- 0:00:29
521500 -- [-687.105] (-687.245) (-687.980) (-685.819) * [-692.443] (-688.379) (-687.309) (-687.757) -- 0:00:29
522000 -- (-687.591) [-690.347] (-687.940) (-685.613) * [-688.907] (-687.616) (-685.596) (-686.545) -- 0:00:29
522500 -- (-685.710) (-693.773) (-686.066) [-686.478] * (-686.381) (-685.869) [-687.519] (-687.322) -- 0:00:29
523000 -- (-688.242) (-689.768) (-687.714) [-685.170] * (-688.582) [-686.032] (-686.424) (-687.837) -- 0:00:29
523500 -- (-686.448) (-689.328) [-688.909] (-687.008) * (-687.262) [-687.516] (-688.305) (-696.637) -- 0:00:29
524000 -- (-688.449) (-688.584) [-685.070] (-687.962) * (-686.775) (-686.363) (-692.145) [-687.003] -- 0:00:29
524500 -- (-687.206) (-688.579) (-686.048) [-686.273] * (-685.404) (-687.104) [-688.624] (-684.937) -- 0:00:29
525000 -- (-686.208) (-688.623) [-686.672] (-684.936) * (-686.639) (-686.215) [-689.143] (-689.086) -- 0:00:28
Average standard deviation of split frequencies: 0.012379
525500 -- (-687.994) [-689.322] (-687.269) (-685.051) * [-686.654] (-687.005) (-689.888) (-687.846) -- 0:00:28
526000 -- (-692.071) [-686.746] (-687.875) (-687.607) * (-686.034) (-686.227) [-690.768] (-690.330) -- 0:00:28
526500 -- (-687.396) [-689.527] (-690.138) (-687.686) * [-685.965] (-686.983) (-687.968) (-687.584) -- 0:00:28
527000 -- [-686.913] (-688.125) (-689.766) (-686.991) * [-687.904] (-688.406) (-684.494) (-686.343) -- 0:00:28
527500 -- (-688.853) (-689.491) [-686.477] (-688.675) * (-687.526) [-686.612] (-684.850) (-687.548) -- 0:00:28
528000 -- (-689.687) (-687.512) [-686.902] (-686.099) * (-688.217) (-686.494) [-688.080] (-686.014) -- 0:00:28
528500 -- (-684.699) [-686.981] (-690.075) (-685.302) * (-687.548) [-685.431] (-687.020) (-686.408) -- 0:00:28
529000 -- [-685.017] (-686.595) (-688.249) (-685.136) * [-685.432] (-693.754) (-687.692) (-690.253) -- 0:00:28
529500 -- [-685.761] (-685.162) (-688.499) (-686.655) * (-687.097) (-687.161) [-687.210] (-690.405) -- 0:00:28
530000 -- (-685.071) [-686.556] (-686.851) (-686.509) * (-686.574) [-688.412] (-687.309) (-689.169) -- 0:00:28
Average standard deviation of split frequencies: 0.012603
530500 -- [-684.934] (-687.059) (-687.484) (-686.457) * (-686.345) [-686.699] (-691.297) (-688.760) -- 0:00:28
531000 -- (-685.405) [-686.750] (-688.625) (-686.929) * (-685.439) [-688.225] (-688.995) (-686.192) -- 0:00:28
531500 -- (-685.360) (-685.651) [-686.090] (-687.476) * (-689.570) (-686.224) [-686.308] (-685.697) -- 0:00:28
532000 -- (-687.959) (-687.583) (-686.717) [-685.932] * [-687.220] (-685.189) (-686.224) (-684.935) -- 0:00:28
532500 -- (-685.434) (-692.174) [-686.941] (-686.042) * (-686.901) (-686.194) (-685.232) [-685.292] -- 0:00:28
533000 -- (-689.704) (-687.515) [-688.532] (-690.006) * (-687.792) [-686.000] (-687.004) (-686.400) -- 0:00:28
533500 -- (-685.736) (-691.288) (-687.563) [-687.958] * [-685.868] (-687.680) (-686.331) (-689.703) -- 0:00:27
534000 -- [-685.243] (-690.146) (-686.603) (-689.110) * (-686.293) [-684.868] (-686.334) (-686.201) -- 0:00:27
534500 -- (-686.695) (-686.623) (-685.272) [-685.306] * (-685.862) (-686.007) (-691.126) [-686.637] -- 0:00:27
535000 -- (-686.264) [-688.815] (-690.604) (-685.866) * (-685.833) [-690.980] (-690.047) (-689.004) -- 0:00:27
Average standard deviation of split frequencies: 0.012478
535500 -- [-685.739] (-690.038) (-686.380) (-686.080) * (-686.341) (-688.191) (-689.400) [-687.170] -- 0:00:27
536000 -- (-687.806) [-685.869] (-692.683) (-689.219) * (-687.722) [-685.840] (-685.876) (-689.483) -- 0:00:27
536500 -- (-687.474) (-685.033) (-687.520) [-687.931] * (-686.932) (-686.678) (-687.585) [-687.086] -- 0:00:27
537000 -- (-686.761) [-687.751] (-686.959) (-686.057) * [-688.576] (-685.976) (-686.625) (-689.383) -- 0:00:27
537500 -- (-686.071) (-685.378) [-685.553] (-686.372) * [-685.864] (-687.786) (-687.746) (-686.513) -- 0:00:27
538000 -- (-686.911) (-685.424) [-685.093] (-688.147) * (-689.675) (-687.557) [-687.613] (-688.162) -- 0:00:28
538500 -- (-685.898) (-686.194) [-687.248] (-686.752) * (-685.696) [-686.883] (-685.483) (-688.157) -- 0:00:28
539000 -- (-692.159) (-685.705) [-684.967] (-687.279) * (-689.690) (-686.272) [-689.707] (-687.438) -- 0:00:28
539500 -- [-686.385] (-688.117) (-685.403) (-689.053) * (-687.425) (-687.760) (-689.484) [-685.602] -- 0:00:28
540000 -- [-687.774] (-686.720) (-688.202) (-688.256) * (-688.113) (-687.924) (-690.024) [-687.152] -- 0:00:28
Average standard deviation of split frequencies: 0.012730
540500 -- [-686.919] (-685.001) (-687.560) (-687.287) * [-685.925] (-687.310) (-687.328) (-687.719) -- 0:00:28
541000 -- (-688.042) (-687.393) (-687.948) [-685.262] * [-685.377] (-686.832) (-687.160) (-686.905) -- 0:00:27
541500 -- [-685.401] (-688.172) (-686.801) (-685.155) * (-686.960) (-692.281) (-686.344) [-686.699] -- 0:00:27
542000 -- (-685.774) (-686.064) (-686.167) [-688.671] * (-687.999) (-686.382) [-685.506] (-685.539) -- 0:00:27
542500 -- (-685.828) [-686.367] (-687.124) (-685.966) * (-687.028) [-685.522] (-686.216) (-690.108) -- 0:00:27
543000 -- (-693.319) [-686.268] (-688.484) (-686.366) * (-692.723) (-686.895) [-685.857] (-685.479) -- 0:00:27
543500 -- [-689.415] (-686.030) (-686.444) (-688.911) * [-684.958] (-685.179) (-686.780) (-686.926) -- 0:00:27
544000 -- (-686.628) (-685.267) (-687.438) [-686.655] * [-689.713] (-685.669) (-686.440) (-690.099) -- 0:00:27
544500 -- (-691.978) (-685.740) [-686.947] (-689.095) * [-686.479] (-685.015) (-685.815) (-689.097) -- 0:00:27
545000 -- (-687.966) [-685.698] (-687.339) (-687.179) * (-687.248) [-687.894] (-686.294) (-686.409) -- 0:00:27
Average standard deviation of split frequencies: 0.012573
545500 -- (-687.437) (-685.929) (-688.010) [-687.998] * (-691.760) (-691.890) (-686.777) [-688.274] -- 0:00:27
546000 -- (-687.026) (-686.988) (-687.454) [-686.610] * (-687.439) (-688.412) [-686.151] (-687.988) -- 0:00:27
546500 -- (-686.835) [-686.642] (-687.195) (-685.698) * (-685.947) [-686.423] (-688.160) (-686.157) -- 0:00:27
547000 -- (-686.881) [-687.528] (-686.691) (-686.047) * (-687.778) (-690.031) [-686.489] (-685.558) -- 0:00:27
547500 -- (-688.524) (-689.147) [-687.084] (-686.379) * [-687.260] (-689.281) (-688.121) (-686.080) -- 0:00:27
548000 -- [-686.702] (-686.001) (-686.450) (-686.346) * (-690.298) [-685.505] (-693.852) (-685.737) -- 0:00:27
548500 -- (-685.741) (-693.424) [-686.401] (-686.764) * [-685.786] (-686.784) (-692.456) (-689.683) -- 0:00:27
549000 -- (-687.906) (-689.530) [-689.501] (-686.290) * [-687.207] (-689.406) (-687.490) (-690.949) -- 0:00:27
549500 -- [-686.603] (-687.419) (-688.161) (-688.670) * (-687.570) [-691.112] (-686.371) (-686.323) -- 0:00:27
550000 -- (-686.729) (-685.996) (-687.484) [-684.862] * (-688.112) [-685.665] (-687.049) (-685.692) -- 0:00:27
Average standard deviation of split frequencies: 0.012627
550500 -- [-685.767] (-686.267) (-686.176) (-685.854) * [-688.266] (-687.781) (-688.271) (-688.162) -- 0:00:26
551000 -- (-687.572) (-685.893) [-688.627] (-688.188) * (-686.358) (-687.531) [-687.086] (-685.332) -- 0:00:26
551500 -- (-688.623) (-687.253) [-685.341] (-685.633) * (-686.255) (-687.531) [-686.082] (-688.041) -- 0:00:26
552000 -- (-686.420) (-688.171) (-686.692) [-686.112] * (-688.111) [-689.436] (-686.871) (-685.911) -- 0:00:26
552500 -- (-687.950) (-688.018) [-687.661] (-686.166) * (-685.035) (-688.232) [-685.081] (-685.798) -- 0:00:26
553000 -- [-685.927] (-686.902) (-687.296) (-686.897) * [-685.837] (-685.184) (-685.528) (-687.221) -- 0:00:26
553500 -- (-685.508) [-684.941] (-687.856) (-687.726) * [-687.382] (-685.826) (-684.996) (-688.411) -- 0:00:26
554000 -- (-685.589) [-686.832] (-689.301) (-687.773) * [-685.569] (-688.541) (-686.595) (-689.112) -- 0:00:26
554500 -- (-686.854) (-687.717) (-687.601) [-690.893] * (-686.333) [-686.979] (-686.983) (-688.042) -- 0:00:26
555000 -- (-685.879) (-690.321) (-688.846) [-687.049] * (-686.556) (-690.350) (-688.672) [-685.221] -- 0:00:27
Average standard deviation of split frequencies: 0.012548
555500 -- [-688.205] (-691.152) (-688.780) (-685.167) * (-690.302) [-685.313] (-687.574) (-687.373) -- 0:00:27
556000 -- [-685.519] (-686.026) (-686.203) (-686.891) * (-691.878) (-686.932) (-688.170) [-688.492] -- 0:00:27
556500 -- [-687.459] (-685.742) (-686.255) (-687.757) * (-686.758) (-687.381) [-686.553] (-689.453) -- 0:00:27
557000 -- (-685.479) (-685.475) [-686.249] (-686.738) * (-686.199) (-687.068) [-689.399] (-688.471) -- 0:00:27
557500 -- (-687.389) [-685.494] (-686.264) (-686.907) * (-686.329) [-689.035] (-689.951) (-687.341) -- 0:00:26
558000 -- [-686.278] (-686.030) (-686.442) (-688.078) * [-690.039] (-685.407) (-691.054) (-693.226) -- 0:00:26
558500 -- (-684.879) (-689.833) [-688.222] (-686.140) * [-687.581] (-686.910) (-685.445) (-693.945) -- 0:00:26
559000 -- (-685.706) (-686.712) (-689.201) [-686.323] * [-686.096] (-685.878) (-685.504) (-694.295) -- 0:00:26
559500 -- (-686.407) [-686.292] (-687.762) (-685.773) * (-686.179) (-688.476) [-686.355] (-688.309) -- 0:00:26
560000 -- [-686.034] (-689.499) (-686.934) (-687.467) * (-688.919) (-685.929) (-685.759) [-685.219] -- 0:00:26
Average standard deviation of split frequencies: 0.012780
560500 -- (-686.441) [-689.020] (-685.826) (-688.465) * (-687.275) (-687.266) [-685.582] (-687.276) -- 0:00:26
561000 -- (-687.042) (-685.903) (-687.701) [-688.935] * (-687.082) [-687.341] (-688.656) (-687.482) -- 0:00:26
561500 -- (-684.661) [-686.484] (-684.573) (-686.259) * [-689.460] (-688.119) (-686.292) (-685.902) -- 0:00:26
562000 -- [-684.778] (-687.011) (-687.142) (-689.331) * (-686.543) (-688.579) (-686.603) [-685.095] -- 0:00:26
562500 -- [-688.264] (-686.686) (-686.209) (-686.457) * (-685.324) [-687.447] (-687.995) (-685.514) -- 0:00:26
563000 -- (-692.421) (-685.877) (-686.408) [-685.615] * (-691.212) (-688.250) [-689.692] (-687.194) -- 0:00:26
563500 -- (-688.355) (-687.621) (-684.964) [-688.460] * (-686.570) (-686.728) [-684.823] (-687.741) -- 0:00:26
564000 -- (-694.232) [-685.640] (-689.245) (-686.360) * (-686.150) [-687.142] (-685.517) (-686.722) -- 0:00:26
564500 -- (-688.636) (-686.901) (-687.013) [-686.650] * [-686.232] (-686.167) (-685.441) (-688.625) -- 0:00:26
565000 -- (-688.218) [-688.766] (-685.877) (-686.941) * [-684.709] (-688.398) (-685.302) (-686.092) -- 0:00:26
Average standard deviation of split frequencies: 0.012382
565500 -- (-686.427) (-687.558) [-685.186] (-686.200) * [-686.091] (-687.109) (-684.724) (-685.245) -- 0:00:26
566000 -- (-687.481) [-691.887] (-686.340) (-685.909) * (-685.558) (-688.683) [-687.463] (-686.731) -- 0:00:26
566500 -- (-687.734) (-689.225) [-687.349] (-685.506) * (-686.597) (-687.941) (-686.349) [-688.219] -- 0:00:26
567000 -- [-685.062] (-686.924) (-689.692) (-686.606) * (-686.549) [-686.596] (-686.382) (-691.370) -- 0:00:25
567500 -- (-684.918) [-688.389] (-685.695) (-686.430) * (-687.025) (-685.791) [-686.286] (-685.679) -- 0:00:25
568000 -- [-686.295] (-685.676) (-688.237) (-689.128) * (-691.311) (-685.572) (-687.186) [-687.726] -- 0:00:25
568500 -- (-687.560) (-686.706) [-685.353] (-687.167) * [-685.896] (-685.306) (-695.046) (-689.286) -- 0:00:25
569000 -- (-690.269) (-687.214) (-688.640) [-686.840] * (-685.600) (-685.468) [-692.511] (-686.773) -- 0:00:25
569500 -- (-686.610) [-687.046] (-687.338) (-688.098) * (-686.323) (-686.532) [-685.625] (-688.893) -- 0:00:25
570000 -- (-686.786) (-687.029) [-686.215] (-689.497) * [-685.193] (-688.119) (-690.490) (-687.685) -- 0:00:25
Average standard deviation of split frequencies: 0.012171
570500 -- [-688.786] (-685.910) (-688.446) (-689.053) * (-685.751) (-687.339) [-688.019] (-687.361) -- 0:00:25
571000 -- (-687.980) (-685.817) [-685.940] (-685.784) * (-690.179) (-685.816) [-687.713] (-688.403) -- 0:00:25
571500 -- (-689.677) (-686.060) [-686.904] (-687.478) * (-686.498) (-689.940) (-687.940) [-687.987] -- 0:00:25
572000 -- (-687.971) (-686.571) (-688.114) [-686.232] * (-684.616) (-689.185) (-685.624) [-689.543] -- 0:00:26
572500 -- (-689.648) [-689.235] (-690.219) (-689.620) * (-686.590) (-687.441) [-688.515] (-686.301) -- 0:00:26
573000 -- (-692.659) (-694.136) [-690.563] (-687.748) * (-691.832) (-687.126) (-687.849) [-687.945] -- 0:00:26
573500 -- (-689.832) [-687.155] (-690.449) (-686.548) * (-685.554) (-691.488) (-687.875) [-686.259] -- 0:00:26
574000 -- (-689.504) (-686.200) [-687.954] (-686.747) * (-686.829) (-692.088) (-686.805) [-689.753] -- 0:00:25
574500 -- (-689.231) (-685.054) (-684.966) [-687.200] * (-685.752) (-685.325) (-684.860) [-688.514] -- 0:00:25
575000 -- (-690.946) [-685.244] (-690.875) (-687.009) * (-689.217) (-695.038) (-684.547) [-687.692] -- 0:00:25
Average standard deviation of split frequencies: 0.012604
575500 -- (-689.070) (-686.965) [-686.566] (-684.846) * (-688.459) (-686.080) (-689.745) [-687.584] -- 0:00:25
576000 -- (-688.807) (-689.138) [-685.302] (-687.830) * (-685.874) (-690.202) (-687.663) [-685.756] -- 0:00:25
576500 -- (-688.684) (-687.176) [-684.988] (-691.194) * (-687.875) [-686.664] (-690.285) (-685.220) -- 0:00:25
577000 -- [-685.765] (-687.697) (-685.442) (-691.240) * [-688.636] (-685.981) (-688.360) (-684.878) -- 0:00:25
577500 -- (-685.792) (-687.161) [-684.978] (-688.174) * (-689.170) (-686.125) [-686.280] (-690.545) -- 0:00:25
578000 -- (-685.968) (-688.882) (-688.287) [-686.500] * (-686.337) (-685.530) [-686.520] (-687.627) -- 0:00:25
578500 -- (-685.531) [-687.004] (-688.315) (-686.839) * (-686.509) [-684.977] (-686.159) (-687.173) -- 0:00:25
579000 -- (-687.746) (-687.730) (-686.760) [-687.939] * (-684.846) (-686.475) [-687.504] (-685.604) -- 0:00:25
579500 -- (-688.494) (-688.749) [-685.722] (-688.491) * [-688.037] (-686.599) (-686.233) (-685.126) -- 0:00:25
580000 -- (-686.761) (-686.765) (-687.871) [-685.805] * [-687.202] (-687.037) (-686.954) (-686.963) -- 0:00:25
Average standard deviation of split frequencies: 0.012773
580500 -- (-686.579) [-685.472] (-685.640) (-686.177) * (-686.976) (-686.801) [-692.615] (-685.821) -- 0:00:25
581000 -- [-685.311] (-687.184) (-688.558) (-687.644) * (-686.139) [-684.947] (-688.311) (-688.275) -- 0:00:25
581500 -- [-688.177] (-687.007) (-693.576) (-684.953) * (-686.950) (-684.894) (-686.597) [-685.523] -- 0:00:25
582000 -- [-684.578] (-687.040) (-689.582) (-685.514) * (-688.940) (-685.429) (-687.008) [-686.792] -- 0:00:25
582500 -- (-686.702) (-685.065) (-687.321) [-685.635] * [-686.039] (-685.063) (-690.731) (-684.878) -- 0:00:25
583000 -- [-684.824] (-685.544) (-685.912) (-685.413) * (-686.058) (-684.935) (-686.431) [-687.878] -- 0:00:25
583500 -- (-688.665) (-687.343) (-684.867) [-685.592] * [-685.894] (-685.679) (-686.265) (-686.927) -- 0:00:24
584000 -- (-689.939) (-686.077) (-687.790) [-688.155] * (-685.293) (-688.708) [-686.815] (-687.138) -- 0:00:24
584500 -- (-693.040) (-686.914) [-687.356] (-687.705) * [-685.484] (-688.293) (-687.742) (-687.517) -- 0:00:24
585000 -- (-685.445) (-685.978) [-687.981] (-690.067) * (-687.509) (-688.498) [-685.571] (-687.134) -- 0:00:24
Average standard deviation of split frequencies: 0.013086
585500 -- [-685.407] (-687.163) (-689.300) (-688.396) * (-686.071) (-686.462) [-686.968] (-686.744) -- 0:00:24
586000 -- (-688.557) [-684.733] (-686.295) (-692.914) * (-687.447) (-686.530) (-689.101) [-685.889] -- 0:00:24
586500 -- [-690.896] (-685.651) (-687.778) (-695.765) * (-687.342) (-689.880) (-687.052) [-686.587] -- 0:00:24
587000 -- (-687.695) (-686.023) [-686.090] (-689.464) * [-692.529] (-685.421) (-686.057) (-687.115) -- 0:00:24
587500 -- (-688.264) (-685.059) (-686.415) [-685.215] * (-687.821) (-688.128) (-685.687) [-686.522] -- 0:00:24
588000 -- (-688.458) [-686.195] (-685.872) (-685.806) * [-686.788] (-688.148) (-684.694) (-690.346) -- 0:00:24
588500 -- [-687.033] (-689.765) (-686.471) (-684.971) * (-690.258) (-689.643) (-685.915) [-686.885] -- 0:00:25
589000 -- [-686.043] (-687.392) (-687.410) (-687.099) * (-687.465) (-685.571) (-685.140) [-685.109] -- 0:00:25
589500 -- [-687.103] (-692.604) (-685.720) (-686.009) * (-686.797) (-685.116) [-686.326] (-685.090) -- 0:00:25
590000 -- [-686.714] (-685.454) (-688.260) (-686.579) * (-688.581) [-686.059] (-687.558) (-685.425) -- 0:00:25
Average standard deviation of split frequencies: 0.012823
590500 -- (-686.671) (-685.564) (-687.909) [-686.079] * (-688.721) [-685.257] (-686.158) (-692.431) -- 0:00:24
591000 -- [-688.531] (-686.055) (-688.067) (-686.023) * (-688.997) (-687.918) [-687.374] (-687.219) -- 0:00:24
