--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:41:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplQ/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -686.18          -690.35
2       -686.18          -690.26
--------------------------------------
TOTAL     -686.18          -690.31
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.891952    0.091791    0.356776    1.492926    0.856596   1414.68   1457.84    1.001
r(A<->C){all}   0.171706    0.019796    0.000012    0.460638    0.138939    252.87    274.37    1.000
r(A<->G){all}   0.164955    0.019044    0.000022    0.443564    0.130478    189.53    216.66    1.003
r(A<->T){all}   0.156423    0.017182    0.000057    0.416916    0.122704    246.16    248.48    1.003
r(C<->G){all}   0.173185    0.020650    0.000077    0.468124    0.134488    231.22    334.95    1.001
r(C<->T){all}   0.169615    0.019927    0.000115    0.450104    0.132268    192.71    209.87    1.000
r(G<->T){all}   0.164116    0.017980    0.000006    0.422795    0.132137    155.92    213.02    1.000
pi(A){all}      0.235326    0.000353    0.197574    0.270429    0.235118   1236.05   1287.37    1.000
pi(C){all}      0.311761    0.000424    0.273215    0.353232    0.311398   1274.22   1281.05    1.000
pi(G){all}      0.312892    0.000416    0.272551    0.351762    0.312475   1165.77   1235.09    1.000
pi(T){all}      0.140021    0.000243    0.110820    0.171722    0.139352   1492.57   1496.79    1.000
alpha{1,2}      0.420672    0.236706    0.000187    1.440990    0.240545   1287.36   1300.21    1.000
alpha{3}        0.437439    0.221145    0.000202    1.413727    0.286054   1270.69   1271.29    1.000
pinvar{all}     0.996897    0.000015    0.990073    0.999999    0.998095    829.42    979.15    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-653.20654
Model 2: PositiveSelection	-653.206538
Model 0: one-ratio	-653.206535
Model 7: beta	-653.206523
Model 8: beta&w>1	-653.206551


Model 0 vs 1	9.999999974752427E-6

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	5.600000008598727E-5
>C1
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C2
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C3
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C4
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C5
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C6
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=170 

C1              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C2              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C3              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C4              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C5              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C6              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
                **************************************************

C1              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C2              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C3              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C4              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C5              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C6              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
                **************************************************

C1              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C2              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C3              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C4              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C5              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C6              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
                **************************************************

C1              VEATSDEVAYTSEPDKAAEH
C2              VEATSDEVAYTSEPDKAAEH
C3              VEATSDEVAYTSEPDKAAEH
C4              VEATSDEVAYTSEPDKAAEH
C5              VEATSDEVAYTSEPDKAAEH
C6              VEATSDEVAYTSEPDKAAEH
                ********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  170 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  170 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5100]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5100]--->[5100]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.472 Mb, Max= 30.708 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C2              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C3              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C4              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C5              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
C6              MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
                **************************************************

C1              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C2              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C3              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C4              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C5              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
C6              LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
                **************************************************

C1              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C2              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C3              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C4              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C5              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
C6              EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
                **************************************************

C1              VEATSDEVAYTSEPDKAAEH
C2              VEATSDEVAYTSEPDKAAEH
C3              VEATSDEVAYTSEPDKAAEH
C4              VEATSDEVAYTSEPDKAAEH
C5              VEATSDEVAYTSEPDKAAEH
C6              VEATSDEVAYTSEPDKAAEH
                ********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C2              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C3              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C4              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C5              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
C6              ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
                **************************************************

C1              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C2              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C3              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C4              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C5              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
C6              AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
                **************************************************

C1              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C2              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C3              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C4              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C5              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
C6              TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
                **************************************************

C1              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C2              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C3              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C4              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C5              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
C6              CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
                **************************************************

C1              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C2              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C3              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C4              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C5              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
C6              GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
                **************************************************

C1              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C2              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C3              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C4              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C5              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
C6              GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
                **************************************************