591500 -- [-688.315] (-685.951) (-687.876) (-688.401) * (-689.035) (-688.401) (-686.814) [-686.961] -- 0:00:24
592000 -- (-688.391) (-690.125) [-689.941] (-688.166) * [-690.262] (-686.619) (-689.459) (-686.923) -- 0:00:24
592500 -- (-686.064) (-686.994) (-685.708) [-686.322] * (-688.140) (-689.208) [-685.493] (-687.482) -- 0:00:24
593000 -- (-689.437) (-685.874) [-687.010] (-686.733) * (-688.680) [-688.084] (-686.000) (-686.202) -- 0:00:24
593500 -- (-687.491) (-685.823) [-685.344] (-688.895) * (-688.149) (-687.801) (-687.082) [-687.545] -- 0:00:24
594000 -- (-688.539) [-686.045] (-686.401) (-687.385) * (-687.524) (-687.095) (-690.617) [-686.353] -- 0:00:24
594500 -- (-688.520) (-685.942) [-688.408] (-690.220) * [-687.198] (-686.181) (-689.854) (-689.758) -- 0:00:24
595000 -- (-686.032) (-684.703) (-688.164) [-690.086] * [-690.234] (-684.936) (-686.644) (-686.286) -- 0:00:24
Average standard deviation of split frequencies: 0.013130
595500 -- (-690.401) [-686.712] (-688.152) (-690.223) * [-687.041] (-694.143) (-686.388) (-686.253) -- 0:00:24
596000 -- (-686.243) [-685.429] (-689.179) (-695.525) * [-686.489] (-685.045) (-686.360) (-686.322) -- 0:00:24
596500 -- (-687.206) (-686.060) (-686.261) [-685.739] * (-688.090) (-685.589) [-685.441] (-686.227) -- 0:00:24
597000 -- (-687.659) (-687.030) [-692.901] (-686.801) * (-686.748) (-685.477) (-687.758) [-688.010] -- 0:00:24
597500 -- (-688.382) [-686.476] (-685.506) (-686.933) * (-685.691) (-686.388) [-687.438] (-686.538) -- 0:00:24
598000 -- [-688.230] (-687.880) (-685.427) (-685.415) * (-687.497) (-687.412) (-689.591) [-686.631] -- 0:00:24
598500 -- (-689.984) (-684.727) (-685.394) [-684.859] * (-685.861) (-686.334) (-685.639) [-686.273] -- 0:00:24
599000 -- (-689.560) (-689.273) [-689.191] (-686.208) * (-685.861) [-685.838] (-685.081) (-688.227) -- 0:00:24
599500 -- (-686.106) (-685.094) [-690.936] (-686.074) * (-694.250) [-688.075] (-685.105) (-687.580) -- 0:00:24
600000 -- (-686.445) (-685.636) (-686.256) [-686.679] * [-689.055] (-688.368) (-686.278) (-685.389) -- 0:00:24
Average standard deviation of split frequencies: 0.013237
600500 -- [-686.046] (-691.156) (-685.827) (-686.608) * (-688.518) [-687.071] (-688.291) (-687.588) -- 0:00:23
601000 -- (-690.947) [-687.673] (-686.074) (-686.188) * (-691.345) [-688.016] (-686.752) (-687.795) -- 0:00:23
601500 -- (-686.711) (-688.750) (-685.563) [-685.716] * (-688.033) [-688.919] (-685.976) (-686.356) -- 0:00:23
602000 -- (-687.589) (-687.251) (-686.871) [-686.733] * (-688.400) [-686.573] (-685.415) (-688.394) -- 0:00:23
602500 -- [-687.177] (-686.290) (-685.350) (-687.753) * (-688.141) (-689.424) [-686.052] (-687.922) -- 0:00:23
603000 -- [-685.001] (-685.864) (-688.638) (-686.916) * (-688.498) (-688.793) (-685.774) [-688.247] -- 0:00:23
603500 -- (-685.618) (-685.802) [-688.065] (-687.338) * (-684.818) [-685.623] (-685.832) (-690.346) -- 0:00:23
604000 -- (-686.259) (-688.161) (-689.712) [-687.642] * (-689.857) (-684.697) (-690.496) [-687.593] -- 0:00:23
604500 -- (-685.094) (-689.161) [-686.867] (-687.422) * (-689.313) [-685.567] (-686.798) (-686.738) -- 0:00:23
605000 -- (-685.797) [-685.057] (-687.113) (-688.118) * (-690.432) [-686.357] (-687.056) (-686.302) -- 0:00:23
Average standard deviation of split frequencies: 0.012446
605500 -- (-689.108) [-686.660] (-691.539) (-685.957) * (-685.980) (-686.194) (-685.977) [-684.854] -- 0:00:24
606000 -- (-686.457) [-685.542] (-687.024) (-686.620) * (-686.253) [-686.293] (-685.530) (-685.965) -- 0:00:24
606500 -- (-685.592) [-684.761] (-688.278) (-695.654) * (-689.338) (-685.467) [-685.144] (-686.773) -- 0:00:24
607000 -- (-690.854) (-684.867) (-687.469) [-686.621] * (-692.036) (-688.108) [-684.754] (-686.054) -- 0:00:23
607500 -- [-686.148] (-688.184) (-686.923) (-687.536) * (-696.398) (-685.449) [-687.056] (-685.392) -- 0:00:23
608000 -- (-687.064) (-687.565) (-688.161) [-687.025] * (-686.223) (-688.537) (-685.005) [-684.876] -- 0:00:23
608500 -- (-688.618) (-685.530) [-687.427] (-686.925) * (-685.772) (-693.686) (-685.452) [-686.185] -- 0:00:23
609000 -- (-687.590) [-686.854] (-685.790) (-684.978) * (-685.407) (-690.277) [-687.707] (-686.154) -- 0:00:23
609500 -- (-688.687) (-687.681) (-685.742) [-688.957] * (-685.574) (-692.769) (-685.416) [-689.211] -- 0:00:23
610000 -- [-687.069] (-687.044) (-691.224) (-690.208) * [-688.651] (-690.098) (-685.411) (-685.053) -- 0:00:23
Average standard deviation of split frequencies: 0.013123
610500 -- (-685.312) [-685.609] (-686.273) (-687.844) * (-686.578) (-686.064) [-686.052] (-685.737) -- 0:00:23
611000 -- [-685.711] (-686.862) (-686.646) (-687.826) * [-688.701] (-686.715) (-685.225) (-693.389) -- 0:00:23
611500 -- (-687.563) (-685.260) [-688.352] (-689.005) * (-687.774) (-691.195) [-686.042] (-687.350) -- 0:00:23
612000 -- (-686.736) (-687.231) [-685.503] (-686.584) * (-686.108) (-687.591) (-687.892) [-686.908] -- 0:00:23
612500 -- (-688.341) [-687.651] (-687.656) (-686.075) * [-684.714] (-686.839) (-686.634) (-691.839) -- 0:00:23
613000 -- (-686.733) [-686.254] (-688.535) (-692.036) * (-685.084) (-685.762) [-685.266] (-687.184) -- 0:00:23
613500 -- (-687.607) [-686.295] (-686.578) (-687.784) * (-688.331) (-688.068) (-687.237) [-685.644] -- 0:00:23
614000 -- (-686.556) (-687.240) (-688.173) [-687.666] * (-686.919) (-687.754) [-688.777] (-685.657) -- 0:00:23
614500 -- (-690.040) [-691.135] (-687.927) (-685.443) * (-688.817) (-686.129) (-686.503) [-685.831] -- 0:00:23
615000 -- (-692.217) (-685.782) [-688.285] (-685.901) * (-685.378) [-686.443] (-687.713) (-686.750) -- 0:00:23
Average standard deviation of split frequencies: 0.012754
615500 -- (-689.161) [-686.804] (-685.374) (-685.873) * (-685.746) (-686.149) [-690.485] (-685.439) -- 0:00:23
616000 -- (-687.419) (-687.233) (-686.503) [-687.506] * (-687.708) (-686.398) [-688.916] (-688.013) -- 0:00:23
616500 -- (-686.551) (-686.431) (-686.043) [-688.062] * [-692.505] (-685.448) (-686.485) (-688.495) -- 0:00:23
617000 -- (-687.907) (-688.564) [-687.139] (-687.494) * (-688.284) (-687.810) (-689.102) [-692.279] -- 0:00:22
617500 -- [-687.288] (-687.629) (-687.147) (-693.526) * (-685.813) [-691.454] (-687.776) (-690.522) -- 0:00:22
618000 -- [-686.791] (-686.199) (-688.410) (-685.892) * (-689.176) (-688.319) [-686.089] (-686.629) -- 0:00:22
618500 -- (-691.032) (-686.499) (-685.563) [-686.895] * (-694.328) (-688.877) [-684.809] (-687.238) -- 0:00:22
619000 -- (-691.448) (-687.939) (-686.593) [-687.308] * (-698.920) (-687.253) (-685.267) [-685.776] -- 0:00:22
619500 -- (-690.832) (-700.552) (-686.660) [-685.606] * [-690.804] (-687.896) (-686.877) (-685.787) -- 0:00:22
620000 -- (-686.054) [-687.175] (-686.334) (-690.481) * (-685.606) (-685.508) (-689.048) [-690.226] -- 0:00:22
Average standard deviation of split frequencies: 0.012760
620500 -- (-685.709) [-685.301] (-687.147) (-688.703) * (-688.443) (-686.005) (-693.725) [-685.858] -- 0:00:22
621000 -- (-687.424) (-686.913) [-690.303] (-685.816) * [-685.583] (-686.607) (-686.174) (-686.715) -- 0:00:22
621500 -- [-685.712] (-685.752) (-686.431) (-688.175) * (-685.321) (-688.466) (-685.022) [-688.658] -- 0:00:22
622000 -- [-686.232] (-688.002) (-684.853) (-688.755) * (-689.735) (-686.976) (-688.163) [-686.660] -- 0:00:23
622500 -- [-686.976] (-688.233) (-686.558) (-685.438) * (-690.921) (-685.360) [-684.773] (-686.907) -- 0:00:23
623000 -- (-686.045) (-685.105) (-685.003) [-685.524] * (-686.480) [-687.062] (-688.874) (-685.128) -- 0:00:22
623500 -- (-686.630) [-686.904] (-686.532) (-687.294) * [-687.313] (-688.512) (-696.515) (-687.525) -- 0:00:22
624000 -- (-686.621) [-685.626] (-689.795) (-689.205) * (-690.199) (-687.236) (-686.815) [-686.755] -- 0:00:22
624500 -- (-686.911) (-686.947) [-687.448] (-687.426) * (-691.589) (-686.898) (-687.776) [-686.676] -- 0:00:22
625000 -- (-686.123) [-688.252] (-691.485) (-685.587) * (-687.789) (-687.948) (-688.140) [-688.498] -- 0:00:22
Average standard deviation of split frequencies: 0.012613
625500 -- (-685.193) (-687.958) (-687.303) [-685.688] * (-687.759) [-687.105] (-688.404) (-692.270) -- 0:00:22
626000 -- (-688.429) (-685.527) (-688.243) [-687.204] * (-689.778) [-685.688] (-687.388) (-687.273) -- 0:00:22
626500 -- [-685.547] (-686.135) (-689.410) (-685.241) * (-688.013) (-685.893) [-688.466] (-685.961) -- 0:00:22
627000 -- (-687.821) (-685.459) [-688.153] (-686.221) * (-691.752) [-686.383] (-685.671) (-686.996) -- 0:00:22
627500 -- (-687.500) [-686.086] (-689.921) (-688.644) * (-688.080) [-687.588] (-685.859) (-687.727) -- 0:00:22
628000 -- (-689.710) (-686.221) [-686.255] (-689.207) * (-689.737) (-686.589) (-687.204) [-686.221] -- 0:00:22
628500 -- (-688.868) (-689.536) [-689.067] (-688.898) * (-686.290) (-686.556) [-686.904] (-686.582) -- 0:00:22
629000 -- (-687.891) (-687.248) [-688.935] (-685.907) * (-691.016) (-687.536) [-685.377] (-686.439) -- 0:00:22
629500 -- (-688.843) (-688.617) [-685.132] (-687.317) * [-685.874] (-689.955) (-686.013) (-686.039) -- 0:00:22
630000 -- [-684.677] (-687.527) (-685.216) (-690.800) * (-687.383) (-690.362) [-687.579] (-689.641) -- 0:00:22
Average standard deviation of split frequencies: 0.012894
630500 -- (-686.422) (-686.024) [-685.930] (-690.209) * (-686.420) (-689.073) (-691.035) [-687.251] -- 0:00:22
631000 -- [-686.589] (-693.768) (-686.686) (-685.949) * (-689.770) (-684.861) (-689.560) [-685.440] -- 0:00:22
631500 -- (-685.880) (-688.109) [-684.590] (-687.881) * (-686.857) [-686.477] (-685.487) (-686.243) -- 0:00:22
632000 -- (-685.810) [-685.361] (-685.440) (-686.430) * (-686.458) (-686.412) (-687.398) [-685.884] -- 0:00:22
632500 -- (-684.848) (-688.023) (-689.167) [-686.006] * (-687.734) [-685.606] (-687.620) (-685.180) -- 0:00:22
633000 -- (-687.702) [-686.118] (-687.316) (-685.915) * [-686.169] (-688.285) (-690.191) (-686.066) -- 0:00:22
633500 -- (-688.512) (-686.175) (-691.267) [-685.851] * (-685.199) [-687.070] (-688.280) (-687.067) -- 0:00:21
634000 -- (-685.972) (-686.488) (-685.758) [-685.885] * (-688.418) (-685.562) (-686.204) [-686.932] -- 0:00:21
634500 -- (-687.312) [-691.710] (-689.683) (-686.478) * [-685.516] (-687.394) (-685.209) (-687.321) -- 0:00:21
635000 -- (-686.892) [-685.626] (-687.660) (-686.970) * [-686.482] (-687.545) (-687.379) (-689.002) -- 0:00:21
Average standard deviation of split frequencies: 0.013481
635500 -- (-685.456) (-685.964) (-687.184) [-686.125] * [-685.375] (-687.870) (-688.778) (-685.731) -- 0:00:21
636000 -- (-685.215) [-685.774] (-688.858) (-686.376) * (-686.475) (-686.172) [-686.146] (-687.842) -- 0:00:21
636500 -- (-687.841) (-685.992) [-687.960] (-689.068) * (-686.049) (-684.916) [-685.490] (-688.449) -- 0:00:21
637000 -- [-691.552] (-686.574) (-687.739) (-689.355) * (-685.927) [-686.900] (-686.221) (-685.220) -- 0:00:21
637500 -- (-686.614) [-686.482] (-686.795) (-686.100) * (-686.323) [-687.369] (-687.352) (-687.255) -- 0:00:21
638000 -- (-686.875) [-685.981] (-687.818) (-686.303) * (-686.959) (-688.470) [-687.606] (-687.444) -- 0:00:21
638500 -- (-687.327) (-686.372) [-686.406] (-692.318) * (-686.180) [-689.177] (-688.471) (-686.097) -- 0:00:21
639000 -- (-690.641) (-689.530) [-692.492] (-688.475) * (-687.928) (-689.674) (-686.599) [-685.505] -- 0:00:22
639500 -- (-688.596) (-686.196) (-688.686) [-686.573] * [-685.754] (-687.344) (-688.311) (-685.493) -- 0:00:21
640000 -- (-687.263) (-685.964) [-686.395] (-685.910) * (-686.616) [-685.538] (-685.554) (-685.495) -- 0:00:21
Average standard deviation of split frequencies: 0.013980
640500 -- [-688.154] (-684.774) (-687.167) (-687.250) * (-692.984) (-686.665) (-685.455) [-687.460] -- 0:00:21
641000 -- (-687.739) [-686.214] (-687.427) (-689.219) * [-687.484] (-687.986) (-689.122) (-685.777) -- 0:00:21
641500 -- (-686.142) (-685.283) (-687.453) [-687.756] * (-689.803) (-690.285) [-687.695] (-688.836) -- 0:00:21
642000 -- (-687.492) [-687.120] (-687.589) (-686.633) * (-687.001) (-688.652) [-686.064] (-691.606) -- 0:00:21
642500 -- (-685.988) [-688.608] (-686.164) (-687.472) * [-687.763] (-687.816) (-686.434) (-687.384) -- 0:00:21
643000 -- [-687.072] (-685.118) (-687.450) (-687.620) * (-688.110) (-688.280) (-686.991) [-685.011] -- 0:00:21
643500 -- [-688.771] (-685.423) (-685.734) (-687.558) * [-685.759] (-690.226) (-687.907) (-690.237) -- 0:00:21
644000 -- (-691.694) [-685.207] (-686.003) (-687.828) * (-689.806) (-690.671) (-689.231) [-685.682] -- 0:00:21
644500 -- (-691.569) [-687.774] (-686.995) (-688.160) * (-686.515) (-686.469) [-689.229] (-685.217) -- 0:00:21
645000 -- (-690.088) [-687.230] (-685.768) (-687.345) * (-686.459) [-689.817] (-686.078) (-686.077) -- 0:00:21
Average standard deviation of split frequencies: 0.013330
645500 -- (-688.553) [-686.217] (-687.096) (-686.429) * [-686.304] (-684.625) (-688.341) (-685.726) -- 0:00:21
646000 -- [-685.422] (-686.185) (-689.012) (-685.380) * [-685.817] (-686.927) (-689.848) (-687.789) -- 0:00:21
646500 -- (-685.913) (-685.610) [-687.109] (-685.688) * (-689.100) [-687.690] (-688.283) (-689.690) -- 0:00:21
647000 -- (-688.159) (-687.974) [-690.233] (-688.437) * (-692.414) (-687.454) (-685.412) [-685.708] -- 0:00:21
647500 -- (-688.895) (-686.714) (-689.510) [-688.453] * (-689.661) [-687.472] (-688.053) (-686.409) -- 0:00:21
648000 -- (-690.528) (-687.087) [-689.343] (-687.545) * (-686.887) (-688.521) (-686.783) [-687.060] -- 0:00:21
648500 -- (-686.957) (-685.157) [-687.008] (-685.872) * (-684.840) (-687.273) [-685.278] (-685.252) -- 0:00:21
649000 -- (-686.692) (-686.679) [-687.126] (-685.537) * [-684.996] (-686.293) (-687.546) (-684.775) -- 0:00:21
649500 -- (-684.994) (-689.580) (-690.434) [-692.131] * (-684.945) [-685.695] (-688.531) (-687.419) -- 0:00:21
650000 -- [-685.320] (-688.702) (-690.595) (-688.667) * (-687.675) [-688.533] (-689.669) (-684.874) -- 0:00:21
Average standard deviation of split frequencies: 0.013282
650500 -- [-685.011] (-685.927) (-688.823) (-685.723) * (-687.894) (-686.697) [-689.262] (-685.158) -- 0:00:20
651000 -- [-685.650] (-685.128) (-688.626) (-687.599) * (-686.336) (-686.449) [-688.468] (-685.713) -- 0:00:20
651500 -- (-691.563) [-684.996] (-688.796) (-684.909) * (-687.180) (-687.586) [-686.423] (-686.574) -- 0:00:20
652000 -- (-689.847) (-685.885) [-692.106] (-684.917) * (-688.289) (-685.421) (-688.372) [-687.758] -- 0:00:20
652500 -- (-688.833) [-688.371] (-689.629) (-686.789) * (-690.636) [-685.600] (-686.262) (-689.103) -- 0:00:20
653000 -- [-685.826] (-687.122) (-688.151) (-685.878) * (-688.602) [-685.010] (-687.944) (-687.916) -- 0:00:20
653500 -- (-685.701) (-687.677) [-686.811] (-686.682) * [-689.658] (-692.914) (-688.815) (-693.357) -- 0:00:20
654000 -- (-687.130) (-686.668) (-685.726) [-685.605] * [-687.847] (-687.086) (-686.322) (-689.930) -- 0:00:20
654500 -- (-686.492) (-686.603) [-685.258] (-685.324) * [-687.296] (-687.804) (-689.648) (-685.122) -- 0:00:20
655000 -- (-686.004) (-691.127) (-690.614) [-687.672] * (-687.303) [-687.808] (-686.905) (-685.133) -- 0:00:20
Average standard deviation of split frequencies: 0.013701
655500 -- (-687.612) [-689.124] (-689.885) (-685.817) * (-686.481) (-685.967) (-684.805) [-690.271] -- 0:00:21
656000 -- (-685.674) [-688.955] (-684.962) (-686.200) * (-687.567) (-689.039) [-684.871] (-690.280) -- 0:00:20
656500 -- (-685.905) [-686.881] (-688.297) (-686.886) * (-690.307) [-687.331] (-686.691) (-685.762) -- 0:00:20
657000 -- (-686.288) (-686.883) (-686.974) [-685.920] * (-688.708) (-686.991) (-686.498) [-686.893] -- 0:00:20
657500 -- (-686.472) (-690.652) [-686.761] (-687.325) * (-690.657) (-692.239) [-689.785] (-686.787) -- 0:00:20
658000 -- (-685.261) (-687.029) (-689.176) [-685.239] * (-688.185) (-696.061) (-685.728) [-684.866] -- 0:00:20
658500 -- (-687.850) (-686.568) (-690.264) [-685.463] * (-687.732) [-688.255] (-686.828) (-686.428) -- 0:00:20
659000 -- (-688.475) [-686.549] (-690.842) (-687.624) * (-688.458) (-686.811) [-686.799] (-685.430) -- 0:00:20
659500 -- (-689.185) [-686.657] (-686.343) (-685.080) * (-686.710) (-689.242) (-687.639) [-685.922] -- 0:00:20
660000 -- (-687.700) (-687.958) (-692.056) [-685.981] * [-686.823] (-687.175) (-687.077) (-686.103) -- 0:00:20
Average standard deviation of split frequencies: 0.013557
660500 -- (-685.820) [-686.162] (-688.758) (-687.997) * (-689.290) (-688.653) (-686.013) [-686.248] -- 0:00:20
661000 -- (-686.291) (-686.738) [-685.816] (-685.067) * (-688.887) [-687.497] (-686.769) (-684.866) -- 0:00:20
661500 -- (-687.234) (-691.426) (-686.451) [-685.180] * (-692.541) (-685.727) [-687.042] (-685.453) -- 0:00:20
662000 -- (-687.420) (-685.512) [-687.996] (-685.133) * (-688.845) (-687.306) [-686.911] (-688.199) -- 0:00:20
662500 -- (-688.467) (-686.970) (-686.288) [-686.640] * (-686.764) (-685.747) [-688.510] (-686.353) -- 0:00:20
663000 -- (-686.417) (-686.991) [-685.922] (-686.643) * (-693.290) [-686.783] (-689.815) (-688.101) -- 0:00:20
663500 -- [-685.430] (-685.092) (-686.672) (-687.296) * (-691.237) (-685.565) [-686.807] (-689.714) -- 0:00:20
664000 -- (-690.013) [-685.944] (-687.139) (-686.376) * (-689.457) [-687.278] (-689.794) (-686.691) -- 0:00:20
664500 -- [-686.049] (-687.139) (-687.066) (-687.969) * (-685.554) [-692.659] (-688.661) (-685.612) -- 0:00:20
665000 -- (-686.701) (-688.107) (-685.082) [-686.142] * [-684.675] (-685.450) (-686.515) (-685.413) -- 0:00:20
Average standard deviation of split frequencies: 0.013024
665500 -- (-686.131) (-689.026) [-685.941] (-686.606) * [-684.654] (-686.398) (-687.142) (-687.254) -- 0:00:20
666000 -- (-688.152) [-687.071] (-687.014) (-686.009) * (-684.891) (-693.886) (-686.734) [-688.518] -- 0:00:20
666500 -- (-687.374) (-687.447) (-686.285) [-688.913] * (-686.733) (-686.187) [-688.923] (-686.579) -- 0:00:20
667000 -- (-687.515) [-688.071] (-691.037) (-684.937) * (-688.041) (-686.973) [-689.402] (-690.464) -- 0:00:19
667500 -- (-686.539) (-686.494) (-689.338) [-685.548] * (-689.015) (-688.636) (-688.003) [-685.369] -- 0:00:19
668000 -- (-686.282) [-686.873] (-685.177) (-687.152) * [-688.136] (-689.115) (-686.942) (-686.306) -- 0:00:19
668500 -- (-686.205) [-686.437] (-684.871) (-685.914) * (-685.934) (-686.741) (-687.583) [-685.428] -- 0:00:19
669000 -- (-685.675) [-689.337] (-690.017) (-689.285) * (-690.248) [-686.484] (-688.808) (-686.032) -- 0:00:19
669500 -- [-685.075] (-686.454) (-685.839) (-690.154) * [-688.454] (-685.228) (-689.881) (-686.182) -- 0:00:19
670000 -- (-689.363) (-686.206) [-686.128] (-687.802) * (-688.434) (-686.666) [-686.120] (-685.749) -- 0:00:19
Average standard deviation of split frequencies: 0.013589
670500 -- [-686.520] (-690.419) (-686.255) (-686.960) * (-688.453) (-688.342) [-687.545] (-687.134) -- 0:00:19
671000 -- [-686.533] (-693.288) (-687.037) (-684.795) * (-687.339) [-685.833] (-687.577) (-686.808) -- 0:00:19
671500 -- (-687.573) (-687.759) [-686.415] (-686.055) * (-684.783) [-685.971] (-689.084) (-687.265) -- 0:00:19
672000 -- (-689.063) (-688.672) [-688.047] (-686.528) * (-686.223) [-686.654] (-689.789) (-686.664) -- 0:00:20
672500 -- (-685.862) [-689.164] (-687.516) (-687.946) * (-688.676) [-687.978] (-686.455) (-684.681) -- 0:00:19
673000 -- (-685.458) [-688.416] (-690.010) (-686.654) * (-687.404) (-686.334) [-687.069] (-684.712) -- 0:00:19
673500 -- [-687.137] (-686.535) (-687.924) (-691.448) * (-685.463) [-687.375] (-688.972) (-688.612) -- 0:00:19
674000 -- (-687.620) (-686.490) (-686.478) [-690.810] * (-690.004) [-685.148] (-687.044) (-687.704) -- 0:00:19
674500 -- (-685.787) [-686.522] (-686.851) (-687.547) * (-687.176) (-686.734) (-684.697) [-685.139] -- 0:00:19
675000 -- (-686.606) (-686.293) (-689.225) [-689.859] * (-687.852) (-686.479) [-685.509] (-687.074) -- 0:00:19
Average standard deviation of split frequencies: 0.013343
675500 -- (-686.590) (-691.678) [-687.879] (-695.448) * [-685.591] (-686.078) (-688.552) (-688.736) -- 0:00:19
676000 -- (-685.018) [-690.369] (-686.695) (-687.959) * (-687.073) (-685.658) (-685.854) [-689.883] -- 0:00:19
676500 -- [-685.027] (-693.294) (-685.667) (-685.267) * (-686.414) (-686.743) (-685.390) [-687.996] -- 0:00:19
677000 -- (-689.021) (-691.829) (-687.541) [-685.207] * (-687.545) (-686.013) [-690.600] (-687.295) -- 0:00:19
677500 -- (-687.416) (-687.614) (-688.335) [-688.779] * (-685.516) (-685.826) [-687.274] (-687.630) -- 0:00:19
678000 -- (-686.719) (-684.698) (-685.230) [-689.680] * (-686.287) [-685.164] (-686.603) (-690.537) -- 0:00:19
678500 -- [-687.014] (-686.945) (-686.147) (-688.304) * (-689.976) (-687.854) (-686.563) [-689.976] -- 0:00:19
679000 -- (-686.576) [-689.237] (-687.290) (-689.247) * (-692.652) (-686.955) [-687.179] (-688.584) -- 0:00:19
679500 -- [-685.735] (-686.797) (-687.307) (-687.120) * [-687.869] (-688.561) (-687.947) (-685.671) -- 0:00:19
680000 -- [-687.273] (-685.915) (-690.051) (-687.725) * (-689.086) (-688.687) [-687.815] (-686.844) -- 0:00:19
Average standard deviation of split frequencies: 0.014267
680500 -- (-690.645) (-685.271) [-689.841] (-687.081) * [-685.715] (-685.961) (-686.889) (-687.484) -- 0:00:19
681000 -- (-686.572) (-690.640) (-686.484) [-686.485] * (-688.107) (-693.634) (-686.672) [-689.904] -- 0:00:19
681500 -- (-687.121) (-692.658) (-688.514) [-688.927] * (-690.216) [-687.698] (-686.892) (-686.354) -- 0:00:19
682000 -- (-686.200) [-688.409] (-687.246) (-688.454) * (-685.660) [-686.801] (-685.963) (-685.921) -- 0:00:19
682500 -- (-686.406) (-688.527) [-686.261] (-687.043) * [-686.336] (-691.284) (-688.091) (-687.932) -- 0:00:19
683000 -- (-688.088) (-687.479) [-685.097] (-685.700) * (-684.967) (-684.948) (-686.364) [-687.629] -- 0:00:19
683500 -- (-686.617) (-688.583) [-687.683] (-686.959) * (-687.283) (-687.032) (-685.897) [-687.132] -- 0:00:18
684000 -- (-686.408) [-691.786] (-686.896) (-689.975) * (-688.422) (-685.789) [-687.309] (-691.005) -- 0:00:18
684500 -- [-685.759] (-686.487) (-684.611) (-687.218) * (-687.087) (-685.070) [-688.108] (-686.268) -- 0:00:18
685000 -- (-685.361) (-686.214) (-686.572) [-686.702] * (-690.302) [-684.808] (-687.456) (-690.650) -- 0:00:18
Average standard deviation of split frequencies: 0.014731
685500 -- (-686.408) (-685.465) (-685.714) [-688.388] * [-684.834] (-686.533) (-690.048) (-692.562) -- 0:00:18
686000 -- [-687.724] (-690.698) (-686.189) (-687.460) * [-685.949] (-688.853) (-687.838) (-689.327) -- 0:00:18
686500 -- (-688.045) (-686.415) [-685.970] (-685.888) * (-685.951) (-691.407) (-685.136) [-687.387] -- 0:00:18
687000 -- [-687.687] (-686.972) (-687.394) (-685.273) * (-686.166) (-686.020) (-685.692) [-687.439] -- 0:00:18
687500 -- (-690.025) (-687.998) [-685.206] (-686.851) * [-687.894] (-688.665) (-690.891) (-688.294) -- 0:00:18
688000 -- [-688.151] (-688.566) (-685.980) (-687.400) * (-685.420) (-687.639) (-691.327) [-687.779] -- 0:00:18
688500 -- [-690.492] (-687.468) (-687.655) (-688.766) * (-685.667) [-685.533] (-686.264) (-692.123) -- 0:00:18
689000 -- [-685.946] (-687.234) (-691.927) (-689.182) * (-687.347) (-685.551) [-686.509] (-689.851) -- 0:00:18
689500 -- (-684.721) (-685.556) [-686.369] (-685.926) * (-686.980) (-693.302) (-688.048) [-685.692] -- 0:00:18
690000 -- (-685.106) [-687.206] (-688.085) (-687.235) * (-686.697) (-685.618) [-685.280] (-687.848) -- 0:00:18
Average standard deviation of split frequencies: 0.014547
690500 -- (-686.220) [-688.339] (-686.318) (-686.842) * (-686.527) (-687.472) [-685.499] (-686.041) -- 0:00:18
691000 -- (-686.776) (-687.948) (-685.800) [-685.962] * (-686.103) [-687.625] (-690.529) (-687.665) -- 0:00:18
691500 -- (-685.587) (-688.124) [-687.535] (-686.245) * (-685.492) (-685.785) [-690.793] (-685.192) -- 0:00:18
692000 -- [-685.452] (-685.799) (-686.763) (-686.852) * (-687.082) [-686.135] (-692.089) (-687.738) -- 0:00:18
692500 -- (-686.048) (-687.805) (-688.579) [-686.510] * (-687.260) (-688.142) [-685.876] (-689.279) -- 0:00:18
693000 -- (-686.129) [-689.836] (-685.976) (-690.641) * (-686.055) [-690.016] (-685.895) (-687.606) -- 0:00:18
693500 -- [-685.280] (-690.467) (-688.485) (-686.450) * [-684.715] (-689.635) (-686.471) (-687.560) -- 0:00:18
694000 -- (-689.930) [-688.464] (-686.304) (-686.449) * (-684.899) [-687.163] (-688.365) (-687.413) -- 0:00:18
694500 -- (-688.549) (-693.429) [-686.078] (-685.269) * (-692.222) (-690.985) (-691.126) [-687.549] -- 0:00:18
695000 -- (-688.136) (-696.128) (-684.820) [-686.551] * (-691.132) (-692.023) (-687.314) [-687.526] -- 0:00:18
Average standard deviation of split frequencies: 0.014585
695500 -- (-694.100) (-687.336) (-685.033) [-685.626] * (-688.527) (-692.144) [-685.318] (-687.730) -- 0:00:18
696000 -- (-689.892) (-688.176) (-687.039) [-685.372] * (-688.787) [-686.007] (-686.447) (-685.396) -- 0:00:18
696500 -- [-688.058] (-686.972) (-685.324) (-688.197) * [-689.386] (-684.629) (-686.109) (-686.458) -- 0:00:18
697000 -- (-685.794) (-687.551) [-687.914] (-687.107) * (-686.564) (-684.552) (-685.015) [-691.433] -- 0:00:18
697500 -- [-686.535] (-685.777) (-687.136) (-684.902) * (-686.080) (-688.466) (-688.499) [-690.335] -- 0:00:18
698000 -- (-689.256) (-687.542) [-692.006] (-685.076) * (-686.081) (-685.235) [-686.246] (-688.017) -- 0:00:18
698500 -- (-687.116) (-685.787) [-687.152] (-685.139) * (-693.203) (-685.951) (-684.750) [-691.002] -- 0:00:18
699000 -- [-685.420] (-685.004) (-687.061) (-686.014) * (-691.382) (-690.410) [-688.321] (-689.398) -- 0:00:18
699500 -- (-686.760) [-685.743] (-685.733) (-685.549) * [-685.488] (-686.275) (-690.107) (-685.566) -- 0:00:18
700000 -- (-685.913) [-686.162] (-686.332) (-687.801) * (-687.218) [-685.575] (-687.921) (-690.346) -- 0:00:18
Average standard deviation of split frequencies: 0.014353
700500 -- (-688.147) [-687.493] (-688.133) (-686.681) * [-685.599] (-686.128) (-686.742) (-685.096) -- 0:00:17
701000 -- (-684.501) [-686.654] (-685.312) (-687.220) * (-688.395) (-685.564) (-688.274) [-686.423] -- 0:00:17
701500 -- [-685.876] (-692.131) (-689.077) (-685.049) * (-686.630) (-686.537) [-685.143] (-687.508) -- 0:00:17
702000 -- (-687.026) (-686.774) [-686.277] (-690.117) * (-687.602) [-686.658] (-686.249) (-686.593) -- 0:00:17
702500 -- [-685.078] (-685.728) (-687.397) (-687.352) * [-687.459] (-686.806) (-688.281) (-686.888) -- 0:00:17
703000 -- [-691.096] (-686.357) (-685.209) (-685.568) * (-691.002) [-686.135] (-690.209) (-686.103) -- 0:00:17
703500 -- (-689.360) (-687.345) [-686.438] (-689.514) * (-690.411) (-686.411) (-686.820) [-687.145] -- 0:00:17
704000 -- (-689.504) (-686.872) [-685.868] (-691.394) * (-684.667) (-687.888) [-687.108] (-692.255) -- 0:00:17
704500 -- (-686.878) (-685.997) (-688.447) [-687.605] * [-685.097] (-686.216) (-687.364) (-692.833) -- 0:00:17
705000 -- (-687.998) (-688.896) [-685.369] (-685.951) * (-688.096) (-686.288) [-686.728] (-690.482) -- 0:00:17
Average standard deviation of split frequencies: 0.014066
705500 -- (-688.045) (-690.798) (-690.680) [-684.932] * [-687.744] (-689.300) (-688.438) (-686.068) -- 0:00:17
706000 -- (-686.118) [-686.736] (-685.857) (-685.223) * [-686.219] (-689.934) (-686.305) (-685.769) -- 0:00:17
706500 -- (-686.377) (-686.981) (-686.951) [-687.455] * (-685.406) [-689.760] (-686.003) (-686.611) -- 0:00:17
707000 -- [-686.999] (-686.812) (-687.647) (-687.899) * [-684.883] (-686.839) (-686.771) (-689.061) -- 0:00:17
707500 -- (-687.980) [-685.131] (-687.194) (-686.376) * (-688.112) (-686.758) [-685.647] (-688.365) -- 0:00:17
708000 -- (-685.940) [-686.010] (-686.800) (-684.816) * [-686.134] (-687.651) (-685.224) (-687.236) -- 0:00:17
708500 -- (-685.423) [-687.300] (-686.321) (-686.440) * [-686.901] (-690.609) (-686.231) (-685.929) -- 0:00:17
709000 -- (-686.485) [-687.026] (-685.681) (-691.131) * (-685.752) [-686.052] (-687.234) (-684.636) -- 0:00:17
709500 -- (-686.964) (-686.692) (-684.860) [-686.791] * (-687.687) [-687.768] (-687.132) (-688.788) -- 0:00:17
710000 -- (-687.640) (-686.511) [-685.766] (-685.227) * (-687.863) (-686.823) [-690.539] (-686.248) -- 0:00:17
Average standard deviation of split frequencies: 0.013753
710500 -- [-687.465] (-688.671) (-686.008) (-687.810) * (-689.742) (-688.381) (-687.599) [-687.237] -- 0:00:17
711000 -- (-688.178) (-687.602) (-685.754) [-687.090] * (-689.967) (-688.984) [-687.135] (-688.196) -- 0:00:17
711500 -- (-684.854) [-685.989] (-685.533) (-687.821) * [-687.702] (-686.419) (-686.922) (-685.417) -- 0:00:17
712000 -- (-686.339) (-688.430) (-686.206) [-686.471] * (-690.094) [-688.925] (-688.047) (-686.365) -- 0:00:17
712500 -- [-686.198] (-689.594) (-686.137) (-685.731) * (-688.377) [-685.735] (-687.435) (-688.902) -- 0:00:17
713000 -- [-688.198] (-684.628) (-685.860) (-686.915) * (-685.252) [-685.894] (-690.892) (-689.371) -- 0:00:17
713500 -- [-685.970] (-686.466) (-686.990) (-686.589) * [-687.743] (-688.830) (-686.924) (-686.272) -- 0:00:17
714000 -- (-687.164) (-685.196) (-687.633) [-688.730] * (-688.740) (-691.327) (-685.557) [-685.289] -- 0:00:17
714500 -- [-685.994] (-685.348) (-686.017) (-688.242) * (-689.389) [-688.438] (-686.768) (-685.523) -- 0:00:17
715000 -- (-688.847) [-684.949] (-693.934) (-685.398) * (-686.014) (-686.282) (-689.307) [-687.969] -- 0:00:17
Average standard deviation of split frequencies: 0.013519
715500 -- [-685.883] (-684.542) (-689.176) (-685.908) * (-686.736) (-686.640) (-689.504) [-690.322] -- 0:00:17
716000 -- (-686.662) (-687.234) (-687.227) [-686.306] * (-685.767) [-686.351] (-686.743) (-685.851) -- 0:00:17
716500 -- (-686.389) [-686.728] (-685.956) (-686.647) * (-685.361) [-686.492] (-686.524) (-685.318) -- 0:00:17
717000 -- (-685.292) (-688.504) [-690.924] (-685.235) * (-687.431) [-684.625] (-685.028) (-687.136) -- 0:00:16
717500 -- (-685.066) (-685.759) [-687.213] (-685.741) * [-690.768] (-687.358) (-685.849) (-687.635) -- 0:00:16
718000 -- (-687.089) (-686.404) (-689.336) [-690.294] * (-687.336) [-685.336] (-688.961) (-687.749) -- 0:00:16
718500 -- (-685.443) [-689.651] (-687.261) (-689.526) * (-689.405) [-685.612] (-692.335) (-686.126) -- 0:00:16
719000 -- (-685.797) (-691.817) (-687.974) [-686.795] * [-689.008] (-687.036) (-687.362) (-685.906) -- 0:00:16
719500 -- (-688.806) (-688.343) [-689.547] (-685.664) * (-692.038) (-687.210) [-689.899] (-688.911) -- 0:00:16
720000 -- (-686.990) (-688.011) [-691.474] (-691.695) * (-690.285) (-688.415) [-691.088] (-686.146) -- 0:00:16
Average standard deviation of split frequencies: 0.013431
720500 -- [-687.464] (-692.820) (-692.518) (-689.009) * [-689.435] (-686.047) (-684.733) (-687.671) -- 0:00:16
721000 -- [-686.170] (-686.585) (-689.192) (-686.836) * (-685.381) (-684.978) (-685.960) [-689.809] -- 0:00:16
721500 -- (-688.520) (-686.569) [-686.188] (-688.075) * (-685.160) (-690.417) (-686.383) [-687.457] -- 0:00:16
722000 -- (-689.974) (-686.807) [-688.506] (-689.707) * [-685.088] (-687.040) (-688.379) (-686.735) -- 0:00:16
722500 -- (-687.655) (-685.254) [-685.396] (-685.516) * [-685.150] (-686.461) (-686.362) (-685.866) -- 0:00:16
723000 -- [-686.522] (-686.698) (-686.695) (-685.935) * (-685.987) (-689.799) (-686.500) [-684.605] -- 0:00:16
723500 -- (-685.767) (-692.274) (-689.330) [-689.074] * [-687.443] (-686.898) (-686.745) (-684.507) -- 0:00:16
724000 -- (-685.090) (-689.745) (-687.137) [-685.715] * (-689.137) [-686.884] (-686.487) (-685.824) -- 0:00:16
724500 -- [-686.395] (-687.188) (-686.499) (-686.668) * (-685.532) [-687.966] (-684.761) (-688.687) -- 0:00:16
725000 -- [-688.556] (-687.844) (-685.491) (-687.542) * [-684.742] (-687.579) (-686.001) (-686.629) -- 0:00:16
Average standard deviation of split frequencies: 0.013068
725500 -- (-688.280) (-688.879) [-686.244] (-688.128) * (-684.809) [-687.998] (-686.964) (-689.530) -- 0:00:16
726000 -- (-687.287) (-687.595) (-686.229) [-687.036] * (-687.081) (-690.174) (-684.478) [-691.342] -- 0:00:16
726500 -- [-686.419] (-685.812) (-686.981) (-689.944) * (-687.178) (-689.675) [-686.210] (-686.935) -- 0:00:16
727000 -- [-685.407] (-688.281) (-687.390) (-685.305) * (-688.062) (-689.540) [-687.079] (-689.403) -- 0:00:16
727500 -- [-685.431] (-685.874) (-685.641) (-687.149) * (-687.493) (-689.046) (-688.269) [-686.309] -- 0:00:16
728000 -- [-685.175] (-685.251) (-690.374) (-690.615) * (-686.284) (-686.032) (-689.583) [-686.320] -- 0:00:16
728500 -- [-687.656] (-688.205) (-688.314) (-689.289) * (-686.059) (-688.483) [-685.261] (-686.111) -- 0:00:16
729000 -- (-688.501) [-687.448] (-687.967) (-690.770) * [-686.296] (-687.052) (-687.139) (-688.914) -- 0:00:16
729500 -- (-685.999) (-686.864) [-685.642] (-689.157) * (-687.722) [-686.274] (-690.957) (-688.704) -- 0:00:16
730000 -- (-687.552) (-687.069) [-685.256] (-689.152) * [-687.651] (-685.587) (-688.113) (-688.287) -- 0:00:16
Average standard deviation of split frequencies: 0.012559
730500 -- (-688.432) (-687.757) [-686.960] (-686.065) * (-685.401) [-687.245] (-686.640) (-691.441) -- 0:00:16
731000 -- (-690.135) (-686.623) (-690.327) [-686.506] * [-687.752] (-688.573) (-685.414) (-685.615) -- 0:00:16
731500 -- (-687.579) [-693.385] (-686.006) (-690.735) * (-686.066) (-687.840) (-685.263) [-685.558] -- 0:00:16