C1              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C2              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C3              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C4              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C5              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
C6              GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
                **************************************************

C1              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C2              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C3              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C4              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C5              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
C6              GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
                **************************************************

C1              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C2              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C3              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C4              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C5              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
C6              CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
                **************************************************

C1              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C2              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C3              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C4              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C5              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
C6              GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
                **************************************************

C1              CGCCGAACAT
C2              CGCCGAACAT
C3              CGCCGAACAT
C4              CGCCGAACAT
C5              CGCCGAACAT
C6              CGCCGAACAT
                **********



>C1
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C2
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C3
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C4
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C5
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C6
ATGCCCAAGCCCACCAAGGGCCCTCGCCTCGGTGGCTCGTCTTCGCACCA
AAAGGCCCTTCTGACCAACCTGGCCGCGTCGCTGTTCGAGCACGGCCGGA
TCAAGACGACCGAGCCAAAGGCTCGTGCGCTGCGGCCGTATGCGGAGAAG
CTAATAACGCACGCGAAAAAGGGCACACTGCACAACCGTCGAGAGGTCCT
GAAAAAGCTCCCCGACAAGGATGTGGTGCACGCCCTGTTCGCGGAGATCG
GGCCATTCTTCTCCGATCGCGATGGCGGATACACCCGTATTATAAAGGTC
GAGGCGCGTAAGGGTGACAACGCTCCGATGGCTGTGATCGAACTAGTGCG
GGAGAAGACGGTAACGTCCGAGGCCGACCGAGCCCGCCGAGTTGCCGCCG
CTTCGGCCAAAGCAGCGCAGGCCCAAGAGAAGCCGGCTCAAGAGGAGGAG
GTCGAAGCCACGTCGGACGAGGTGGCCTACACCAGCGAGCCTGACAAGGC
CGCCGAACAT
>C1
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C2
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C3
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C4
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C5
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH
>C6
MPKPTKGPRLGGSSSHQKALLTNLAASLFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVLKKLPDKDVVHALFAEIGPFFSDRDGGYTRIIKV
EARKGDNAPMAVIELVREKTVTSEADRARRVAAASAKAAQAQEKPAQEEE
VEATSDEVAYTSEPDKAAEH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 510 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790407
      Setting output file names to "/data/11res/rplQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1489751643
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0845803344
      Seed = 345399571
      Swapseed = 1579790407
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1141.404454 -- -24.965149
         Chain 2 -- -1141.404279 -- -24.965149
         Chain 3 -- -1141.404279 -- -24.965149
         Chain 4 -- -1141.404454 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1141.404389 -- -24.965149
         Chain 2 -- -1141.404279 -- -24.965149
         Chain 3 -- -1141.404454 -- -24.965149
         Chain 4 -- -1141.404279 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1141.404] (-1141.404) (-1141.404) (-1141.404) * [-1141.404] (-1141.404) (-1141.404) (-1141.404) 
        500 -- [-692.640] (-704.746) (-703.376) (-712.773) * [-702.750] (-703.885) (-701.329) (-715.571) -- 0:00:00
       1000 -- [-692.553] (-694.909) (-701.686) (-702.684) * [-694.004] (-696.014) (-691.130) (-704.375) -- 0:00:00
       1500 -- (-697.978) [-688.543] (-693.685) (-693.017) * [-691.684] (-697.738) (-690.702) (-700.540) -- 0:00:00
       2000 -- [-693.913] (-695.144) (-695.334) (-695.685) * [-699.520] (-693.069) (-692.661) (-696.038) -- 0:00:00
       2500 -- [-694.590] (-697.318) (-697.686) (-692.961) * (-695.025) [-693.202] (-694.117) (-693.633) -- 0:00:00
       3000 -- (-705.102) [-692.798] (-694.526) (-693.815) * (-696.130) (-699.547) [-694.471] (-700.182) -- 0:00:00
       3500 -- (-698.093) (-697.213) (-690.422) [-696.521] * (-693.763) [-694.763] (-694.970) (-692.713) -- 0:00:00
       4000 -- (-694.853) (-695.008) (-690.376) [-693.768] * (-701.098) (-699.190) [-689.668] (-695.543) -- 0:00:00
       4500 -- [-694.907] (-692.295) (-691.579) (-695.743) * (-697.538) [-694.098] (-696.595) (-694.828) -- 0:00:00
       5000 -- (-693.983) [-692.994] (-694.170) (-693.056) * (-700.597) [-692.058] (-699.123) (-690.774) -- 0:00:00