732000 -- (-687.335) (-693.603) [-687.979] (-690.502) * (-686.083) (-687.869) [-684.713] (-686.913) -- 0:00:16
732500 -- (-688.078) (-688.676) [-685.292] (-687.904) * (-690.708) (-688.206) (-686.201) [-686.507] -- 0:00:16
733000 -- [-686.251] (-688.440) (-685.919) (-685.355) * (-687.883) (-688.830) [-686.542] (-689.520) -- 0:00:16
733500 -- [-686.804] (-692.345) (-686.156) (-686.016) * (-685.310) [-686.621] (-685.482) (-686.981) -- 0:00:15
734000 -- (-688.470) (-690.103) (-685.363) [-687.803] * (-688.349) (-687.578) [-685.689] (-686.354) -- 0:00:15
734500 -- (-687.704) [-687.971] (-685.955) (-686.587) * (-684.898) (-688.819) [-684.669] (-690.893) -- 0:00:15
735000 -- (-686.352) [-685.473] (-686.299) (-687.087) * (-684.898) (-690.307) [-686.898] (-688.739) -- 0:00:15
Average standard deviation of split frequencies: 0.012981
735500 -- (-687.778) [-689.245] (-685.203) (-690.435) * (-687.836) (-689.749) (-687.666) [-689.417] -- 0:00:15
736000 -- (-688.921) (-688.509) (-685.372) [-692.475] * (-688.270) (-689.324) [-686.884] (-690.947) -- 0:00:15
736500 -- (-685.152) [-686.283] (-687.083) (-687.291) * [-685.160] (-687.450) (-686.608) (-686.584) -- 0:00:15
737000 -- (-685.220) (-686.651) (-689.473) [-686.834] * [-685.812] (-688.935) (-687.016) (-685.854) -- 0:00:15
737500 -- (-685.283) [-686.392] (-691.476) (-688.889) * (-685.613) (-684.878) (-685.346) [-689.364] -- 0:00:15
738000 -- [-687.587] (-686.187) (-687.757) (-687.163) * [-685.293] (-685.725) (-687.210) (-687.921) -- 0:00:15
738500 -- (-686.633) (-689.520) [-686.206] (-685.765) * (-684.801) (-686.763) [-689.600] (-687.741) -- 0:00:15
739000 -- (-688.724) (-689.615) [-692.595] (-688.860) * (-685.876) (-689.636) [-689.052] (-686.753) -- 0:00:15
739500 -- [-685.409] (-686.236) (-689.664) (-686.060) * (-684.803) (-690.791) (-689.102) [-689.390] -- 0:00:15
740000 -- (-685.389) [-685.655] (-686.405) (-688.699) * (-687.915) (-689.570) (-688.930) [-684.907] -- 0:00:15
Average standard deviation of split frequencies: 0.012814
740500 -- (-693.259) (-689.675) [-685.252] (-689.913) * [-686.729] (-690.720) (-686.779) (-685.073) -- 0:00:15
741000 -- [-687.244] (-690.116) (-689.236) (-685.341) * (-689.957) (-690.675) [-685.470] (-684.522) -- 0:00:15
741500 -- (-686.805) (-689.673) [-687.419] (-685.366) * (-685.394) (-687.113) [-685.279] (-688.374) -- 0:00:15
742000 -- (-689.453) (-694.770) [-689.062] (-684.902) * (-686.319) (-686.086) (-687.816) [-688.806] -- 0:00:15
742500 -- [-691.516] (-687.668) (-687.431) (-684.943) * (-688.350) [-685.073] (-688.180) (-686.598) -- 0:00:15
743000 -- [-686.114] (-689.621) (-685.117) (-684.706) * (-689.318) (-685.570) (-687.170) [-688.980] -- 0:00:15
743500 -- (-685.572) (-689.312) (-686.443) [-687.362] * (-688.603) (-686.439) (-685.991) [-688.231] -- 0:00:15
744000 -- (-690.128) (-691.957) [-685.731] (-687.095) * (-689.061) (-687.946) [-687.033] (-687.730) -- 0:00:15
744500 -- [-686.412] (-687.156) (-690.231) (-686.525) * (-687.409) [-686.005] (-685.912) (-692.061) -- 0:00:15
745000 -- [-686.518] (-689.674) (-687.776) (-686.418) * (-686.899) [-688.890] (-685.156) (-686.702) -- 0:00:15
Average standard deviation of split frequencies: 0.013059
745500 -- (-686.751) (-689.429) (-687.407) [-686.021] * [-685.235] (-684.613) (-685.556) (-687.490) -- 0:00:15
746000 -- (-687.642) (-686.002) [-688.294] (-693.063) * (-685.173) [-686.171] (-686.669) (-686.505) -- 0:00:15
746500 -- (-686.292) [-686.060] (-685.446) (-693.283) * [-688.076] (-685.636) (-687.728) (-688.814) -- 0:00:15
747000 -- (-685.583) (-685.240) [-685.542] (-688.232) * [-688.562] (-686.318) (-686.629) (-687.058) -- 0:00:15
747500 -- (-684.896) [-685.473] (-685.414) (-684.808) * (-686.904) (-685.428) (-692.636) [-686.758] -- 0:00:15
748000 -- [-685.071] (-688.773) (-685.143) (-686.401) * (-687.189) (-686.255) [-692.814] (-687.390) -- 0:00:15
748500 -- [-687.431] (-686.681) (-687.961) (-685.719) * [-685.347] (-685.289) (-688.245) (-686.713) -- 0:00:15
749000 -- [-687.582] (-687.535) (-690.094) (-688.646) * (-685.932) (-685.388) [-689.580] (-687.834) -- 0:00:15
749500 -- (-685.835) (-684.961) (-689.032) [-685.004] * (-693.122) [-686.805] (-689.571) (-685.423) -- 0:00:15
750000 -- [-687.023] (-684.841) (-687.136) (-684.852) * [-686.985] (-687.888) (-690.276) (-686.967) -- 0:00:15
Average standard deviation of split frequencies: 0.012978
750500 -- (-688.788) [-685.200] (-687.285) (-688.083) * [-687.622] (-686.488) (-685.443) (-688.619) -- 0:00:14
751000 -- (-686.753) (-688.116) [-685.228] (-688.664) * (-686.818) [-685.543] (-691.118) (-687.547) -- 0:00:14
751500 -- [-686.749] (-688.355) (-686.529) (-685.430) * [-691.413] (-686.948) (-685.981) (-690.639) -- 0:00:14
752000 -- (-687.605) (-686.091) (-686.950) [-688.990] * (-691.098) (-689.651) [-689.443] (-687.697) -- 0:00:14
752500 -- (-691.444) (-686.940) (-684.609) [-689.699] * [-685.114] (-688.685) (-688.030) (-684.926) -- 0:00:14
753000 -- (-689.347) (-684.684) [-685.926] (-686.260) * (-686.282) (-689.405) [-687.903] (-686.456) -- 0:00:14
753500 -- (-686.932) (-686.537) (-685.900) [-687.440] * (-687.096) (-687.652) (-686.109) [-684.861] -- 0:00:14
754000 -- (-686.868) (-686.985) (-688.123) [-686.885] * [-686.890] (-685.786) (-685.366) (-686.977) -- 0:00:14
754500 -- (-686.837) [-686.011] (-688.141) (-689.529) * (-688.198) [-685.789] (-686.458) (-686.861) -- 0:00:14
755000 -- [-685.844] (-689.897) (-689.229) (-686.628) * (-688.027) (-685.954) [-689.002] (-688.936) -- 0:00:14
Average standard deviation of split frequencies: 0.012388
755500 -- (-687.617) [-686.545] (-688.412) (-687.780) * (-687.446) (-687.300) (-689.227) [-686.341] -- 0:00:14
756000 -- (-687.836) (-685.677) [-687.031] (-688.905) * [-687.073] (-686.421) (-689.317) (-689.596) -- 0:00:14
756500 -- (-693.086) [-686.020] (-687.881) (-690.037) * (-686.791) [-686.393] (-687.163) (-689.947) -- 0:00:14
757000 -- (-688.277) [-684.637] (-687.560) (-686.656) * (-686.078) (-689.760) (-685.968) [-686.275] -- 0:00:14
757500 -- (-687.481) (-686.435) (-688.683) [-684.831] * (-687.061) (-687.448) [-687.072] (-688.455) -- 0:00:14
758000 -- [-684.685] (-686.071) (-687.517) (-685.981) * (-689.208) (-686.856) (-686.089) [-687.714] -- 0:00:14
758500 -- [-685.041] (-687.194) (-687.067) (-686.929) * (-686.052) (-689.461) (-686.442) [-686.331] -- 0:00:14
759000 -- [-687.308] (-686.290) (-686.002) (-688.302) * [-685.980] (-685.726) (-686.777) (-688.225) -- 0:00:14
759500 -- (-691.143) (-686.739) [-686.523] (-687.644) * (-686.471) [-687.148] (-692.959) (-684.820) -- 0:00:14
760000 -- (-686.153) (-688.120) (-686.946) [-684.937] * (-685.038) (-687.864) (-685.348) [-685.844] -- 0:00:14
Average standard deviation of split frequencies: 0.012436
760500 -- [-685.293] (-686.684) (-690.884) (-686.234) * (-688.571) [-689.346] (-685.459) (-687.050) -- 0:00:14
761000 -- [-686.208] (-686.262) (-689.264) (-685.933) * [-688.306] (-686.483) (-685.963) (-685.179) -- 0:00:14
761500 -- (-685.463) (-686.049) (-686.477) [-689.629] * (-689.893) [-689.671] (-685.744) (-687.005) -- 0:00:14
762000 -- (-689.397) [-685.130] (-686.385) (-687.704) * [-689.586] (-687.076) (-685.590) (-686.697) -- 0:00:14
762500 -- (-689.973) (-687.478) [-685.049] (-688.149) * (-685.167) (-685.523) (-688.979) [-688.084] -- 0:00:14
763000 -- (-686.159) [-685.198] (-686.905) (-688.344) * (-687.491) (-692.159) (-685.974) [-688.449] -- 0:00:14
763500 -- [-691.068] (-687.272) (-685.148) (-685.807) * (-686.858) (-691.014) (-687.569) [-685.440] -- 0:00:14
764000 -- [-687.831] (-686.057) (-686.636) (-692.924) * [-685.195] (-695.241) (-689.720) (-687.437) -- 0:00:14
764500 -- (-687.719) (-686.736) (-686.001) [-686.354] * (-689.155) (-688.339) (-693.806) [-688.196] -- 0:00:14
765000 -- (-687.940) [-689.653] (-686.561) (-690.783) * [-686.975] (-687.987) (-691.604) (-687.403) -- 0:00:14
Average standard deviation of split frequencies: 0.012636
765500 -- (-687.674) [-687.645] (-686.103) (-685.790) * (-686.010) (-686.609) [-687.377] (-687.986) -- 0:00:14
766000 -- (-685.433) (-687.679) (-686.289) [-684.984] * (-684.975) (-686.057) (-685.668) [-687.956] -- 0:00:14
766500 -- (-690.937) [-688.330] (-688.182) (-692.661) * (-686.036) (-685.991) [-685.931] (-691.730) -- 0:00:14
767000 -- [-686.843] (-687.793) (-686.214) (-690.458) * (-686.274) (-685.499) (-685.858) [-690.131] -- 0:00:13
767500 -- (-687.678) [-687.248] (-687.422) (-689.101) * [-686.728] (-684.932) (-686.572) (-689.207) -- 0:00:13
768000 -- (-687.532) [-687.895] (-687.187) (-685.598) * (-685.229) [-687.118] (-689.562) (-691.297) -- 0:00:13
768500 -- (-686.462) (-686.683) [-687.142] (-687.320) * (-686.279) (-687.468) [-686.607] (-692.448) -- 0:00:13
769000 -- (-687.056) (-687.099) [-688.414] (-686.515) * (-690.235) (-687.804) [-686.121] (-690.848) -- 0:00:13
769500 -- (-686.985) [-687.919] (-688.132) (-687.248) * [-687.848] (-689.746) (-685.959) (-687.462) -- 0:00:13
770000 -- (-687.421) (-691.691) (-685.932) [-685.552] * (-689.762) (-690.984) [-686.026] (-686.273) -- 0:00:13
Average standard deviation of split frequencies: 0.012397
770500 -- [-685.866] (-686.473) (-690.056) (-686.353) * (-689.846) (-685.446) [-685.514] (-686.796) -- 0:00:13
771000 -- (-688.642) (-685.559) [-685.935] (-686.088) * (-688.354) [-686.071] (-688.263) (-687.377) -- 0:00:13
771500 -- (-686.301) (-688.063) [-686.151] (-686.314) * [-685.241] (-686.236) (-685.602) (-687.375) -- 0:00:13
772000 -- [-688.099] (-687.625) (-685.847) (-690.312) * (-686.866) [-685.517] (-690.863) (-684.742) -- 0:00:13
772500 -- [-687.109] (-687.760) (-687.248) (-688.094) * (-689.000) [-687.207] (-686.391) (-685.843) -- 0:00:13
773000 -- (-684.963) (-695.280) [-687.417] (-686.255) * [-686.942] (-688.977) (-688.838) (-687.661) -- 0:00:13
773500 -- [-687.958] (-685.499) (-685.061) (-690.949) * (-687.129) [-685.693] (-686.911) (-684.692) -- 0:00:13
774000 -- (-689.121) (-685.070) (-685.919) [-685.092] * [-686.164] (-686.845) (-685.827) (-685.033) -- 0:00:13
774500 -- (-692.834) (-686.775) [-689.592] (-685.538) * [-689.486] (-689.359) (-685.731) (-685.836) -- 0:00:13
775000 -- [-686.647] (-685.500) (-685.940) (-687.109) * (-686.670) [-684.835] (-685.589) (-684.658) -- 0:00:13
Average standard deviation of split frequencies: 0.012190
775500 -- [-686.732] (-685.042) (-688.539) (-686.578) * (-690.971) [-690.085] (-687.809) (-688.374) -- 0:00:13
776000 -- [-686.721] (-684.885) (-689.450) (-690.831) * (-686.093) (-687.080) (-686.018) [-685.885] -- 0:00:13
776500 -- (-685.161) (-685.827) [-688.377] (-687.872) * [-685.095] (-689.016) (-687.273) (-685.880) -- 0:00:13
777000 -- [-685.743] (-685.454) (-691.489) (-687.215) * [-686.089] (-685.044) (-692.318) (-686.633) -- 0:00:13
777500 -- (-685.304) [-687.150] (-687.058) (-685.217) * (-690.861) (-685.285) [-688.849] (-686.821) -- 0:00:13
778000 -- (-686.613) (-687.596) [-686.837] (-688.289) * (-686.234) (-685.793) [-685.839] (-686.062) -- 0:00:13
778500 -- [-684.946] (-686.368) (-686.349) (-686.794) * (-687.938) (-685.270) (-685.496) [-685.026] -- 0:00:13
779000 -- (-684.944) (-686.721) (-688.190) [-686.512] * (-687.095) (-689.902) (-691.774) [-685.707] -- 0:00:13
779500 -- [-685.899] (-686.558) (-685.904) (-685.513) * (-687.963) (-687.482) [-686.494] (-694.701) -- 0:00:13
780000 -- (-684.976) (-688.640) (-688.481) [-684.951] * (-689.352) (-685.422) (-686.849) [-687.378] -- 0:00:13
Average standard deviation of split frequencies: 0.012560
780500 -- (-684.811) [-687.732] (-689.504) (-686.781) * (-687.200) (-686.543) [-687.100] (-686.852) -- 0:00:13
781000 -- [-685.324] (-687.535) (-689.050) (-688.603) * (-691.353) (-687.125) [-687.394] (-686.378) -- 0:00:13
781500 -- [-685.052] (-695.558) (-688.475) (-685.575) * (-690.186) (-685.957) [-685.054] (-685.076) -- 0:00:13
782000 -- (-690.157) [-689.090] (-687.603) (-688.587) * [-687.100] (-687.149) (-685.713) (-693.683) -- 0:00:13
782500 -- (-690.005) (-689.827) [-686.443] (-689.239) * (-686.132) (-685.776) [-686.260] (-693.968) -- 0:00:13
783000 -- (-689.086) (-688.784) [-686.626] (-689.879) * (-685.038) [-684.931] (-691.537) (-691.591) -- 0:00:13
783500 -- (-687.088) (-685.547) [-685.317] (-685.021) * [-685.390] (-685.996) (-686.417) (-692.710) -- 0:00:12
784000 -- (-685.999) (-686.753) [-689.652] (-684.977) * (-685.760) [-685.966] (-687.959) (-690.682) -- 0:00:12
784500 -- [-686.910] (-686.753) (-686.716) (-690.298) * (-688.449) [-687.919] (-688.192) (-689.364) -- 0:00:12
785000 -- [-685.256] (-688.863) (-687.529) (-687.319) * (-687.743) (-688.329) [-687.308] (-692.818) -- 0:00:12
Average standard deviation of split frequencies: 0.012332
785500 -- (-686.471) (-689.154) [-686.763] (-685.493) * [-684.696] (-689.820) (-687.919) (-688.476) -- 0:00:12
786000 -- (-687.608) [-691.470] (-688.302) (-685.393) * [-687.643] (-687.498) (-687.191) (-685.493) -- 0:00:12
786500 -- (-685.533) [-687.784] (-690.832) (-686.377) * (-687.824) [-687.715] (-686.497) (-685.567) -- 0:00:12
787000 -- (-687.525) (-686.959) (-685.148) [-688.017] * (-691.821) [-687.458] (-687.022) (-687.556) -- 0:00:12
787500 -- (-692.153) (-687.271) [-686.901] (-687.764) * (-689.646) (-685.002) (-686.746) [-686.381] -- 0:00:12
788000 -- (-691.704) (-686.224) (-687.065) [-685.959] * (-686.971) [-686.610] (-688.181) (-691.999) -- 0:00:12
788500 -- [-688.156] (-686.912) (-689.733) (-686.110) * (-686.136) [-686.870] (-688.553) (-685.416) -- 0:00:12
789000 -- (-690.343) (-688.795) [-687.648] (-688.321) * (-686.336) [-686.976] (-688.507) (-689.122) -- 0:00:12
789500 -- (-687.848) (-686.290) [-686.516] (-686.514) * (-685.868) (-687.991) [-688.671] (-688.827) -- 0:00:12
790000 -- (-690.770) [-685.973] (-686.178) (-690.582) * [-687.266] (-688.098) (-686.036) (-688.715) -- 0:00:12
Average standard deviation of split frequencies: 0.012148
790500 -- [-687.167] (-687.058) (-686.164) (-687.140) * (-687.256) (-685.206) [-686.085] (-686.411) -- 0:00:12
791000 -- (-686.020) [-690.364] (-685.130) (-690.917) * (-685.670) [-687.472] (-691.793) (-687.752) -- 0:00:12
791500 -- [-685.668] (-687.180) (-689.588) (-688.461) * (-687.344) (-688.900) (-685.832) [-688.749] -- 0:00:12
792000 -- (-686.209) [-684.825] (-686.873) (-689.947) * (-687.896) [-687.278] (-687.234) (-689.126) -- 0:00:12
792500 -- (-685.431) [-687.310] (-686.938) (-687.956) * (-686.574) (-690.290) (-686.694) [-685.664] -- 0:00:12
793000 -- (-685.078) (-686.040) (-687.296) [-686.574] * (-685.360) (-685.858) (-685.784) [-685.776] -- 0:00:12
793500 -- (-687.473) [-686.663] (-687.265) (-685.617) * (-685.539) (-687.954) (-690.297) [-687.676] -- 0:00:12
794000 -- (-686.943) (-688.474) (-685.255) [-685.170] * (-685.605) (-691.019) [-691.884] (-686.952) -- 0:00:12
794500 -- (-687.271) (-685.250) (-685.039) [-686.090] * (-685.352) (-687.190) [-691.448] (-686.538) -- 0:00:12
795000 -- [-688.116] (-687.851) (-685.773) (-687.640) * (-686.297) [-685.430] (-690.462) (-686.053) -- 0:00:12
Average standard deviation of split frequencies: 0.012140
795500 -- (-686.356) [-687.332] (-687.116) (-693.413) * (-688.119) [-688.048] (-688.690) (-686.883) -- 0:00:12
796000 -- [-684.748] (-688.670) (-688.018) (-688.535) * (-685.173) [-685.562] (-689.239) (-685.249) -- 0:00:12
796500 -- (-687.249) [-689.661] (-687.384) (-686.236) * (-685.170) (-687.667) (-689.966) [-685.768] -- 0:00:12
797000 -- (-690.059) (-689.376) [-685.379] (-685.068) * [-685.145] (-687.311) (-689.177) (-686.253) -- 0:00:12
797500 -- (-686.728) (-689.922) [-685.510] (-691.799) * (-687.613) (-686.252) (-690.230) [-687.137] -- 0:00:12
798000 -- (-685.709) [-688.900] (-686.523) (-686.075) * (-687.793) (-693.351) (-688.489) [-686.080] -- 0:00:12
798500 -- (-685.369) (-687.997) [-686.496] (-687.402) * (-687.538) (-686.690) (-686.849) [-686.492] -- 0:00:12
799000 -- (-687.338) (-688.569) (-686.250) [-687.638] * [-685.874] (-686.253) (-687.422) (-686.255) -- 0:00:12
799500 -- [-687.152] (-685.973) (-686.856) (-690.327) * (-686.365) (-688.641) (-687.840) [-686.208] -- 0:00:12
800000 -- (-687.920) [-685.422] (-689.407) (-687.029) * [-686.569] (-686.400) (-686.967) (-687.344) -- 0:00:12
Average standard deviation of split frequencies: 0.012033
800500 -- [-686.298] (-685.651) (-688.665) (-686.106) * (-684.627) (-687.195) (-686.414) [-686.934] -- 0:00:11
801000 -- [-689.429] (-685.542) (-687.781) (-687.463) * [-689.403] (-687.317) (-687.355) (-687.170) -- 0:00:11
801500 -- (-690.120) (-686.814) (-686.033) [-685.132] * [-688.620] (-688.711) (-687.721) (-689.393) -- 0:00:11
802000 -- (-689.003) (-685.746) [-685.362] (-685.040) * (-686.506) [-685.819] (-685.750) (-686.441) -- 0:00:11
802500 -- (-686.116) [-688.746] (-685.382) (-685.377) * (-685.814) (-687.004) (-687.410) [-689.584] -- 0:00:11
803000 -- (-690.911) (-687.648) [-687.273] (-689.381) * (-686.793) (-688.670) (-686.534) [-688.234] -- 0:00:11
803500 -- [-690.536] (-686.777) (-688.139) (-687.646) * (-689.535) [-684.900] (-685.677) (-684.454) -- 0:00:11
804000 -- (-691.105) (-685.476) (-685.794) [-685.428] * (-687.870) [-684.834] (-691.121) (-685.827) -- 0:00:11
804500 -- (-691.733) (-685.863) (-684.975) [-686.270] * (-686.557) [-686.740] (-685.662) (-685.583) -- 0:00:11
805000 -- [-686.756] (-688.936) (-689.445) (-686.520) * (-685.491) [-685.857] (-692.551) (-687.450) -- 0:00:11
Average standard deviation of split frequencies: 0.011734
805500 -- (-688.909) [-687.268] (-690.085) (-687.926) * (-685.307) [-685.525] (-688.495) (-686.529) -- 0:00:11
806000 -- (-685.954) (-686.869) (-690.079) [-686.718] * (-685.275) (-689.412) [-685.753] (-689.519) -- 0:00:11
806500 -- [-686.100] (-687.179) (-686.212) (-685.111) * (-685.484) (-685.575) (-686.014) [-687.130] -- 0:00:11
807000 -- [-688.107] (-689.070) (-684.778) (-686.447) * [-686.192] (-687.033) (-686.346) (-687.869) -- 0:00:11
807500 -- (-686.971) (-686.490) (-686.044) [-685.738] * (-686.412) (-685.422) (-686.761) [-686.069] -- 0:00:11
808000 -- [-686.958] (-688.151) (-687.053) (-684.879) * (-684.693) [-686.485] (-686.594) (-686.665) -- 0:00:11
808500 -- [-686.931] (-688.261) (-685.076) (-686.017) * (-687.814) [-691.123] (-687.426) (-686.743) -- 0:00:11
809000 -- [-686.058] (-686.966) (-685.016) (-685.555) * (-687.117) [-689.148] (-688.391) (-688.164) -- 0:00:11
809500 -- (-686.644) (-685.845) (-691.190) [-686.344] * [-685.287] (-691.010) (-688.232) (-686.249) -- 0:00:11
810000 -- [-687.105] (-688.347) (-689.421) (-686.171) * [-685.288] (-689.598) (-685.457) (-688.215) -- 0:00:11
Average standard deviation of split frequencies: 0.011448
810500 -- (-688.039) (-691.424) (-687.896) [-686.794] * (-685.888) (-689.208) (-686.035) [-688.496] -- 0:00:11
811000 -- (-686.614) (-689.352) [-686.874] (-686.247) * (-686.800) (-687.263) (-686.833) [-687.266] -- 0:00:11
811500 -- (-686.667) [-685.365] (-688.903) (-689.194) * (-685.875) (-686.854) [-688.307] (-691.281) -- 0:00:11
812000 -- (-686.298) [-686.829] (-686.617) (-690.613) * (-688.809) (-687.914) (-686.135) [-691.503] -- 0:00:11
812500 -- (-687.370) (-684.803) (-689.693) [-686.847] * (-688.008) (-687.088) (-690.602) [-691.878] -- 0:00:11
813000 -- (-688.729) (-688.514) [-688.512] (-685.828) * [-689.320] (-691.038) (-685.369) (-690.839) -- 0:00:11
813500 -- (-694.754) (-686.397) [-688.200] (-685.873) * (-686.248) [-687.564] (-689.222) (-688.368) -- 0:00:11
814000 -- (-691.080) [-684.870] (-686.228) (-687.955) * [-685.511] (-690.381) (-686.004) (-686.230) -- 0:00:11
814500 -- (-685.647) (-687.979) [-687.398] (-687.047) * (-687.904) (-685.691) (-686.598) [-685.530] -- 0:00:11
815000 -- (-688.983) (-686.226) [-688.596] (-687.142) * [-687.021] (-686.278) (-689.278) (-687.926) -- 0:00:11
Average standard deviation of split frequencies: 0.012096
815500 -- (-686.172) [-687.159] (-686.582) (-685.899) * (-689.779) [-693.132] (-687.905) (-687.130) -- 0:00:11
816000 -- [-690.118] (-687.129) (-688.328) (-687.314) * (-686.733) [-685.858] (-687.172) (-686.704) -- 0:00:11
816500 -- (-686.845) [-688.169] (-688.526) (-685.967) * (-690.930) (-686.725) [-685.113] (-688.658) -- 0:00:11
817000 -- (-685.719) (-692.452) (-689.270) [-687.199] * (-687.182) (-686.854) [-684.887] (-688.376) -- 0:00:10
817500 -- (-686.356) (-686.874) (-690.629) [-691.315] * (-685.967) (-686.208) [-687.389] (-687.459) -- 0:00:10
818000 -- (-691.546) [-686.658] (-687.224) (-688.147) * [-686.472] (-685.535) (-688.063) (-685.650) -- 0:00:10
818500 -- [-685.180] (-688.766) (-687.876) (-687.486) * (-688.195) (-685.228) [-686.176] (-685.337) -- 0:00:10
819000 -- [-685.597] (-686.399) (-684.744) (-687.084) * (-687.679) (-690.108) (-687.740) [-686.554] -- 0:00:10
819500 -- [-687.114] (-687.951) (-685.738) (-689.617) * (-686.617) (-688.529) (-686.827) [-687.212] -- 0:00:10
820000 -- (-685.380) (-690.754) [-684.613] (-692.042) * [-686.015] (-687.172) (-689.628) (-687.331) -- 0:00:10
Average standard deviation of split frequencies: 0.012314
820500 -- (-686.815) (-691.043) [-685.274] (-686.949) * (-686.891) [-686.463] (-691.090) (-687.952) -- 0:00:10
821000 -- [-685.055] (-685.990) (-689.126) (-688.849) * (-685.434) (-686.422) [-688.105] (-689.831) -- 0:00:10
821500 -- [-687.160] (-686.830) (-686.011) (-686.105) * (-688.003) [-686.332] (-686.616) (-690.276) -- 0:00:10
822000 -- (-685.472) [-685.501] (-685.244) (-685.187) * (-686.168) [-685.584] (-689.514) (-689.645) -- 0:00:10
822500 -- (-691.896) [-686.494] (-688.638) (-685.670) * (-686.370) (-684.904) (-689.142) [-687.838] -- 0:00:10
823000 -- (-686.868) [-687.086] (-687.221) (-687.029) * (-686.532) [-685.604] (-687.588) (-687.068) -- 0:00:10
823500 -- [-685.628] (-689.400) (-685.785) (-687.613) * (-689.974) [-684.909] (-688.640) (-686.040) -- 0:00:10
824000 -- [-685.522] (-685.462) (-687.701) (-686.887) * (-685.386) (-686.099) [-687.325] (-687.745) -- 0:00:10
824500 -- (-686.014) (-686.144) (-685.979) [-686.377] * (-685.331) [-686.849] (-686.561) (-687.181) -- 0:00:10
825000 -- (-687.222) (-688.437) [-684.984] (-687.026) * (-685.246) (-686.190) [-685.319] (-685.035) -- 0:00:10
Average standard deviation of split frequencies: 0.012235
825500 -- (-687.449) [-686.129] (-689.522) (-685.663) * (-690.224) (-687.014) (-692.628) [-686.082] -- 0:00:10
826000 -- (-686.274) (-686.939) (-685.700) [-686.380] * (-690.363) (-686.893) [-686.086] (-686.328) -- 0:00:10
826500 -- (-690.082) (-689.232) (-688.443) [-688.071] * (-688.543) (-686.350) (-685.653) [-685.849] -- 0:00:10
827000 -- (-688.415) [-686.594] (-686.437) (-690.195) * (-688.448) (-685.389) (-686.372) [-684.986] -- 0:00:10
827500 -- [-688.560] (-689.111) (-689.082) (-690.380) * [-685.156] (-688.330) (-689.426) (-688.797) -- 0:00:10
828000 -- [-687.269] (-688.058) (-689.297) (-685.917) * (-685.758) (-686.102) (-687.820) [-688.185] -- 0:00:10
828500 -- (-685.433) (-685.654) (-685.546) [-685.245] * [-685.963] (-687.343) (-684.932) (-691.514) -- 0:00:10
829000 -- (-687.324) [-687.741] (-686.640) (-688.612) * [-688.143] (-687.217) (-684.895) (-685.330) -- 0:00:10
829500 -- (-685.263) (-688.463) (-686.285) [-687.594] * (-687.904) [-687.895] (-687.200) (-687.243) -- 0:00:10
830000 -- (-686.533) [-687.642] (-685.758) (-685.047) * (-686.557) [-692.398] (-687.420) (-687.772) -- 0:00:10
Average standard deviation of split frequencies: 0.012591
830500 -- (-687.610) (-688.495) [-686.162] (-686.260) * (-688.592) (-686.456) [-687.097] (-687.651) -- 0:00:10
831000 -- (-688.572) [-687.427] (-688.322) (-689.266) * [-687.005] (-690.734) (-686.603) (-690.198) -- 0:00:10
831500 -- (-688.775) [-686.969] (-694.972) (-687.280) * (-689.880) (-689.625) [-686.514] (-686.270) -- 0:00:10
832000 -- (-690.220) [-685.793] (-689.624) (-686.417) * [-685.767] (-690.712) (-689.414) (-686.645) -- 0:00:10
832500 -- (-689.914) (-686.201) (-685.745) [-686.241] * (-686.572) (-688.558) (-690.174) [-686.765] -- 0:00:10
833000 -- [-689.725] (-687.819) (-688.179) (-686.929) * (-685.482) (-686.120) (-689.848) [-687.279] -- 0:00:10
833500 -- (-687.591) [-686.248] (-688.921) (-688.287) * (-685.339) (-685.031) (-686.893) [-691.219] -- 0:00:09
834000 -- [-685.421] (-688.539) (-686.334) (-687.815) * [-684.559] (-687.517) (-687.525) (-689.491) -- 0:00:09
834500 -- [-685.803] (-687.689) (-688.476) (-686.850) * (-689.054) (-686.727) [-688.941] (-690.805) -- 0:00:09
835000 -- [-687.307] (-695.343) (-688.238) (-687.496) * [-689.511] (-685.652) (-689.254) (-689.996) -- 0:00:09
Average standard deviation of split frequencies: 0.012511
835500 -- (-689.818) (-688.079) [-686.728] (-689.400) * (-687.785) (-684.886) [-685.208] (-687.885) -- 0:00:09
836000 -- [-691.943] (-687.222) (-686.153) (-685.820) * (-686.413) (-686.969) (-685.071) [-688.537] -- 0:00:09
836500 -- (-684.850) (-688.376) [-688.596] (-686.656) * (-687.567) (-687.525) [-687.459] (-685.688) -- 0:00:09
837000 -- [-687.517] (-689.954) (-692.050) (-688.250) * (-685.323) (-687.063) (-685.329) [-687.382] -- 0:00:09
837500 -- (-685.457) [-687.724] (-687.140) (-686.929) * (-688.658) (-687.906) (-686.505) [-689.704] -- 0:00:09
838000 -- (-686.340) [-687.577] (-687.847) (-686.107) * [-687.413] (-687.581) (-689.434) (-687.662) -- 0:00:09
838500 -- (-686.541) (-686.601) (-689.511) [-686.085] * [-685.517] (-687.618) (-686.188) (-687.469) -- 0:00:09
839000 -- [-685.755] (-688.285) (-686.387) (-685.898) * (-687.970) (-686.565) [-686.514] (-690.731) -- 0:00:09
839500 -- (-685.931) (-686.593) (-685.729) [-687.451] * (-694.369) (-686.789) [-687.060] (-688.027) -- 0:00:09
840000 -- (-687.141) (-687.910) (-686.908) [-687.683] * (-687.523) (-690.855) [-690.000] (-685.598) -- 0:00:09
Average standard deviation of split frequencies: 0.012091
840500 -- (-688.547) [-685.964] (-687.020) (-688.413) * (-690.129) (-690.750) [-688.640] (-686.953) -- 0:00:09
841000 -- (-687.274) [-685.781] (-686.980) (-690.652) * [-687.386] (-689.995) (-687.184) (-685.364) -- 0:00:09
841500 -- (-689.604) (-687.739) (-686.258) [-684.944] * (-689.872) (-695.619) [-687.294] (-691.008) -- 0:00:09
842000 -- (-687.965) (-685.781) [-685.568] (-685.736) * (-685.549) (-686.535) (-688.033) [-689.326] -- 0:00:09
842500 -- (-686.753) (-689.160) [-690.101] (-685.185) * (-684.891) (-689.178) (-688.837) [-690.127] -- 0:00:09
843000 -- [-688.334] (-690.306) (-685.175) (-687.827) * [-685.468] (-686.346) (-685.111) (-686.363) -- 0:00:09
843500 -- (-690.605) (-689.886) (-688.441) [-686.133] * (-685.254) (-688.111) [-686.678] (-688.327) -- 0:00:09
844000 -- (-686.302) (-686.813) [-686.957] (-688.933) * [-686.720] (-691.103) (-687.556) (-685.458) -- 0:00:09
844500 -- (-686.342) (-686.508) [-684.910] (-686.828) * (-689.185) (-689.746) (-685.227) [-688.509] -- 0:00:09
845000 -- [-686.362] (-685.548) (-684.987) (-689.671) * (-688.027) [-685.876] (-689.665) (-686.941) -- 0:00:09
Average standard deviation of split frequencies: 0.012119
845500 -- (-686.378) (-685.326) (-684.977) [-686.982] * (-687.593) (-688.033) [-691.235] (-688.417) -- 0:00:09
846000 -- [-686.398] (-686.389) (-686.179) (-693.530) * (-687.084) (-687.067) (-688.132) [-688.954] -- 0:00:09
846500 -- (-688.108) (-687.469) (-685.985) [-686.939] * [-687.599] (-692.203) (-686.714) (-689.880) -- 0:00:09
847000 -- [-687.424] (-685.185) (-687.987) (-686.734) * (-687.732) (-693.269) (-685.008) [-694.297] -- 0:00:09
847500 -- (-686.017) (-687.918) [-685.349] (-688.313) * (-685.720) (-689.904) [-685.037] (-689.651) -- 0:00:09
848000 -- (-686.906) (-687.605) [-687.291] (-690.037) * (-687.713) [-685.534] (-687.865) (-688.876) -- 0:00:09
848500 -- (-686.787) [-687.517] (-689.161) (-687.269) * (-688.293) [-686.726] (-687.965) (-685.583) -- 0:00:09
849000 -- (-689.942) (-686.694) (-686.082) [-687.067] * [-689.457] (-685.240) (-688.697) (-687.307) -- 0:00:09
849500 -- [-692.318] (-688.416) (-686.100) (-685.452) * (-686.724) [-689.067] (-690.669) (-687.271) -- 0:00:09
850000 -- (-689.537) (-689.415) [-687.908] (-685.516) * (-685.162) (-689.956) (-688.474) [-685.074] -- 0:00:09
Average standard deviation of split frequencies: 0.011741
850500 -- (-689.666) [-689.755] (-686.143) (-686.799) * [-688.885] (-688.629) (-686.182) (-686.333) -- 0:00:08
851000 -- [-689.099] (-687.262) (-687.021) (-687.760) * (-685.243) (-686.606) (-686.212) [-686.139] -- 0:00:08
851500 -- (-686.564) (-690.511) (-687.753) [-687.137] * [-685.779] (-688.507) (-689.244) (-688.243) -- 0:00:08
852000 -- (-688.812) (-692.350) (-690.182) [-685.780] * [-686.455] (-689.592) (-686.088) (-687.655) -- 0:00:08
852500 -- (-687.166) (-688.505) [-686.592] (-685.419) * [-685.655] (-687.050) (-685.864) (-685.176) -- 0:00:08
853000 -- [-685.569] (-686.636) (-686.551) (-685.721) * (-684.974) (-685.483) [-686.918] (-685.921) -- 0:00:08
853500 -- (-686.931) (-687.792) (-687.815) [-686.453] * (-684.968) (-688.564) (-687.841) [-687.197] -- 0:00:08
854000 -- (-686.432) (-691.057) [-686.672] (-687.359) * (-686.799) [-686.044] (-691.172) (-685.445) -- 0:00:08
854500 -- (-686.871) (-687.916) [-691.742] (-687.252) * (-686.473) (-685.966) [-690.620] (-685.345) -- 0:00:08
855000 -- (-686.754) (-688.744) [-689.832] (-685.787) * (-687.331) (-686.633) (-691.053) [-688.720] -- 0:00:08
Average standard deviation of split frequencies: 0.012047
855500 -- (-686.211) [-685.637] (-687.450) (-686.020) * [-686.040] (-685.265) (-689.119) (-686.317) -- 0:00:08
856000 -- (-686.041) [-685.656] (-686.541) (-691.585) * (-690.241) [-688.692] (-687.626) (-691.525) -- 0:00:08
856500 -- (-687.271) [-686.178] (-686.276) (-685.935) * (-689.722) (-685.638) (-687.416) [-688.613] -- 0:00:08
857000 -- (-688.754) [-686.121] (-684.885) (-685.590) * (-691.416) (-687.711) (-685.513) [-686.517] -- 0:00:08
857500 -- (-691.262) (-687.840) [-685.224] (-685.655) * (-688.692) (-687.541) (-687.561) [-685.078] -- 0:00:08
858000 -- (-694.529) [-689.166] (-686.370) (-684.670) * [-687.172] (-689.174) (-687.700) (-684.894) -- 0:00:08
858500 -- (-692.658) (-686.735) [-686.679] (-686.932) * (-685.954) (-688.892) (-685.034) [-686.334] -- 0:00:08
859000 -- (-696.157) (-688.170) (-686.544) [-685.707] * (-687.814) [-686.609] (-686.688) (-684.524) -- 0:00:08
859500 -- (-691.819) [-689.323] (-687.249) (-687.245) * [-686.327] (-685.575) (-687.850) (-687.370) -- 0:00:08
860000 -- (-689.758) (-686.328) [-686.177] (-687.372) * (-689.815) (-689.512) [-687.094] (-688.368) -- 0:00:08
Average standard deviation of split frequencies: 0.012255
860500 -- [-688.380] (-686.192) (-688.459) (-686.873) * (-684.838) [-687.820] (-685.039) (-687.636) -- 0:00:08
861000 -- (-689.209) [-687.113] (-688.789) (-688.934) * (-686.665) (-688.496) [-686.964] (-688.555) -- 0:00:08
861500 -- (-689.667) [-685.435] (-685.657) (-686.658) * [-687.885] (-686.661) (-686.473) (-688.390) -- 0:00:08
862000 -- (-685.382) (-690.613) [-687.834] (-686.728) * (-686.966) (-686.334) [-687.439] (-687.135) -- 0:00:08
862500 -- (-685.019) (-685.101) [-686.105] (-685.674) * (-688.086) [-685.182] (-685.905) (-689.167) -- 0:00:08
863000 -- (-686.187) (-686.496) (-685.182) [-688.084] * (-686.866) [-686.921] (-686.450) (-685.919) -- 0:00:08
863500 -- (-689.788) (-686.255) [-685.025] (-689.487) * [-686.450] (-689.946) (-688.124) (-691.109) -- 0:00:08
864000 -- (-686.300) (-685.790) (-684.938) [-688.490] * (-686.680) (-693.017) [-688.051] (-685.687) -- 0:00:08
864500 -- (-685.255) (-687.933) [-685.013] (-686.102) * [-686.210] (-685.746) (-686.832) (-687.985) -- 0:00:08
865000 -- [-688.578] (-691.057) (-686.469) (-687.477) * [-685.419] (-689.683) (-686.638) (-687.151) -- 0:00:08
Average standard deviation of split frequencies: 0.012078
865500 -- (-695.439) [-688.275] (-686.604) (-689.206) * [-684.762] (-689.111) (-687.524) (-687.908) -- 0:00:08
866000 -- (-689.186) (-689.490) (-691.258) [-688.777] * (-685.484) (-687.399) (-689.785) [-686.578] -- 0:00:08
866500 -- (-686.769) [-686.031] (-692.508) (-685.922) * (-687.481) [-687.413] (-686.459) (-688.209) -- 0:00:08
867000 -- (-686.532) [-685.831] (-689.112) (-687.046) * (-687.781) [-686.705] (-685.766) (-687.644) -- 0:00:07
867500 -- (-685.686) [-687.662] (-687.192) (-688.693) * (-689.101) (-688.299) (-687.251) [-687.632] -- 0:00:07
868000 -- (-690.474) (-689.853) (-690.054) [-686.328] * (-688.185) [-688.946] (-686.752) (-693.243) -- 0:00:07
868500 -- (-687.419) (-687.604) [-686.004] (-687.636) * (-687.807) (-689.541) (-688.890) [-686.479] -- 0:00:07
869000 -- (-686.403) [-689.934] (-689.380) (-686.913) * (-687.103) (-686.847) [-685.391] (-686.211) -- 0:00:07
869500 -- [-685.180] (-688.688) (-688.015) (-685.086) * (-684.831) [-686.895] (-685.332) (-686.191) -- 0:00:07
870000 -- [-687.423] (-688.457) (-688.050) (-685.956) * (-690.894) (-686.982) [-687.109] (-685.634) -- 0:00:07
Average standard deviation of split frequencies: 0.011708
870500 -- (-686.241) [-687.548] (-688.304) (-688.864) * (-684.847) (-688.018) (-691.507) [-686.373] -- 0:00:07
871000 -- (-686.640) (-690.624) [-687.188] (-685.888) * (-686.706) (-685.792) [-684.818] (-687.127) -- 0:00:07
871500 -- (-686.834) (-691.118) [-685.657] (-686.580) * (-688.400) (-687.554) (-686.275) [-687.808] -- 0:00:07