      Average standard deviation of split frequencies: 0.092852

       5500 -- (-697.876) [-691.184] (-699.855) (-703.222) * (-692.133) [-693.826] (-692.908) (-686.032) -- 0:00:00
       6000 -- (-703.054) (-700.157) (-696.783) [-696.696] * (-704.279) [-692.602] (-691.422) (-687.561) -- 0:00:00
       6500 -- (-705.086) (-697.757) [-693.635] (-689.312) * [-692.722] (-694.109) (-692.818) (-685.783) -- 0:02:32
       7000 -- (-699.610) [-699.251] (-704.170) (-696.343) * (-699.855) [-698.393] (-693.257) (-686.855) -- 0:02:21
       7500 -- (-699.908) (-701.891) [-700.364] (-695.211) * [-689.262] (-696.688) (-696.018) (-690.722) -- 0:02:12
       8000 -- (-699.340) (-708.608) [-689.663] (-692.597) * (-692.008) [-686.368] (-694.118) (-686.529) -- 0:02:04
       8500 -- (-702.061) (-697.973) [-691.377] (-692.995) * (-701.102) (-686.391) [-702.409] (-686.644) -- 0:01:56
       9000 -- (-702.061) [-692.613] (-698.544) (-695.487) * (-706.803) (-687.519) (-696.902) [-685.541] -- 0:01:50
       9500 -- (-695.534) (-702.919) (-699.222) [-691.776] * (-700.446) (-688.467) [-698.818] (-691.543) -- 0:01:44
      10000 -- (-698.107) (-697.668) [-704.481] (-689.705) * [-693.750] (-694.906) (-692.935) (-687.824) -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- (-694.445) (-709.149) (-697.449) [-690.758] * (-694.067) (-693.425) (-694.042) [-687.672] -- 0:01:34
      11000 -- (-699.321) [-691.409] (-719.010) (-692.163) * (-711.381) (-686.027) [-697.748] (-686.831) -- 0:01:29
      11500 -- (-693.645) (-690.647) (-706.945) [-696.912] * [-693.397] (-685.361) (-703.816) (-687.503) -- 0:01:25
      12000 -- [-699.279] (-690.085) (-693.790) (-692.683) * [-695.739] (-685.848) (-703.153) (-687.063) -- 0:01:22
      12500 -- [-692.382] (-701.396) (-691.367) (-693.845) * (-694.191) (-687.457) (-692.854) [-685.244] -- 0:01:19
      13000 -- [-700.972] (-714.093) (-685.645) (-692.899) * (-694.644) (-685.732) [-700.773] (-685.363) -- 0:01:15
      13500 -- (-702.050) (-695.780) (-685.829) [-698.580] * (-699.447) (-685.727) [-697.800] (-685.343) -- 0:01:13
      14000 -- (-692.827) (-691.514) [-689.276] (-692.456) * (-688.424) (-691.393) [-691.295] (-686.573) -- 0:01:10
      14500 -- (-698.954) [-688.909] (-684.875) (-694.219) * (-699.754) [-687.433] (-700.476) (-687.059) -- 0:01:07
      15000 -- (-693.908) (-685.862) (-688.101) [-692.032] * (-698.145) (-687.115) [-693.213] (-686.492) -- 0:01:05