872000 -- [-688.190] (-690.501) (-684.865) (-686.299) * [-687.311] (-691.022) (-687.762) (-688.926) -- 0:00:07
872500 -- (-688.656) [-690.333] (-686.122) (-686.881) * (-691.223) (-686.783) (-689.105) [-688.250] -- 0:00:07
873000 -- [-685.797] (-687.780) (-685.979) (-688.826) * (-684.748) [-687.964] (-689.854) (-686.326) -- 0:00:07
873500 -- [-684.645] (-688.444) (-686.039) (-687.908) * [-685.245] (-685.880) (-687.223) (-686.853) -- 0:00:07
874000 -- [-684.653] (-688.117) (-687.123) (-686.555) * (-685.057) (-686.055) [-685.348] (-686.648) -- 0:00:07
874500 -- (-685.422) (-688.261) [-686.605] (-686.667) * (-685.831) (-687.066) (-686.687) [-686.881] -- 0:00:07
875000 -- (-685.674) (-685.896) [-685.063] (-686.817) * (-684.852) (-686.011) [-691.187] (-690.624) -- 0:00:07
Average standard deviation of split frequencies: 0.011469
875500 -- (-688.283) (-687.561) (-687.492) [-684.747] * (-687.670) (-685.688) [-687.003] (-685.466) -- 0:00:07
876000 -- (-689.232) [-685.540] (-685.300) (-688.001) * [-686.112] (-687.244) (-689.593) (-688.727) -- 0:00:07
876500 -- (-688.585) (-686.381) (-687.718) [-686.748] * (-687.710) [-685.772] (-688.989) (-689.231) -- 0:00:07
877000 -- [-688.320] (-687.347) (-685.224) (-688.929) * [-684.883] (-688.064) (-688.831) (-687.425) -- 0:00:07
877500 -- [-686.013] (-691.494) (-685.462) (-685.864) * [-684.673] (-689.005) (-687.426) (-686.423) -- 0:00:07
878000 -- (-686.358) (-685.828) (-685.816) [-684.543] * [-685.026] (-685.002) (-691.301) (-686.193) -- 0:00:07
878500 -- (-691.277) (-685.350) (-686.942) [-685.239] * (-685.653) (-685.432) [-685.716] (-685.282) -- 0:00:07
879000 -- (-685.948) (-687.487) [-685.596] (-687.097) * (-685.163) (-686.876) (-688.005) [-685.706] -- 0:00:07
879500 -- (-687.029) [-688.332] (-685.033) (-685.534) * [-686.850] (-688.170) (-686.863) (-685.708) -- 0:00:07
880000 -- (-684.917) (-687.137) (-692.440) [-687.242] * (-689.890) (-686.844) [-687.044] (-687.522) -- 0:00:07
Average standard deviation of split frequencies: 0.011107
880500 -- (-684.919) (-689.658) (-685.487) [-687.032] * (-689.800) [-686.915] (-686.112) (-686.118) -- 0:00:07
881000 -- (-687.163) (-687.808) (-689.153) [-686.746] * (-686.956) (-687.626) (-686.492) [-688.015] -- 0:00:07
881500 -- (-686.087) (-691.624) [-686.803] (-687.868) * (-685.781) (-686.520) [-687.587] (-687.205) -- 0:00:07
882000 -- [-688.188] (-688.090) (-689.742) (-690.634) * (-686.209) [-688.987] (-688.085) (-686.257) -- 0:00:07
882500 -- (-688.113) (-687.511) (-688.719) [-685.921] * (-686.997) [-686.568] (-686.137) (-688.446) -- 0:00:07
883000 -- (-689.926) (-686.939) [-684.960] (-694.263) * (-687.413) (-689.225) [-688.681] (-686.598) -- 0:00:07
883500 -- [-685.875] (-687.280) (-686.719) (-688.355) * (-687.276) [-688.429] (-687.616) (-689.568) -- 0:00:06
884000 -- (-685.703) (-687.164) [-686.343] (-687.499) * (-688.403) [-685.112] (-688.767) (-686.036) -- 0:00:06
884500 -- (-686.272) (-686.988) (-686.950) [-688.197] * [-688.202] (-685.786) (-686.321) (-685.711) -- 0:00:06
885000 -- (-689.290) (-689.577) [-685.460] (-686.556) * (-686.165) (-686.304) [-686.184] (-685.543) -- 0:00:06
Average standard deviation of split frequencies: 0.011306
885500 -- [-686.289] (-686.868) (-685.131) (-685.972) * (-688.126) [-686.275] (-689.465) (-688.694) -- 0:00:06
886000 -- (-687.163) (-691.983) [-686.727] (-685.176) * [-686.408] (-686.407) (-689.955) (-689.374) -- 0:00:06
886500 -- (-687.128) (-688.170) (-686.505) [-686.088] * (-688.451) [-685.555] (-689.172) (-685.910) -- 0:00:06
887000 -- (-690.777) (-685.639) (-686.490) [-686.638] * (-689.853) (-686.568) [-686.413] (-686.972) -- 0:00:06
887500 -- (-685.928) [-686.730] (-686.204) (-686.243) * [-687.362] (-685.663) (-686.729) (-686.872) -- 0:00:06
888000 -- [-685.741] (-685.938) (-685.645) (-687.511) * (-685.089) [-685.512] (-688.104) (-686.023) -- 0:00:06
888500 -- [-686.925] (-684.968) (-687.610) (-685.899) * [-686.729] (-686.163) (-690.818) (-687.462) -- 0:00:06
889000 -- [-686.526] (-685.285) (-690.472) (-687.124) * (-685.572) [-688.150] (-686.997) (-687.646) -- 0:00:06
889500 -- (-686.361) (-686.665) (-688.540) [-686.667] * [-687.458] (-685.926) (-685.094) (-685.756) -- 0:00:06
890000 -- (-686.475) [-685.256] (-688.267) (-685.377) * (-686.695) [-687.671] (-686.661) (-688.699) -- 0:00:06
Average standard deviation of split frequencies: 0.011181
890500 -- (-688.903) [-685.827] (-688.134) (-686.268) * (-688.073) (-685.353) [-688.026] (-686.901) -- 0:00:06
891000 -- (-687.196) [-686.501] (-686.353) (-688.448) * [-688.097] (-686.052) (-689.529) (-686.462) -- 0:00:06
891500 -- (-686.172) (-687.451) (-686.294) [-687.222] * [-688.081] (-685.290) (-688.310) (-685.307) -- 0:00:06
892000 -- [-687.550] (-686.255) (-695.046) (-686.755) * (-685.322) (-686.950) (-686.052) [-685.645] -- 0:00:06
892500 -- (-688.697) [-685.582] (-692.866) (-693.014) * [-693.209] (-686.808) (-688.230) (-687.350) -- 0:00:06
893000 -- (-691.297) (-691.097) [-688.244] (-687.103) * (-685.857) [-686.988] (-685.592) (-686.826) -- 0:00:06
893500 -- [-686.259] (-686.493) (-689.182) (-685.152) * (-685.701) [-684.772] (-687.284) (-689.001) -- 0:00:06
894000 -- (-685.889) (-685.575) [-691.323] (-685.752) * [-686.718] (-685.973) (-685.712) (-689.767) -- 0:00:06
894500 -- [-687.883] (-685.477) (-687.485) (-685.506) * (-685.188) (-685.318) [-686.045] (-689.915) -- 0:00:06
895000 -- (-686.946) (-685.201) [-685.631] (-685.520) * (-689.726) (-685.868) (-686.569) [-687.279] -- 0:00:06
Average standard deviation of split frequencies: 0.011410
895500 -- (-686.939) [-685.253] (-686.457) (-686.790) * (-688.969) [-685.228] (-685.153) (-691.679) -- 0:00:06
896000 -- (-686.603) (-684.994) [-686.287] (-686.425) * [-687.573] (-688.954) (-686.947) (-690.909) -- 0:00:06
896500 -- (-688.934) [-684.856] (-689.900) (-687.860) * (-685.594) (-685.113) (-686.834) [-685.765] -- 0:00:06
897000 -- [-690.037] (-685.351) (-685.577) (-687.603) * [-687.305] (-688.081) (-686.553) (-686.387) -- 0:00:06
897500 -- (-687.660) [-684.816] (-686.157) (-686.268) * (-685.697) (-689.673) (-687.929) [-690.450] -- 0:00:06
898000 -- (-690.300) (-685.131) [-686.532] (-686.472) * [-687.092] (-687.888) (-686.258) (-693.523) -- 0:00:06
898500 -- (-688.750) (-685.175) [-688.037] (-686.375) * (-687.171) (-686.595) (-686.352) [-688.129] -- 0:00:06
899000 -- [-687.106] (-687.831) (-688.860) (-687.818) * [-688.281] (-687.947) (-685.187) (-685.092) -- 0:00:06
899500 -- (-686.168) (-686.987) (-686.822) [-686.173] * [-687.316] (-686.061) (-691.283) (-689.050) -- 0:00:06
900000 -- (-686.043) (-686.855) (-685.711) [-685.879] * [-687.699] (-687.500) (-686.652) (-685.597) -- 0:00:06
Average standard deviation of split frequencies: 0.010893
900500 -- [-686.661] (-684.490) (-685.323) (-685.544) * (-687.537) (-688.988) [-685.904] (-685.978) -- 0:00:05
901000 -- (-687.311) [-686.982] (-685.436) (-685.199) * (-685.547) [-687.791] (-685.515) (-686.160) -- 0:00:05
901500 -- [-687.406] (-685.103) (-688.809) (-685.665) * (-685.400) (-684.632) (-685.526) [-685.193] -- 0:00:05
902000 -- (-687.525) (-689.035) (-686.236) [-689.103] * (-686.550) (-684.629) [-685.304] (-685.251) -- 0:00:05
902500 -- [-688.799] (-685.050) (-685.232) (-690.088) * (-686.616) [-685.196] (-685.299) (-686.219) -- 0:00:05
903000 -- [-685.916] (-686.077) (-687.172) (-688.852) * [-687.988] (-685.541) (-686.404) (-691.702) -- 0:00:05
903500 -- [-686.826] (-685.784) (-686.659) (-687.497) * [-686.896] (-685.323) (-686.827) (-692.080) -- 0:00:05
904000 -- (-690.434) (-685.915) [-686.934] (-688.995) * (-689.285) (-686.249) (-686.338) [-686.526] -- 0:00:05
904500 -- (-691.087) (-687.160) (-686.106) [-686.948] * (-688.250) [-686.012] (-687.873) (-686.950) -- 0:00:05
905000 -- (-691.928) [-687.120] (-687.677) (-686.186) * (-687.065) (-689.181) [-690.076] (-688.793) -- 0:00:05
Average standard deviation of split frequencies: 0.010510
905500 -- (-688.281) (-687.412) [-687.758] (-688.310) * [-685.169] (-688.525) (-685.820) (-687.524) -- 0:00:05
906000 -- (-689.054) [-686.546] (-687.296) (-685.206) * [-687.749] (-690.348) (-689.571) (-690.803) -- 0:00:05
906500 -- (-686.563) [-689.364] (-690.496) (-687.787) * [-687.635] (-691.217) (-688.599) (-686.516) -- 0:00:05
907000 -- [-685.658] (-687.140) (-686.581) (-685.348) * (-685.655) (-686.446) [-688.551] (-687.605) -- 0:00:05
907500 -- (-688.445) (-690.419) (-693.272) [-685.348] * (-688.759) (-684.791) (-687.846) [-685.410] -- 0:00:05
908000 -- (-686.532) (-688.323) (-686.796) [-688.428] * (-686.337) [-685.089] (-685.957) (-687.672) -- 0:00:05
908500 -- (-689.447) [-686.550] (-689.854) (-687.982) * (-685.492) [-685.098] (-686.492) (-689.254) -- 0:00:05
909000 -- (-688.152) (-686.243) [-688.687] (-690.662) * (-686.685) (-685.391) [-685.107] (-686.604) -- 0:00:05
909500 -- [-686.518] (-686.616) (-686.238) (-686.939) * [-686.187] (-684.706) (-688.840) (-690.323) -- 0:00:05
910000 -- (-692.241) (-690.380) (-686.280) [-686.014] * (-685.717) (-687.488) [-689.325] (-694.334) -- 0:00:05
Average standard deviation of split frequencies: 0.010353
910500 -- (-686.501) (-686.790) [-685.096] (-688.083) * (-685.261) [-685.366] (-690.104) (-684.915) -- 0:00:05
911000 -- (-687.614) (-686.058) (-686.274) [-688.241] * (-687.707) [-686.375] (-687.111) (-687.307) -- 0:00:05
911500 -- [-685.546] (-691.498) (-687.088) (-689.987) * (-688.994) [-687.128] (-687.066) (-690.538) -- 0:00:05
912000 -- [-685.310] (-687.179) (-686.125) (-687.105) * (-687.577) (-687.595) (-686.726) [-685.599] -- 0:00:05
912500 -- (-686.137) (-691.894) (-689.166) [-687.428] * (-689.630) [-689.310] (-686.993) (-686.992) -- 0:00:05
913000 -- (-687.343) (-686.392) (-687.733) [-686.364] * [-687.994] (-688.171) (-687.538) (-686.914) -- 0:00:05
913500 -- [-689.116] (-685.558) (-687.551) (-685.058) * (-688.060) (-685.759) (-686.906) [-685.252] -- 0:00:05
914000 -- [-688.706] (-686.012) (-688.209) (-686.806) * [-686.938] (-688.264) (-687.488) (-685.843) -- 0:00:05
914500 -- [-686.910] (-688.363) (-685.765) (-689.529) * [-686.282] (-688.499) (-686.635) (-686.185) -- 0:00:05
915000 -- (-689.617) [-685.571] (-687.448) (-686.018) * [-684.797] (-684.887) (-685.424) (-685.921) -- 0:00:05
Average standard deviation of split frequencies: 0.010258
915500 -- (-686.170) [-686.291] (-686.245) (-686.101) * (-684.968) (-685.064) (-686.087) [-687.829] -- 0:00:05
916000 -- [-685.149] (-685.026) (-685.590) (-686.758) * (-685.486) [-685.802] (-689.155) (-688.021) -- 0:00:05
916500 -- [-686.271] (-686.309) (-684.775) (-686.011) * [-686.083] (-690.179) (-686.675) (-688.171) -- 0:00:05
917000 -- [-688.028] (-691.140) (-685.373) (-686.720) * (-686.608) (-686.405) [-686.264] (-686.177) -- 0:00:04
917500 -- (-687.291) (-686.787) (-684.946) [-686.560] * (-686.633) (-690.937) (-686.560) [-685.683] -- 0:00:04
918000 -- (-687.616) (-687.959) (-684.937) [-686.948] * (-685.450) [-687.800] (-684.820) (-687.587) -- 0:00:04
918500 -- (-686.877) [-685.927] (-685.692) (-689.119) * (-686.656) (-686.565) (-686.351) [-685.982] -- 0:00:04
919000 -- [-685.101] (-690.004) (-689.984) (-687.978) * (-685.486) (-689.070) [-684.901] (-688.237) -- 0:00:04
919500 -- (-685.514) (-687.132) [-685.459] (-686.975) * (-687.460) (-687.606) [-685.962] (-688.080) -- 0:00:04
920000 -- (-685.801) [-687.334] (-687.864) (-687.069) * (-687.904) [-686.751] (-687.599) (-689.473) -- 0:00:04
Average standard deviation of split frequencies: 0.010445
920500 -- (-687.805) (-686.178) (-688.936) [-687.136] * (-690.225) [-685.300] (-685.996) (-688.080) -- 0:00:04
921000 -- (-685.248) (-685.246) (-689.656) [-690.622] * (-685.213) (-685.041) (-685.980) [-686.880] -- 0:00:04
921500 -- [-687.318] (-684.826) (-686.566) (-688.120) * (-686.166) [-685.777] (-688.658) (-686.230) -- 0:00:04
922000 -- (-686.821) (-687.152) (-686.930) [-686.473] * (-688.551) [-685.942] (-690.117) (-688.887) -- 0:00:04
922500 -- (-685.300) (-685.362) [-685.786] (-688.496) * [-687.018] (-687.333) (-687.505) (-693.404) -- 0:00:04
923000 -- (-685.472) (-688.432) [-687.092] (-692.718) * (-689.737) (-688.471) [-685.380] (-686.111) -- 0:00:04
923500 -- [-688.023] (-685.855) (-686.124) (-694.106) * (-693.051) [-685.335] (-686.484) (-685.623) -- 0:00:04
924000 -- (-690.451) (-686.742) [-689.092] (-693.103) * (-686.403) (-685.351) [-686.493] (-687.929) -- 0:00:04
924500 -- (-688.336) [-686.566] (-686.935) (-685.000) * [-686.810] (-689.411) (-685.685) (-687.128) -- 0:00:04
925000 -- (-686.190) [-685.362] (-686.646) (-685.382) * (-686.479) (-691.783) [-685.907] (-688.067) -- 0:00:04
Average standard deviation of split frequencies: 0.010283
925500 -- [-687.343] (-687.198) (-686.990) (-687.479) * [-685.117] (-686.343) (-688.250) (-687.425) -- 0:00:04
926000 -- (-686.226) [-685.336] (-688.154) (-685.641) * (-685.064) (-686.460) [-687.295] (-688.544) -- 0:00:04
926500 -- (-686.304) (-685.586) [-686.882] (-685.400) * (-688.347) (-688.634) (-686.974) [-688.409] -- 0:00:04
927000 -- (-688.066) (-690.594) [-688.645] (-687.123) * [-685.251] (-689.485) (-685.068) (-687.114) -- 0:00:04
927500 -- (-684.916) (-691.908) [-684.615] (-686.458) * (-685.296) (-686.814) [-684.973] (-689.841) -- 0:00:04
928000 -- (-687.094) [-685.550] (-686.787) (-686.470) * (-686.390) (-686.051) [-686.358] (-687.666) -- 0:00:04
928500 -- [-686.973] (-685.233) (-686.205) (-686.102) * (-687.275) [-686.183] (-686.737) (-686.628) -- 0:00:04
929000 -- (-688.775) [-686.758] (-690.373) (-685.194) * (-688.053) (-687.109) (-691.314) [-690.433] -- 0:00:04
929500 -- (-687.275) (-690.435) (-697.982) [-687.537] * (-689.810) [-687.703] (-686.531) (-687.797) -- 0:00:04
930000 -- (-686.090) (-688.538) (-690.825) [-686.971] * (-685.826) (-686.475) (-687.970) [-687.349] -- 0:00:04
Average standard deviation of split frequencies: 0.010029
930500 -- (-686.464) [-691.661] (-686.514) (-687.050) * (-686.131) (-686.328) (-688.280) [-685.662] -- 0:00:04
931000 -- [-687.552] (-685.516) (-687.501) (-690.144) * (-690.115) (-687.442) (-689.064) [-686.196] -- 0:00:04
931500 -- (-689.196) [-689.008] (-686.816) (-685.729) * [-687.895] (-687.764) (-690.643) (-686.523) -- 0:00:04
932000 -- (-685.333) (-688.975) (-688.529) [-690.238] * [-687.656] (-691.053) (-686.115) (-687.547) -- 0:00:04
932500 -- (-685.223) [-687.353] (-686.830) (-686.962) * (-687.633) (-685.989) (-688.044) [-686.805] -- 0:00:04
933000 -- (-685.093) [-686.681] (-688.688) (-687.046) * [-687.484] (-685.664) (-690.729) (-686.473) -- 0:00:04
933500 -- (-686.558) (-686.397) [-685.243] (-689.110) * (-688.642) (-685.391) (-693.139) [-685.441] -- 0:00:03
934000 -- (-687.710) [-686.790] (-685.389) (-685.540) * [-686.006] (-685.876) (-684.920) (-685.181) -- 0:00:03
934500 -- (-689.379) (-688.513) (-688.295) [-686.239] * (-687.362) (-685.237) (-684.791) [-686.383] -- 0:00:03
935000 -- (-686.537) (-689.547) (-686.322) [-685.204] * [-686.546] (-686.514) (-685.794) (-685.582) -- 0:00:03
Average standard deviation of split frequencies: 0.010341
935500 -- (-686.668) (-689.114) [-686.831] (-688.426) * (-685.403) (-686.604) [-685.606] (-687.211) -- 0:00:03
936000 -- (-686.840) [-689.229] (-687.336) (-688.862) * (-685.919) (-685.327) [-686.246] (-687.321) -- 0:00:03
936500 -- (-685.626) (-692.154) (-686.479) [-687.160] * (-686.751) [-685.669] (-686.472) (-687.532) -- 0:00:03
937000 -- (-686.839) [-697.369] (-689.064) (-684.925) * [-686.282] (-686.167) (-685.276) (-689.507) -- 0:00:03
937500 -- [-687.423] (-688.361) (-689.151) (-685.549) * (-686.495) (-686.774) (-686.225) [-689.621] -- 0:00:03
938000 -- (-687.514) (-688.021) [-684.929] (-686.534) * [-685.020] (-690.225) (-685.788) (-687.633) -- 0:00:03
938500 -- [-685.558] (-685.934) (-686.400) (-688.841) * [-685.089] (-689.544) (-685.476) (-687.407) -- 0:00:03
939000 -- (-687.999) [-687.199] (-686.624) (-685.649) * (-685.032) [-687.328] (-688.951) (-687.984) -- 0:00:03
939500 -- (-685.414) (-686.570) [-686.072] (-686.991) * [-687.778] (-685.136) (-687.387) (-687.659) -- 0:00:03
940000 -- (-686.008) (-687.302) [-688.766] (-685.594) * [-687.888] (-689.243) (-688.133) (-687.687) -- 0:00:03
Average standard deviation of split frequencies: 0.010223
940500 -- (-685.569) (-686.311) (-689.736) [-685.974] * [-685.869] (-686.329) (-685.911) (-688.708) -- 0:00:03
941000 -- (-686.423) [-685.578] (-688.173) (-688.026) * (-688.713) [-686.743] (-688.198) (-687.146) -- 0:00:03
941500 -- (-686.419) [-686.648] (-688.742) (-688.137) * (-686.220) (-688.384) (-686.834) [-689.170] -- 0:00:03
942000 -- (-685.554) (-684.925) [-685.454] (-687.294) * (-691.025) (-691.091) [-688.325] (-690.785) -- 0:00:03