      Average standard deviation of split frequencies: 0.079084

      15500 -- (-697.126) [-685.100] (-687.651) (-693.914) * (-697.326) [-687.155] (-694.018) (-686.584) -- 0:01:03
      16000 -- (-705.309) (-685.477) (-688.072) [-695.338] * (-694.111) (-685.710) [-690.945] (-686.859) -- 0:01:01
      16500 -- (-700.936) (-686.548) [-684.908] (-694.492) * (-691.990) [-687.140] (-696.753) (-687.878) -- 0:00:59
      17000 -- [-692.665] (-689.071) (-691.166) (-711.583) * (-693.141) (-685.039) [-701.120] (-705.066) -- 0:00:57
      17500 -- (-697.520) (-687.602) (-688.107) [-696.094] * (-694.709) (-685.110) [-693.494] (-691.298) -- 0:00:56
      18000 -- (-694.036) (-685.947) (-687.207) [-694.600] * [-696.428] (-685.602) (-691.760) (-688.013) -- 0:00:54
      18500 -- (-698.214) [-686.442] (-685.067) (-698.719) * (-693.602) (-686.700) [-697.283] (-686.214) -- 0:00:53
      19000 -- (-692.160) (-685.091) [-686.016] (-697.161) * (-693.883) (-685.597) (-696.683) [-686.202] -- 0:00:51
      19500 -- [-691.668] (-685.433) (-686.861) (-694.657) * (-694.252) (-685.711) [-697.018] (-688.478) -- 0:00:50
      20000 -- (-695.857) (-687.129) (-689.364) [-692.908] * (-702.584) (-687.256) (-695.178) [-688.494] -- 0:00:49

      Average standard deviation of split frequencies: 0.070964

      20500 -- (-698.120) (-686.095) (-686.453) [-708.494] * [-701.587] (-686.878) (-690.771) (-688.422) -- 0:00:47
      21000 -- (-695.376) [-687.369] (-691.313) (-702.495) * (-697.824) [-690.987] (-693.356) (-688.199) -- 0:00:46
      21500 -- (-704.097) (-688.256) (-687.597) [-695.565] * (-696.661) [-688.777] (-698.728) (-687.028) -- 0:00:45
      22000 -- [-693.532] (-688.637) (-685.774) (-697.214) * (-697.902) [-686.417] (-695.401) (-686.866) -- 0:00:44
      22500 -- (-696.074) (-692.644) (-687.119) [-694.750] * (-696.962) (-691.432) (-690.423) [-685.700] -- 0:01:26
      23000 -- (-705.144) (-687.188) [-687.480] (-693.394) * [-693.650] (-687.076) (-703.136) (-687.505) -- 0:01:24
      23500 -- (-699.666) [-686.013] (-687.796) (-701.752) * (-692.233) [-684.899] (-703.489) (-685.280) -- 0:01:23
      24000 -- (-693.561) (-686.506) [-689.782] (-700.850) * (-690.822) (-690.800) (-696.632) [-685.122] -- 0:01:21
      24500 -- (-688.362) (-687.633) [-685.238] (-692.472) * [-691.795] (-689.254) (-698.165) (-685.948) -- 0:01:19
      25000 -- (-687.517) (-687.944) [-687.145] (-699.856) * [-698.216] (-687.067) (-696.638) (-686.825) -- 0:01:18