942500 -- (-687.617) (-686.427) [-684.683] (-685.676) * (-685.530) [-686.493] (-688.336) (-686.650) -- 0:00:03
943000 -- (-685.450) (-686.145) (-687.303) [-687.716] * (-686.084) (-688.154) (-689.418) [-687.765] -- 0:00:03
943500 -- (-688.814) (-687.303) (-685.581) [-688.848] * (-687.272) (-688.067) [-687.026] (-686.529) -- 0:00:03
944000 -- (-692.113) [-685.975] (-687.546) (-684.867) * [-686.503] (-688.763) (-686.769) (-687.523) -- 0:00:03
944500 -- (-690.860) (-687.626) [-686.519] (-685.707) * (-693.724) [-686.821] (-686.205) (-687.489) -- 0:00:03
945000 -- (-689.061) (-688.144) [-686.507] (-685.723) * [-684.881] (-685.665) (-686.932) (-685.338) -- 0:00:03
Average standard deviation of split frequencies: 0.009867
945500 -- (-691.614) [-690.003] (-686.592) (-688.644) * (-686.023) [-684.750] (-687.893) (-686.069) -- 0:00:03
946000 -- [-688.267] (-689.858) (-687.382) (-689.815) * [-685.041] (-686.202) (-686.942) (-685.017) -- 0:00:03
946500 -- [-686.910] (-690.371) (-685.466) (-689.173) * (-687.766) (-687.967) (-689.279) [-689.809] -- 0:00:03
947000 -- [-692.255] (-687.671) (-689.710) (-686.578) * (-685.918) (-685.581) (-691.905) [-687.690] -- 0:00:03
947500 -- (-686.509) (-687.289) [-685.539] (-686.843) * (-686.170) (-686.480) (-693.342) [-686.758] -- 0:00:03
948000 -- (-686.549) (-688.942) (-686.100) [-688.669] * [-689.690] (-685.838) (-687.839) (-685.903) -- 0:00:03
948500 -- (-688.572) [-688.103] (-686.889) (-687.526) * (-688.499) (-686.146) (-687.630) [-686.348] -- 0:00:03
949000 -- (-687.511) (-689.286) [-687.111] (-688.108) * (-688.013) [-687.264] (-685.268) (-685.027) -- 0:00:03
949500 -- [-686.511] (-688.346) (-688.458) (-687.239) * [-692.675] (-687.048) (-686.083) (-688.154) -- 0:00:03
950000 -- [-685.765] (-685.516) (-690.107) (-688.884) * (-691.040) [-685.823] (-690.163) (-685.977) -- 0:00:03
Average standard deviation of split frequencies: 0.009950
950500 -- [-687.564] (-685.879) (-689.074) (-688.583) * (-687.002) (-686.792) [-686.733] (-685.633) -- 0:00:02
951000 -- (-688.500) (-686.323) (-692.999) [-684.752] * (-691.071) (-689.282) (-686.890) [-685.411] -- 0:00:02
951500 -- [-686.316] (-688.685) (-685.728) (-684.821) * (-691.981) (-686.737) [-689.027] (-688.607) -- 0:00:02
952000 -- (-688.017) (-693.050) [-688.465] (-686.570) * (-689.987) (-689.406) (-687.908) [-688.784] -- 0:00:02
952500 -- (-685.998) (-690.048) (-687.051) [-685.838] * (-689.273) [-689.406] (-686.253) (-686.421) -- 0:00:02
953000 -- (-685.814) (-685.889) [-688.749] (-687.279) * (-689.579) (-687.200) [-685.647] (-689.346) -- 0:00:02
953500 -- (-685.288) (-692.740) (-686.319) [-689.973] * (-686.671) (-687.966) (-685.904) [-686.954] -- 0:00:02
954000 -- [-685.348] (-694.434) (-686.974) (-688.360) * (-688.997) (-686.860) [-684.828] (-688.442) -- 0:00:02
954500 -- (-690.667) (-685.706) (-686.696) [-689.788] * (-691.864) [-685.041] (-691.902) (-686.578) -- 0:00:02
955000 -- [-688.457] (-685.499) (-686.306) (-685.517) * (-687.219) (-686.186) [-689.316] (-690.186) -- 0:00:02
Average standard deviation of split frequencies: 0.010092
955500 -- (-691.278) (-687.491) [-688.823] (-685.110) * (-687.411) [-685.111] (-686.945) (-688.282) -- 0:00:02
956000 -- [-685.944] (-687.301) (-686.307) (-686.783) * (-687.913) (-685.464) [-686.144] (-687.348) -- 0:00:02
956500 -- [-687.174] (-687.787) (-691.628) (-684.915) * (-688.676) (-687.486) (-686.173) [-689.707] -- 0:00:02
957000 -- (-687.225) (-690.140) (-690.234) [-685.302] * (-687.791) (-687.446) [-684.742] (-685.612) -- 0:00:02
957500 -- (-687.431) (-685.348) [-693.943] (-685.756) * (-687.382) [-687.822] (-684.670) (-686.310) -- 0:00:02
958000 -- [-685.730] (-688.216) (-693.015) (-689.169) * (-685.433) [-686.030] (-686.483) (-686.460) -- 0:00:02
958500 -- (-687.500) (-686.187) (-686.550) [-686.736] * (-685.655) [-685.005] (-688.033) (-687.553) -- 0:00:02
959000 -- (-687.879) (-688.477) [-686.872] (-685.421) * (-689.787) [-688.780] (-685.591) (-690.728) -- 0:00:02
959500 -- [-688.497] (-687.045) (-688.507) (-685.594) * (-689.802) (-685.678) (-685.313) [-687.242] -- 0:00:02
960000 -- (-688.172) (-687.679) (-687.921) [-685.560] * [-685.557] (-685.888) (-689.873) (-687.990) -- 0:00:02
Average standard deviation of split frequencies: 0.010010
960500 -- (-688.247) (-686.631) [-686.920] (-685.286) * [-684.510] (-685.858) (-693.160) (-685.326) -- 0:00:02
961000 -- (-687.909) [-688.622] (-686.739) (-687.517) * [-685.575] (-688.202) (-686.454) (-685.485) -- 0:00:02
961500 -- (-687.510) (-686.526) [-685.697] (-687.960) * (-687.975) (-687.529) [-686.403] (-685.676) -- 0:00:02
962000 -- [-690.399] (-686.008) (-685.123) (-687.999) * [-688.394] (-689.726) (-689.641) (-687.173) -- 0:00:02
962500 -- [-686.264] (-685.220) (-686.329) (-692.795) * (-684.867) (-688.576) (-690.799) [-686.393] -- 0:00:02
963000 -- (-687.944) (-686.814) [-686.613] (-685.797) * (-685.897) (-686.889) [-688.010] (-688.420) -- 0:00:02
963500 -- (-686.957) (-687.838) (-686.213) [-686.402] * [-686.953] (-686.464) (-688.405) (-688.657) -- 0:00:02
964000 -- (-688.336) (-686.147) (-691.311) [-686.116] * (-686.298) (-688.078) (-687.032) [-691.282] -- 0:00:02
964500 -- (-688.596) (-685.097) (-688.275) [-686.498] * (-687.937) (-687.604) (-686.706) [-692.916] -- 0:00:02
965000 -- (-689.303) [-685.498] (-685.603) (-688.088) * [-686.648] (-690.990) (-687.834) (-687.298) -- 0:00:02
Average standard deviation of split frequencies: 0.010313
965500 -- (-685.624) [-689.954] (-687.990) (-690.550) * (-686.609) [-689.233] (-686.062) (-686.321) -- 0:00:02
966000 -- (-688.565) [-687.915] (-687.710) (-693.854) * (-688.170) [-685.710] (-687.608) (-687.191) -- 0:00:02
966500 -- (-686.423) (-685.161) [-685.857] (-686.108) * (-686.995) (-685.060) [-687.395] (-687.686) -- 0:00:02
967000 -- [-686.618] (-689.320) (-691.385) (-686.393) * (-686.954) [-687.692] (-687.649) (-687.907) -- 0:00:01
967500 -- (-684.920) [-686.196] (-689.300) (-688.101) * [-685.541] (-687.796) (-684.997) (-689.477) -- 0:00:01
968000 -- [-685.097] (-684.931) (-689.277) (-687.544) * (-685.735) (-685.902) (-687.515) [-687.857] -- 0:00:01
968500 -- [-686.404] (-685.883) (-686.628) (-692.094) * (-686.667) (-686.837) (-686.420) [-686.233] -- 0:00:01
969000 -- (-688.680) [-684.843] (-685.743) (-687.228) * [-687.580] (-687.617) (-685.938) (-686.204) -- 0:00:01
969500 -- [-687.429] (-688.008) (-686.515) (-686.521) * (-689.090) (-686.093) (-687.413) [-688.876] -- 0:00:01
970000 -- [-687.048] (-686.073) (-684.693) (-684.937) * [-684.780] (-689.162) (-688.843) (-684.923) -- 0:00:01
Average standard deviation of split frequencies: 0.010361
970500 -- [-687.555] (-686.246) (-685.559) (-686.230) * (-685.941) (-688.585) [-685.564] (-686.500) -- 0:00:01
971000 -- (-686.807) (-692.303) (-687.033) [-688.042] * [-685.793] (-690.177) (-686.760) (-686.892) -- 0:00:01
971500 -- (-685.841) (-686.947) [-689.316] (-689.895) * (-687.447) (-686.218) [-686.184] (-687.866) -- 0:00:01
972000 -- (-687.391) (-686.322) (-688.086) [-687.604] * (-688.048) [-687.623] (-685.382) (-688.118) -- 0:00:01
972500 -- (-686.767) [-685.524] (-685.772) (-691.096) * (-688.026) (-688.877) (-688.332) [-685.821] -- 0:00:01
973000 -- (-686.443) [-685.769] (-685.591) (-693.455) * (-686.795) (-685.388) (-686.569) [-684.943] -- 0:00:01
973500 -- [-686.155] (-687.724) (-688.181) (-698.170) * (-687.573) [-685.742] (-685.148) (-685.656) -- 0:00:01
974000 -- [-685.257] (-685.605) (-685.393) (-690.539) * (-684.623) (-685.581) (-689.295) [-687.245] -- 0:00:01
974500 -- (-686.912) (-687.022) (-685.700) [-686.998] * (-689.702) (-688.056) (-687.311) [-686.072] -- 0:00:01
975000 -- (-688.499) (-689.632) (-685.745) [-687.034] * (-692.498) (-686.582) [-685.881] (-687.639) -- 0:00:01
Average standard deviation of split frequencies: 0.010433
975500 -- (-685.847) (-685.678) [-689.324] (-689.681) * (-692.999) (-686.444) [-690.484] (-685.917) -- 0:00:01
976000 -- [-685.709] (-684.899) (-689.289) (-685.416) * (-687.677) [-687.329] (-687.474) (-688.567) -- 0:00:01
976500 -- (-685.872) [-685.940] (-688.181) (-686.890) * (-689.685) (-686.583) [-686.916] (-688.152) -- 0:00:01
977000 -- (-687.284) [-686.928] (-689.883) (-686.828) * (-686.935) (-686.109) [-686.830] (-687.989) -- 0:00:01
977500 -- [-687.765] (-685.399) (-688.864) (-687.505) * (-688.442) (-686.242) [-685.214] (-687.098) -- 0:00:01
978000 -- [-686.836] (-685.995) (-687.835) (-685.669) * [-690.610] (-687.176) (-686.441) (-686.434) -- 0:00:01
978500 -- [-689.434] (-687.831) (-685.862) (-686.547) * (-688.838) [-687.035] (-685.102) (-692.725) -- 0:00:01
979000 -- (-686.371) (-685.754) [-686.181] (-685.560) * (-686.869) (-687.084) [-686.213] (-689.339) -- 0:00:01
979500 -- (-690.490) [-687.015] (-686.863) (-685.919) * [-686.289] (-689.086) (-686.745) (-687.367) -- 0:00:01
980000 -- (-689.536) [-685.712] (-689.224) (-685.491) * (-686.921) (-694.459) [-687.930] (-690.416) -- 0:00:01
Average standard deviation of split frequencies: 0.010287
980500 -- [-685.540] (-687.454) (-685.707) (-685.509) * (-687.539) [-686.585] (-687.923) (-686.230) -- 0:00:01
981000 -- [-686.956] (-690.501) (-685.772) (-685.003) * [-685.522] (-684.588) (-686.713) (-691.127) -- 0:00:01
981500 -- [-686.319] (-687.680) (-686.253) (-685.556) * (-686.730) (-685.129) (-687.996) [-689.718] -- 0:00:01
982000 -- [-686.879] (-685.752) (-685.102) (-686.045) * (-686.191) [-686.133] (-689.956) (-689.739) -- 0:00:01
982500 -- (-686.260) [-685.659] (-687.034) (-685.855) * (-685.567) (-688.783) (-686.855) [-685.451] -- 0:00:01
983000 -- (-688.850) (-689.127) (-686.558) [-684.916] * (-685.567) [-689.191] (-686.001) (-689.873) -- 0:00:01
983500 -- (-686.217) (-685.764) [-689.168] (-689.442) * [-685.003] (-689.306) (-686.449) (-689.146) -- 0:00:00
984000 -- (-689.789) [-689.484] (-692.882) (-693.614) * (-686.645) [-687.280] (-687.118) (-686.409) -- 0:00:00
984500 -- (-686.867) (-686.275) [-686.452] (-689.095) * [-685.455] (-686.016) (-687.866) (-685.056) -- 0:00:00
985000 -- (-687.992) (-693.272) [-686.038] (-688.959) * (-685.638) (-685.788) (-687.092) [-688.302] -- 0:00:00
Average standard deviation of split frequencies: 0.010327
985500 -- [-685.366] (-685.595) (-689.927) (-686.402) * (-685.539) [-686.221] (-687.015) (-688.131) -- 0:00:00
986000 -- (-685.783) [-686.842] (-689.070) (-686.561) * (-687.716) (-687.276) (-686.514) [-686.381] -- 0:00:00
986500 -- (-686.767) (-686.341) [-688.568] (-685.196) * (-686.218) (-685.734) (-688.841) [-690.278] -- 0:00:00
987000 -- [-686.284] (-687.400) (-686.136) (-687.366) * (-685.207) [-687.016] (-689.358) (-694.760) -- 0:00:00
987500 -- (-686.612) (-699.050) [-686.000] (-687.279) * [-684.965] (-689.167) (-690.076) (-690.078) -- 0:00:00
988000 -- (-685.109) (-700.205) (-691.418) [-685.439] * (-685.322) (-688.581) [-685.257] (-685.251) -- 0:00:00
988500 -- (-686.536) [-686.869] (-685.947) (-691.423) * [-685.736] (-687.866) (-692.561) (-686.056) -- 0:00:00
989000 -- (-686.674) [-689.518] (-686.621) (-688.134) * (-688.107) (-687.371) (-685.526) [-687.042] -- 0:00:00
989500 -- [-688.119] (-692.578) (-686.958) (-686.077) * [-686.753] (-687.973) (-688.120) (-686.669) -- 0:00:00
990000 -- [-685.535] (-688.960) (-685.199) (-686.691) * (-686.328) (-687.260) [-686.083] (-685.746) -- 0:00:00
Average standard deviation of split frequencies: 0.010310
990500 -- (-688.139) (-687.557) (-689.297) [-684.873] * (-686.547) [-686.571] (-691.733) (-685.103) -- 0:00:00
991000 -- (-686.161) (-686.268) [-686.073] (-691.842) * (-688.184) (-686.769) (-691.268) [-685.136] -- 0:00:00
991500 -- (-686.673) [-686.729] (-686.486) (-688.522) * (-686.553) (-686.105) (-684.879) [-685.733] -- 0:00:00
992000 -- (-685.173) (-684.995) [-687.050] (-688.728) * [-687.692] (-686.123) (-685.886) (-690.248) -- 0:00:00
992500 -- (-687.472) (-688.705) (-686.553) [-688.280] * (-690.058) [-685.979] (-686.492) (-686.010) -- 0:00:00
993000 -- (-685.395) (-686.136) (-688.141) [-685.730] * (-685.192) [-686.987] (-695.233) (-688.027) -- 0:00:00
993500 -- [-686.672] (-686.664) (-689.241) (-688.345) * (-685.888) [-686.692] (-691.213) (-687.172) -- 0:00:00
994000 -- (-691.372) (-689.129) (-689.997) [-686.241] * (-685.657) (-686.361) (-686.448) [-689.226] -- 0:00:00
994500 -- [-688.913] (-686.926) (-688.547) (-685.126) * (-684.886) [-685.322] (-690.951) (-693.309) -- 0:00:00
995000 -- (-687.341) (-687.816) (-689.751) [-690.153] * (-686.564) [-685.110] (-691.128) (-688.790) -- 0:00:00
Average standard deviation of split frequencies: 0.010318
995500 -- [-685.334] (-685.462) (-690.849) (-688.162) * [-686.241] (-688.586) (-691.735) (-688.661) -- 0:00:00
996000 -- (-686.408) (-686.874) (-687.868) [-687.060] * (-685.677) (-689.096) [-687.513] (-688.263) -- 0:00:00
996500 -- [-686.716] (-687.250) (-686.514) (-687.356) * (-689.671) (-688.024) [-684.992] (-686.990) -- 0:00:00
997000 -- (-686.237) (-688.821) [-687.474] (-687.181) * (-687.806) (-685.843) [-685.138] (-686.626) -- 0:00:00
997500 -- [-687.631] (-685.004) (-685.121) (-689.127) * (-687.789) (-687.087) [-685.750] (-686.239) -- 0:00:00
998000 -- [-686.367] (-686.537) (-687.742) (-688.163) * (-686.291) [-686.583] (-688.046) (-685.728) -- 0:00:00
998500 -- [-686.221] (-690.456) (-684.987) (-687.948) * [-686.850] (-688.058) (-689.398) (-690.199) -- 0:00:00
999000 -- (-687.268) [-687.694] (-686.187) (-689.505) * [-686.799] (-686.023) (-687.855) (-685.850) -- 0:00:00
999500 -- (-687.038) (-691.497) [-687.447] (-685.507) * (-686.014) (-686.005) (-685.603) [-687.000] -- 0:00:00
1000000 -- [-685.822] (-689.319) (-687.995) (-685.280) * [-685.680] (-689.352) (-687.259) (-686.772) -- 0:00:00
Average standard deviation of split frequencies: 0.010395
Analysis completed in 60 seconds
Analysis used 58.73 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -684.42
Likelihood of best state for "cold" chain of run 2 was -684.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 62 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.7 % ( 26 %) Dirichlet(Pi{all})
31.9 % ( 32 %) Slider(Pi{all})
78.5 % ( 48 %) Multiplier(Alpha{1,2})
78.3 % ( 58 %) Multiplier(Alpha{3})
23.0 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.3 % ( 20 %) Dirichlet(Pi{all})
31.8 % ( 29 %) Slider(Pi{all})
78.8 % ( 52 %) Multiplier(Alpha{1,2})
78.1 % ( 52 %) Multiplier(Alpha{3})
23.0 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.3 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167073 0.82 0.67
3 | 166113 166681 0.84
4 | 166763 166991 166379
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166874 0.82 0.67
3 | 166673 166783 0.84
4 | 166473 166518 166679
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -685.94
| 2 |
| |
| 1 1 1 2 2|
| 2 12 1 |
| 1 1 2 1 1 2 2 2 2 |
| 2 2 22 2 2 2 2 1 21 |
| 1 1 1* 1 1 1 1 1*1 2 1 2 21111 2 1 |
|1 1 *2* 2 1 2 2 1 1 2 121 11 1|
| 1 1 1 212 2 2 2 1 2 1 2 * 1 22 |
|2 2 1 2 1 1 2 1 2 |
| 2 1 * 1 2 2 * 2 2 |
| 2 2 2 1 1 |
| 1 1 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -688.01
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -686.18 -690.35
2 -686.18 -690.26
--------------------------------------
TOTAL -686.18 -690.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891952 0.091791 0.356776 1.492926 0.856596 1414.68 1457.84 1.001
r(A<->C){all} 0.171706 0.019796 0.000012 0.460638 0.138939 252.87 274.37 1.000
r(A<->G){all} 0.164955 0.019044 0.000022 0.443564 0.130478 189.53 216.66 1.003
r(A<->T){all} 0.156423 0.017182 0.000057 0.416916 0.122704 246.16 248.48 1.003
r(C<->G){all} 0.173185 0.020650 0.000077 0.468124 0.134488 231.22 334.95 1.001
r(C<->T){all} 0.169615 0.019927 0.000115 0.450104 0.132268 192.71 209.87 1.000
r(G<->T){all} 0.164116 0.017980 0.000006 0.422795 0.132137 155.92 213.02 1.000
pi(A){all} 0.235326 0.000353 0.197574 0.270429 0.235118 1236.05 1287.37 1.000
pi(C){all} 0.311761 0.000424 0.273215 0.353232 0.311398 1274.22 1281.05 1.000
pi(G){all} 0.312892 0.000416 0.272551 0.351762 0.312475 1165.77 1235.09 1.000
pi(T){all} 0.140021 0.000243 0.110820 0.171722 0.139352 1492.57 1496.79 1.000
alpha{1,2} 0.420672 0.236706 0.000187 1.440990 0.240545 1287.36 1300.21 1.000
alpha{3} 0.437439 0.221145 0.000202 1.413727 0.286054 1270.69 1271.29 1.000
pinvar{all} 0.996897 0.000015 0.990073 0.999999 0.998095 829.42 979.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..**..
9 -- .*..*.
10 -- ..*.*.
11 -- ....**
12 -- .*.*..
13 -- ..****
14 -- .**.**
15 -- ...*.*
16 -- .****.
17 -- ..*..*
18 -- .***.*
19 -- .**...