      Average standard deviation of split frequencies: 0.066178

      25500 -- (-686.635) [-687.412] (-687.202) (-694.162) * (-696.108) [-685.129] (-703.314) (-690.577) -- 0:01:16
      26000 -- (-685.971) (-689.487) (-688.609) [-695.134] * [-695.318] (-686.572) (-713.479) (-687.145) -- 0:01:14
      26500 -- [-688.510] (-686.029) (-685.588) (-700.238) * (-707.867) (-686.719) (-687.970) [-686.280] -- 0:01:13
      27000 -- (-691.086) (-688.978) [-685.675] (-695.992) * (-702.329) [-685.107] (-687.488) (-685.972) -- 0:01:12
      27500 -- (-686.974) [-685.522] (-686.496) (-703.115) * [-691.549] (-685.354) (-687.509) (-687.502) -- 0:01:10
      28000 -- (-690.410) (-686.475) [-685.225] (-693.658) * (-701.626) (-687.122) (-688.741) [-685.865] -- 0:01:09
      28500 -- [-685.718] (-686.930) (-684.971) (-700.651) * [-694.756] (-689.236) (-688.244) (-686.475) -- 0:01:08
      29000 -- (-690.290) (-689.983) [-684.848] (-701.068) * (-694.009) [-685.503] (-685.816) (-685.640) -- 0:01:06
      29500 -- (-687.512) (-687.712) (-686.539) [-696.951] * (-690.292) [-686.826] (-686.331) (-687.851) -- 0:01:05
      30000 -- (-688.422) [-690.692] (-687.683) (-694.721) * [-691.790] (-685.965) (-685.111) (-689.343) -- 0:01:04

      Average standard deviation of split frequencies: 0.057096

      30500 -- (-686.872) (-686.830) (-690.624) [-690.569] * (-703.493) (-688.679) (-693.149) [-689.190] -- 0:01:03
      31000 -- [-692.566] (-686.852) (-687.888) (-703.070) * (-704.052) (-686.568) [-688.012] (-689.674) -- 0:01:02
      31500 -- [-687.027] (-687.347) (-687.863) (-702.033) * (-699.849) [-685.995] (-687.203) (-685.710) -- 0:01:01
      32000 -- (-687.452) (-686.339) [-685.874] (-705.281) * (-695.359) [-687.138] (-685.312) (-689.036) -- 0:01:00
      32500 -- [-684.860] (-685.903) (-687.479) (-692.147) * (-695.957) (-686.365) (-690.105) [-688.150] -- 0:00:59
      33000 -- [-685.849] (-689.913) (-686.459) (-694.184) * (-697.180) [-687.988] (-689.200) (-686.245) -- 0:00:58
      33500 -- (-686.492) [-686.187] (-688.024) (-704.065) * (-702.626) [-688.525] (-686.498) (-688.153) -- 0:00:57
      34000 -- (-690.339) [-687.685] (-691.125) (-687.955) * (-692.579) (-688.393) (-693.232) [-686.475] -- 0:00:56
      34500 -- (-688.152) (-691.099) (-686.350) [-695.612] * (-700.173) (-685.343) (-685.759) [-689.132] -- 0:00:55
      35000 -- (-690.029) [-685.527] (-687.277) (-705.506) * [-693.654] (-686.763) (-687.056) (-686.760) -- 0:00:55

      Average standard deviation of split frequencies: 0.047140

      35500 -- (-691.288) (-687.844) (-687.569) [-696.465] * (-695.028) [-687.316] (-686.866) (-689.115) -- 0:00:54
      36000 -- (-693.721) [-686.726] (-686.016) (-692.342) * (-696.627) [-685.915] (-685.538) (-685.753) -- 0:00:53
      36500 -- [-687.424] (-688.313) (-686.514) (-687.878) * [-692.862] (-685.627) (-686.673) (-688.288) -- 0:00:52
      37000 -- (-687.727) (-695.407) (-687.272) [-687.457] * (-703.629) (-686.093) (-685.776) [-686.373] -- 0:00:52
      37500 -- (-686.326) (-685.661) [-684.996] (-688.264) * (-695.267) [-686.091] (-686.613) (-686.108) -- 0:00:51
      38000 -- (-686.326) [-686.384] (-687.288) (-687.452) * (-700.973) [-685.132] (-689.013) (-686.164) -- 0:00:50
      38500 -- (-687.122) (-685.415) (-689.341) [-687.805] * (-697.178) (-687.365) [-685.943] (-686.935) -- 0:01:14
      39000 -- (-686.542) [-685.550] (-687.443) (-686.590) * [-690.889] (-687.763) (-686.558) (-688.813) -- 0:01:13
      39500 -- (-687.557) [-684.859] (-687.217) (-691.674) * [-690.536] (-685.559) (-689.795) (-685.645) -- 0:01:12
      40000 -- (-686.410) (-684.896) [-687.001] (-689.249) * (-695.122) [-685.474] (-688.815) (-686.554) -- 0:01:12

      Average standard deviation of split frequencies: 0.042097

      40500 -- [-685.316] (-688.712) (-685.740) (-686.539) * (-692.928) [-685.856] (-686.347) (-687.061) -- 0:01:11
      41000 -- [-685.029] (-687.135) (-686.242) (-686.598) * [-699.289] (-685.854) (-687.643) (-685.366) -- 0:01:10
      41500 -- (-685.592) (-685.624) (-689.166) [-685.443] * (-692.415) (-687.075) [-685.309] (-687.818) -- 0:01:09
      42000 -- [-691.483] (-686.547) (-686.765) (-686.901) * (-700.346) [-686.604] (-685.971) (-685.849) -- 0:01:08
      42500 -- (-687.641) (-685.909) [-685.067] (-685.151) * (-687.848) (-687.507) [-685.199] (-685.851) -- 0:01:07
      43000 -- (-688.471) (-687.539) (-688.393) [-687.362] * (-691.036) (-689.822) [-687.199] (-686.649) -- 0:01:06
      43500 -- (-687.248) (-687.562) [-686.214] (-686.804) * (-685.828) (-689.837) (-688.507) [-689.407] -- 0:01:05
      44000 -- (-685.762) (-689.134) (-685.453) [-688.256] * [-686.311] (-690.922) (-687.230) (-685.782) -- 0:01:05
      44500 -- [-686.131] (-686.462) (-685.164) (-690.902) * (-685.579) (-690.925) [-686.401] (-686.371) -- 0:01:04
      45000 -- (-686.041) (-688.573) [-686.123] (-693.768) * (-685.666) [-687.598] (-689.102) (-686.967) -- 0:01:03

      Average standard deviation of split frequencies: 0.033073

      45500 -- (-685.788) (-687.367) (-695.846) [-690.421] * (-689.163) (-689.201) (-686.963) [-685.076] -- 0:01:02
      46000 -- [-685.167] (-688.039) (-692.826) (-685.646) * (-693.938) [-687.227] (-686.650) (-687.544) -- 0:01:02
      46500 -- (-687.499) [-687.186] (-685.881) (-688.522) * (-689.752) (-690.943) [-688.451] (-687.584) -- 0:01:01
      47000 -- (-686.830) [-685.746] (-685.187) (-689.539) * (-686.661) (-686.820) [-685.019] (-686.006) -- 0:01:00
      47500 -- (-691.441) (-685.590) [-685.089] (-687.864) * (-689.150) (-685.270) (-687.639) [-686.390] -- 0:01:00
      48000 -- [-686.644] (-688.127) (-685.681) (-689.940) * (-689.284) [-686.901] (-691.477) (-691.654) -- 0:00:59
      48500 -- (-686.994) [-686.754] (-684.852) (-686.358) * (-686.619) (-687.715) [-689.889] (-685.846) -- 0:00:58
      49000 -- (-687.002) [-686.178] (-688.967) (-688.763) * (-688.686) (-686.217) [-688.103] (-687.663) -- 0:00:58
      49500 -- (-686.675) [-686.505] (-684.696) (-689.842) * (-688.408) (-686.023) (-688.491) [-686.144] -- 0:00:57
      50000 -- (-687.256) (-685.462) (-684.771) [-685.650] * (-689.313) (-686.984) [-686.727] (-687.353) -- 0:00:57