20 -- .*.***
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.016959 0.140573 0.164557 2
8 449 0.149567 0.005182 0.145903 0.153231 2
9 442 0.147235 0.010364 0.139907 0.154564 2
10 437 0.145570 0.012719 0.136576 0.154564 2
11 435 0.144903 0.001413 0.143904 0.145903 2
12 433 0.144237 0.001413 0.143238 0.145237 2
13 428 0.142572 0.006595 0.137908 0.147235 2
14 427 0.142239 0.007066 0.137242 0.147235 2
15 423 0.140906 0.005182 0.137242 0.144570 2
16 422 0.140573 0.039572 0.112592 0.168554 2
17 420 0.139907 0.017901 0.127249 0.152565 2
18 419 0.139574 0.007066 0.134577 0.144570 2
19 415 0.138241 0.001413 0.137242 0.139241 2
20 412 0.137242 0.011306 0.129247 0.145237 2
21 393 0.130913 0.011777 0.122585 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098586 0.010006 0.000036 0.299373 0.067942 1.000 2
length{all}[2] 0.098234 0.009652 0.000001 0.294325 0.069028 1.000 2
length{all}[3] 0.097651 0.009601 0.000109 0.288251 0.068097 1.000 2
length{all}[4] 0.101175 0.010204 0.000097 0.313094 0.068887 1.000 2
length{all}[5] 0.100321 0.009325 0.000025 0.299445 0.071007 1.000 2
length{all}[6] 0.099519 0.009845 0.000000 0.301261 0.067695 1.000 2
length{all}[7] 0.101607 0.010890 0.000048 0.286056 0.075788 1.003 2
length{all}[8] 0.097555 0.009276 0.000073 0.292664 0.059235 0.998 2
length{all}[9] 0.100419 0.010274 0.001002 0.299953 0.072005 0.998 2
length{all}[10] 0.098649 0.009745 0.000009 0.295384 0.065712 0.998 2
length{all}[11] 0.094743 0.007839 0.000922 0.267545 0.069736 0.998 2
length{all}[12] 0.101121 0.011659 0.000749 0.276066 0.068872 0.998 2
length{all}[13] 0.102151 0.010209 0.000366 0.301784 0.072690 1.000 2
length{all}[14] 0.097180 0.008533 0.000144 0.284644 0.071154 0.999 2
length{all}[15] 0.097023 0.009319 0.000069 0.269777 0.070433 1.006 2
length{all}[16] 0.098689 0.010393 0.000309 0.287506 0.068345 0.998 2
length{all}[17] 0.100775 0.011561 0.000027 0.300918 0.064478 0.998 2
length{all}[18] 0.096145 0.009577 0.000099 0.295161 0.065683 1.009 2
length{all}[19] 0.097451 0.009408 0.000060 0.288246 0.069647 0.999 2
length{all}[20] 0.094009 0.010128 0.000043 0.261295 0.064067 0.999 2
length{all}[21] 0.105972 0.010987 0.000021 0.302017 0.071806 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010395
Maximum standard deviation of split frequencies = 0.039572
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 510
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 170 / 170 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 170 / 170 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104346 0.105711 0.098497 0.012735 0.079869 0.109287 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -737.686617
Iterating by ming2
Initial: fx= 737.686617
x= 0.10435 0.10571 0.09850 0.01273 0.07987 0.10929 0.30000 1.30000
1 h-m-p 0.0000 0.0001 402.3960 ++ 725.309477 m 0.0001 13 | 1/8
2 h-m-p 0.0002 0.0026 118.8404 ++ 700.564787 m 0.0026 24 | 2/8
3 h-m-p 0.0000 0.0002 156.9932 ++ 693.370998 m 0.0002 35 | 3/8
4 h-m-p 0.0002 0.0025 59.1124 ++ 659.937082 m 0.0025 46 | 4/8
5 h-m-p 0.0002 0.0008 58.8842 ++ 658.720866 m 0.0008 57 | 5/8
6 h-m-p 0.0000 0.0002 99.9051 ++ 657.483012 m 0.0002 68 | 6/8
7 h-m-p 0.0018 0.1970 8.3940 ------------.. | 6/8
8 h-m-p 0.0000 0.0002 165.1592 ++ 653.206535 m 0.0002 100 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 Y 653.206535 0 1.6000 111 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 -Y 653.206535 0 0.0010 124
Out..
lnL = -653.206535
125 lfun, 125 eigenQcodon, 750 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064536 0.058521 0.072482 0.098176 0.060060 0.092496 0.000100 0.695814 0.486168
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.880514
np = 9
lnL0 = -725.534286
Iterating by ming2
Initial: fx= 725.534286
x= 0.06454 0.05852 0.07248 0.09818 0.06006 0.09250 0.00011 0.69581 0.48617
1 h-m-p 0.0000 0.0000 386.6274 ++ 725.176375 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0007 340.5331 ++++ 668.678694 m 0.0007 28 | 2/9
3 h-m-p 0.0000 0.0000 1519354.6677 ++ 667.429797 m 0.0000 40 | 3/9
4 h-m-p 0.0001 0.0010 91.9352 ++ 662.380645 m 0.0010 52 | 4/9
5 h-m-p 0.0000 0.0000 1530.0044 ++ 657.712072 m 0.0000 64 | 5/9
6 h-m-p 0.0001 0.0005 245.9063 ++ 654.840104 m 0.0005 76 | 6/9
7 h-m-p 0.0088 1.2182 1.5248 -------------.. | 6/9
8 h-m-p 0.0000 0.0000 234.1854 ++ 653.631920 m 0.0000 111 | 7/9
9 h-m-p 0.0046 1.0446 0.7868 ------------.. | 7/9
10 h-m-p 0.0000 0.0000 166.7596 ++ 653.206561 m 0.0000 147 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 653.206561 m 8.0000 159 | 7/9
12 h-m-p 0.0000 0.0000 0.0001
h-m-p: 4.69002174e-14 2.34501087e-13 1.21737607e-04 653.206561
.. | 7/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 653.206560 m 8.0000 186 | 7/9
14 h-m-p 0.0077 3.8553 0.2037 +++++ 653.206540 m 3.8553 203 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 N 653.206540 0 1.6000 217 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 N 653.206540 0 0.0160 230
Out..
lnL = -653.206540
231 lfun, 693 eigenQcodon, 2772 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064127 0.108129 0.093195 0.014223 0.068874 0.078200 0.000100 0.933215 0.102077 0.488290 1.480020
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.012643
np = 11
lnL0 = -721.100530
Iterating by ming2
Initial: fx= 721.100530
x= 0.06413 0.10813 0.09320 0.01422 0.06887 0.07820 0.00011 0.93321 0.10208 0.48829 1.48002
1 h-m-p 0.0000 0.0000 374.1910 ++ 720.791212 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 241.2957 +++ 707.040602 m 0.0003 31 | 2/11
3 h-m-p 0.0002 0.0012 100.4401 ++ 669.935926 m 0.0012 45 | 3/11
4 h-m-p 0.0027 0.0136 27.4339 ++ 656.016752 m 0.0136 59 | 4/11
5 h-m-p 0.0000 0.0000 85562.8217 ++ 655.395652 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 153776.3523 ++ 655.015980 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0001 3167.4184 ++ 653.595322 m 0.0001 101 | 7/11
8 h-m-p 0.0160 8.0000 13.1240 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 166.7463 ++ 653.206559 m 0.0000 140 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 653.206559 m 8.0000 157 | 7/11
11 h-m-p 0.1635 8.0000 0.0002 +++ 653.206559 m 8.0000 175 | 7/11
12 h-m-p 0.0067 0.0335 0.0382 -------Y 653.206559 0 0.0000 200 | 7/11
13 h-m-p 0.0088 4.3900 0.0006 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 653.206559 m 8.0000 250 | 7/11
15 h-m-p 0.0059 2.9285 0.3791 +++++ 653.206539 m 2.9285 271 | 8/11
16 h-m-p 1.6000 8.0000 0.0519 ++ 653.206538 m 8.0000 289 | 8/11
17 h-m-p 0.0232 0.1162 9.0488 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0000 -----C 653.206538 0 0.0000 336
Out..
lnL = -653.206538
337 lfun, 1348 eigenQcodon, 6066 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -653.210445 S = -653.203373 -0.002704
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:03
did 20 / 49 patterns 0:03
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074627 0.059376 0.032324 0.096078 0.040671 0.092362 0.000100 0.915767 1.313873
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.829845
np = 9
lnL0 = -715.889388
Iterating by ming2
Initial: fx= 715.889388
x= 0.07463 0.05938 0.03232 0.09608 0.04067 0.09236 0.00011 0.91577 1.31387
1 h-m-p 0.0000 0.0000 369.3268 ++ 715.570179 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0200 45.8969 +++++ 687.647989 m 0.0200 29 | 2/9
3 h-m-p 0.0003 0.0013 73.1069 ++ 680.973483 m 0.0013 41 | 3/9
4 h-m-p 0.0000 0.0001 54.8669 ++ 678.563597 m 0.0001 53 | 4/9
5 h-m-p 0.0007 0.0124 8.4970 -----------.. | 4/9
6 h-m-p 0.0000 0.0001 323.6022 ++ 668.124587 m 0.0001 86 | 5/9
7 h-m-p 0.0187 8.0000 1.4628 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 283.2520 ++ 660.985279 m 0.0001 121 | 6/9
9 h-m-p 0.0178 8.0000 1.1346 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 233.2037 ++ 654.706541 m 0.0001 156 | 7/9
11 h-m-p 0.0231 8.0000 0.8104 -------------.. | 7/9
12 h-m-p 0.0000 0.0001 167.8751 ++ 653.206618 m 0.0001 193 | 8/9
13 h-m-p 0.7370 8.0000 0.0000 --N 653.206618 0 0.0115 207 | 7/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 653.206618 m 8.0000 223 | 7/9
15 h-m-p 0.0028 0.0141 0.0369 ------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 653.206618 m 8.0000 264 | 7/9
17 h-m-p 0.0160 8.0000 0.7609 +++++ 653.206541 m 8.0000 281 | 7/9
18 h-m-p 1.6000 8.0000 0.2332 ++ 653.206537 m 8.0000 295 | 7/9
19 h-m-p 0.5568 8.0000 3.3506 ++ 653.206526 m 8.0000 309 | 7/9
20 h-m-p 1.6000 8.0000 2.0945 ++ 653.206525 m 8.0000 321 | 7/9
21 h-m-p 0.8075 8.0000 20.7509 ++ 653.206523 m 8.0000 333 | 7/9
22 h-m-p 1.6000 8.0000 24.6748 ++ 653.206523 m 8.0000 345 | 7/9
23 h-m-p 1.6000 8.0000 16.0183 ++ 653.206523 m 8.0000 357 | 7/9
24 h-m-p 1.6000 8.0000 0.0000 N 653.206523 0 1.6000 369
Out..
lnL = -653.206523
370 lfun, 4070 eigenQcodon, 22200 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099647 0.043793 0.024658 0.102924 0.048248 0.065201 543.066822 0.900000 0.905004 1.926365 1.465353
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.052606
np = 11
lnL0 = -713.967316
Iterating by ming2
Initial: fx= 713.967316
x= 0.09965 0.04379 0.02466 0.10292 0.04825 0.06520 543.06682 0.90000 0.90500 1.92636 1.46535
1 h-m-p 0.0000 0.0002 362.6859 +++ 692.122839 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0011 133.9161 ++ 675.168185 m 0.0011 31 | 2/11
3 h-m-p 0.0000 0.0000 267213.9834 ++ 672.160564 m 0.0000 45 | 3/11
4 h-m-p 0.0006 0.0031 49.3803 ++ 670.177785 m 0.0031 59 | 4/11
5 h-m-p 0.0002 0.0010 218.0279 ++ 653.914734 m 0.0010 73 | 5/11
6 h-m-p 0.0006 0.0029 43.0281 ++ 653.206692 m 0.0029 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0008 ++ 653.206692 m 8.0000 101 | 6/11
8 h-m-p 0.0122 1.3107 0.5301 ---------C 653.206692 0 0.0000 129 | 6/11
9 h-m-p 0.0160 8.0000 0.0039 +++++ 653.206688 m 8.0000 151 | 6/11
10 h-m-p 0.0613 1.3017 0.5084 ------------Y 653.206688 0 0.0000 182 | 6/11
11 h-m-p 0.0160 8.0000 0.0007 +++++ 653.206688 m 8.0000 204 | 6/11
12 h-m-p 0.0123 1.5253 0.4406 -----------C 653.206688 0 0.0000 234 | 6/11
13 h-m-p 0.0160 8.0000 0.0001 -----Y 653.206688 0 0.0000 258 | 6/11
14 h-m-p 0.0160 8.0000 0.0013 +++++ 653.206687 m 8.0000 280 | 6/11
15 h-m-p 0.0062 0.7209 1.6126 ----------C 653.206687 0 0.0000 309 | 6/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 653.206687 m 8.0000 326 | 6/11
17 h-m-p 0.0160 8.0000 0.0731 +++++ 653.206663 m 8.0000 348 | 6/11
18 h-m-p 0.5093 2.5464 1.0912 --------------N 653.206663 0 0.0000 381 | 6/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 653.206663 m 8.0000 398 | 6/11
20 h-m-p 0.0070 3.4805 0.5252 -------------.. | 6/11
21 h-m-p 0.0160 8.0000 0.0002 +++++ 653.206662 m 8.0000 450 | 6/11
22 h-m-p 0.0063 2.9643 0.2729 ----------N 653.206662 0 0.0000 479 | 6/11
23 h-m-p 0.0002 0.1038 2.0192 +++++ 653.206589 m 0.1038 501 | 7/11
24 h-m-p 0.5213 8.0000 0.0760 ------------C 653.206589 0 0.0000 527 | 7/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 653.206589 m 8.0000 548 | 7/11
26 h-m-p 0.0160 8.0000 0.1958 +++++ 653.206576 m 8.0000 569 | 7/11
27 h-m-p 1.2306 8.0000 1.2727 ++ 653.206558 m 8.0000 587 | 7/11
28 h-m-p 1.6000 8.0000 1.1101 ++ 653.206555 m 8.0000 601 | 7/11
29 h-m-p 1.5559 8.0000 5.7076 ++ 653.206552 m 8.0000 615 | 7/11
30 h-m-p 1.0796 5.3980 5.7002 ++ 653.206551 m 5.3980 629 | 8/11
31 h-m-p 0.4710 8.0000 6.5559 ---------------N 653.206551 0 0.0000 658 | 8/11
32 h-m-p 0.0160 8.0000 0.0000 +Y 653.206551 0 0.1944 673 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 --------N 653.206551 0 0.0000 698
Out..
lnL = -653.206551
699 lfun, 8388 eigenQcodon, 46134 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -653.236351 S = -653.206551 -0.013139
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:20
did 20 / 49 patterns 0:20
did 30 / 49 patterns 0:20
did 40 / 49 patterns 0:21
did 49 / 49 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=170
NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
NC_002677_1_NP_302321_1_1193_rplQ MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
**************************************************
NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
NC_002677_1_NP_302321_1_1193_rplQ LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
**************************************************
NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
NC_002677_1_NP_302321_1_1193_rplQ EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
**************************************************
NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 VEATSDEVAYTSEPDKAAEH
NC_002677_1_NP_302321_1_1193_rplQ VEATSDEVAYTSEPDKAAEH
NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 VEATSDEVAYTSEPDKAAEH
NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 VEATSDEVAYTSEPDKAAEH
NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 VEATSDEVAYTSEPDKAAEH
NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 VEATSDEVAYTSEPDKAAEH
********************
>NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT >NC_002677_1_NP_302321_1_1193_rplQ ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT >NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT >NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT >NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT >NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC CGCCGAACAT
>NC_011896_1_WP_010908642_1_2088_MLBR_RS09915 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH >NC_002677_1_NP_302321_1_1193_rplQ MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH >NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH >NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH >NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH >NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040 MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE VEATSDEVAYTSEPDKAAEH
#NEXUS
[ID: 0845803344]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908642_1_2088_MLBR_RS09915
NC_002677_1_NP_302321_1_1193_rplQ
NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485
NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795
NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745
NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908642_1_2088_MLBR_RS09915,
2 NC_002677_1_NP_302321_1_1193_rplQ,
3 NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485,
4 NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795,
5 NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745,
6 NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0679416,2:0.0690284,3:0.06809741,4:0.06888695,5:0.071007,6:0.06769459);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0679416,2:0.0690284,3:0.06809741,4:0.06888695,5:0.071007,6:0.06769459);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -686.18 -690.35
2 -686.18 -690.26
--------------------------------------
TOTAL -686.18 -690.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891952 0.091791 0.356776 1.492926 0.856596 1414.68 1457.84 1.001
r(A<->C){all} 0.171706 0.019796 0.000012 0.460638 0.138939 252.87 274.37 1.000
r(A<->G){all} 0.164955 0.019044 0.000022 0.443564 0.130478 189.53 216.66 1.003
r(A<->T){all} 0.156423 0.017182 0.000057 0.416916 0.122704 246.16 248.48 1.003
r(C<->G){all} 0.173185 0.020650 0.000077 0.468124 0.134488 231.22 334.95 1.001
r(C<->T){all} 0.169615 0.019927 0.000115 0.450104 0.132268 192.71 209.87 1.000
r(G<->T){all} 0.164116 0.017980 0.000006 0.422795 0.132137 155.92 213.02 1.000
pi(A){all} 0.235326 0.000353 0.197574 0.270429 0.235118 1236.05 1287.37 1.000
pi(C){all} 0.311761 0.000424 0.273215 0.353232 0.311398 1274.22 1281.05 1.000
pi(G){all} 0.312892 0.000416 0.272551 0.351762 0.312475 1165.77 1235.09 1.000
pi(T){all} 0.140021 0.000243 0.110820 0.171722 0.139352 1492.57 1496.79 1.000
alpha{1,2} 0.420672 0.236706 0.000187 1.440990 0.240545 1287.36 1300.21 1.000
alpha{3} 0.437439 0.221145 0.000202 1.413727 0.286054 1270.69 1271.29 1.000
pinvar{all} 0.996897 0.000015 0.990073 0.999999 0.998095 829.42 979.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplQ/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 170
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 3 3 3 3 3 3
CTG 7 7 7 7 7 7 | CCG 3 3 3 3 3 3 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 5 5 5 5 5 5 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 14 14 14 14 14 14 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 5 5 5 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 3 | GCC 13 13 13 13 13 13 | GAC 5 5 5 5 5 5 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 5 5 5 5 5 5 | GCG 7 7 7 7 7 7 | GAG 14 14 14 14 14 14 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908642_1_2088_MLBR_RS09915
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
#2: NC_002677_1_NP_302321_1_1193_rplQ
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
#3: NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
#4: NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
#5: NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
#6: NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 12 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 24
CTC 12 | CCC 18 | CAC 30 | CGC 18
CTA 12 | CCA 12 | Gln Q CAA 18 | CGA 18
CTG 42 | CCG 18 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 18 | ACC 30 | AAC 18 | AGC 6
ATA 12 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 30 | AAG 84 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 30 | Asp D GAT 18 | Gly G GGT 12
GTC 18 | GCC 78 | GAC 30 | GGC 30
GTA 6 | GCA 6 | Glu E GAA 18 | GGA 6
GTG 30 | GCG 42 | GAG 84 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08824 C:0.26471 A:0.23529 G:0.41176
position 2: T:0.20000 C:0.32353 A:0.34118 G:0.13529
position 3: T:0.12941 C:0.34706 A:0.12941 G:0.39412
Average T:0.13922 C:0.31176 A:0.23529 G:0.31373
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -653.206535 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.465353
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908642_1_2088_MLBR_RS09915: 0.000004, NC_002677_1_NP_302321_1_1193_rplQ: 0.000004, NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485: 0.000004, NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795: 0.000004, NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745: 0.000004, NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.46535
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
7..2 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
7..3 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
7..4 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
7..5 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
7..6 0.000 414.4 95.6 1.4654 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -653.206540 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.431004
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908642_1_2088_MLBR_RS09915: 0.000004, NC_002677_1_NP_302321_1_1193_rplQ: 0.000004, NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485: 0.000004, NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795: 0.000004, NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745: 0.000004, NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.43100 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 414.4 95.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -653.206538 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.450152 0.307884 1.000000 1.597880
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908642_1_2088_MLBR_RS09915: 0.000004, NC_002677_1_NP_302321_1_1193_rplQ: 0.000004, NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485: 0.000004, NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795: 0.000004, NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745: 0.000004, NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.45015 0.30788 0.24196
w: 1.00000 1.00000 1.59788
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
7..2 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
7..3 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
7..4 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
7..5 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
7..6 0.000 414.4 95.6 1.1447 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908642_1_2088_MLBR_RS09915)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908642_1_2088_MLBR_RS09915)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -653.206523 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 543.066822 0.005000 1.361379
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908642_1_2088_MLBR_RS09915: 0.000004, NC_002677_1_NP_302321_1_1193_rplQ: 0.000004, NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485: 0.000004, NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795: 0.000004, NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745: 0.000004, NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 543.06682
Parameters in M7 (beta):
p = 0.00500 q = 1.36138
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 364.1 145.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -653.206551 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 550.872558 0.999990 5.244913 99.000000 5.353552
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908642_1_2088_MLBR_RS09915: 0.000004, NC_002677_1_NP_302321_1_1193_rplQ: 0.000004, NZ_LVXE01000050_1_WP_010908642_1_2125_A3216_RS11485: 0.000004, NZ_LYPH01000079_1_WP_010908642_1_2658_A8144_RS12795: 0.000004, NZ_CP029543_1_WP_010908642_1_2110_DIJ64_RS10745: 0.000004, NZ_AP014567_1_WP_010908642_1_2169_JK2ML_RS11040: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 550.87256
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 5.24491 q = 99.00000
(p1 = 0.00001) w = 5.35355
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.02079 0.02897 0.03475 0.03988 0.04489 0.05011 0.05589 0.06280 0.07214 0.08960 5.35355
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
7..2 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
7..3 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
7..4 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
7..5 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
7..6 0.000 364.1 145.9 0.0500 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908642_1_2088_MLBR_RS09915)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:21
Model 1: NearlyNeutral -653.20654 Model 2: PositiveSelection -653.206538 Model 0: one-ratio -653.206535 Model 7: beta -653.206523 Model 8: beta&w>1 -653.206551 Model 0 vs 1 9.999999974752427E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.600000008598727E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