      Average standard deviation of split frequencies: 0.033495

      50500 -- (-686.490) (-685.415) (-686.927) [-688.095] * (-688.087) [-686.250] (-685.965) (-686.465) -- 0:00:56
      51000 -- [-686.205] (-690.063) (-685.663) (-688.879) * (-691.747) (-687.842) (-685.589) [-686.469] -- 0:00:55
      51500 -- (-686.160) (-689.011) [-685.827] (-690.508) * (-694.470) (-685.305) (-688.372) [-687.946] -- 0:00:55
      52000 -- [-688.337] (-687.090) (-686.555) (-689.984) * (-688.223) [-686.165] (-688.631) (-689.145) -- 0:00:54
      52500 -- (-684.914) (-686.572) (-686.341) [-686.684] * [-686.652] (-684.483) (-687.389) (-688.417) -- 0:00:54
      53000 -- (-690.678) [-685.792] (-687.315) (-684.862) * (-688.643) [-689.225] (-688.061) (-685.805) -- 0:00:53
      53500 -- (-686.706) [-688.441] (-686.340) (-686.144) * (-687.636) (-689.492) (-687.849) [-692.008] -- 0:00:53
      54000 -- (-688.674) [-687.722] (-684.824) (-686.529) * (-686.990) (-684.947) [-686.900] (-686.661) -- 0:00:52
      54500 -- (-687.870) (-687.538) (-685.614) [-685.955] * [-685.925] (-685.212) (-688.653) (-686.163) -- 0:00:52
      55000 -- (-692.160) [-687.260] (-686.766) (-685.917) * (-685.625) (-686.429) [-686.781] (-690.269) -- 0:00:51

      Average standard deviation of split frequencies: 0.027258

      55500 -- (-686.546) [-685.877] (-686.356) (-684.999) * [-685.148] (-686.091) (-690.807) (-685.579) -- 0:01:08
      56000 -- [-686.882] (-685.739) (-688.085) (-687.241) * [-687.512] (-686.701) (-687.407) (-686.003) -- 0:01:07
      56500 -- (-685.245) (-684.707) (-685.570) [-685.346] * [-687.215] (-685.476) (-687.515) (-688.112) -- 0:01:06
      57000 -- [-685.512] (-685.421) (-688.277) (-686.159) * [-687.221] (-685.676) (-685.975) (-687.241) -- 0:01:06
      57500 -- (-689.265) (-686.435) (-688.462) [-684.969] * [-685.549] (-692.000) (-685.862) (-686.695) -- 0:01:05
      58000 -- (-693.539) [-689.984] (-687.256) (-685.502) * [-686.483] (-687.732) (-685.775) (-687.426) -- 0:01:04
      58500 -- (-693.186) (-694.800) (-689.351) [-685.328] * (-689.482) (-686.132) [-686.158] (-685.996) -- 0:01:04
      59000 -- (-686.451) (-689.424) (-686.219) [-687.628] * (-688.360) (-688.620) [-685.934] (-686.507) -- 0:01:03
      59500 -- (-686.766) (-684.994) (-686.432) [-687.269] * (-688.154) (-688.486) (-688.322) [-685.836] -- 0:01:03
      60000 -- (-685.830) (-689.750) (-690.133) [-687.100] * [-684.870] (-686.089) (-685.556) (-686.714) -- 0:01:02

      Average standard deviation of split frequencies: 0.024421

      60500 -- (-687.090) (-690.631) (-686.073) [-687.211] * (-685.032) (-684.608) [-690.288] (-686.895) -- 0:01:02
      61000 -- [-685.457] (-694.890) (-689.500) (-685.739) * [-685.481] (-686.420) (-689.925) (-687.329) -- 0:01:01
      61500 -- (-686.883) (-690.589) (-684.833) [-687.521] * (-687.587) (-687.908) (-687.320) [-685.682] -- 0:01:01
      62000 -- [-685.305] (-688.877) (-685.562) (-686.792) * (-688.699) [-686.666] (-689.082) (-685.522) -- 0:01:00
      62500 -- [-685.302] (-686.898) (-692.746) (-686.930) * (-685.128) [-687.414] (-689.696) (-686.311) -- 0:01:00
      63000 -- (-688.596) (-688.825) [-688.073] (-688.766) * (-686.658) (-684.590) [-686.538] (-687.740) -- 0:00:59
      63500 -- (-686.499) (-694.166) (-691.928) [-687.762] * (-686.195) (-684.589) (-687.812) [-687.057] -- 0:00:58
      64000 -- (-689.801) (-686.249) (-690.255) [-688.574] * [-686.372] (-688.975) (-686.446) (-687.240) -- 0:00:58
      64500 -- (-690.379) (-685.455) [-691.323] (-686.801) * (-686.949) (-685.924) [-685.551] (-684.902) -- 0:00:58
      65000 -- (-687.571) (-685.043) (-686.592) [-686.256] * (-685.961) (-686.169) (-686.277) [-686.239] -- 0:00:57

      Average standard deviation of split frequencies: 0.021427

      65500 -- (-687.695) [-687.171] (-685.682) (-687.729) * (-686.712) [-686.323] (-685.741) (-685.619) -- 0:00:57
      66000 -- [-686.444] (-687.810) (-686.588) (-691.122) * (-690.595) [-685.721] (-686.767) (-685.744) -- 0:00:56
      66500 -- (-686.733) (-685.928) [-687.094] (-686.695) * (-689.308) (-684.719) (-688.483) [-686.405] -- 0:00:56
      67000 -- [-687.979] (-687.398) (-686.625) (-685.202) * (-686.582) (-684.463) (-692.821) [-686.434] -- 0:00:55
      67500 -- (-685.882) [-685.364] (-687.504) (-685.635) * (-686.145) (-688.272) (-687.322) [-687.770] -- 0:00:55
      68000 -- (-687.739) [-688.695] (-687.961) (-691.178) * (-686.455) (-686.960) [-685.420] (-685.378) -- 0:00:54
      68500 -- (-689.331) (-685.873) (-685.040) [-688.704] * (-688.001) (-686.314) [-688.885] (-687.762) -- 0:00:54
      69000 -- (-685.968) (-688.176) (-684.939) [-687.195] * (-686.208) (-686.677) (-687.172) [-688.344] -- 0:00:53
      69500 -- (-689.853) (-687.779) [-687.630] (-686.762) * (-688.007) (-690.110) [-686.374] (-688.449) -- 0:00:53
      70000 -- (-688.245) [-688.882] (-686.435) (-687.994) * (-687.527) [-684.643] (-687.870) (-690.004) -- 0:00:53

      Average standard deviation of split frequencies: 0.022347

      70500 -- (-686.826) (-687.189) (-686.284) [-685.817] * (-685.643) [-685.291] (-689.222) (-686.088) -- 0:00:52
      71000 -- (-687.099) (-688.227) (-687.280) [-687.899] * (-687.410) (-686.313) (-689.248) [-688.372] -- 0:00:52
      71500 -- [-688.484] (-686.619) (-690.664) (-686.955) * (-687.567) (-685.705) [-685.531] (-686.514) -- 0:00:51
      72000 -- [-685.267] (-689.478) (-689.009) (-690.097) * (-686.216) (-687.114) [-687.259] (-689.828) -- 0:00:51
      72500 -- [-688.095] (-687.060) (-690.184) (-685.876) * (-686.177) [-685.397] (-687.699) (-685.867) -- 0:01:03
      73000 -- (-687.108) (-686.550) (-690.099) [-685.240] * (-686.382) [-685.080] (-693.561) (-687.147) -- 0:01:03
      73500 -- [-685.857] (-687.056) (-685.048) (-691.003) * [-685.772] (-685.730) (-693.798) (-689.840) -- 0:01:03
      74000 -- [-684.940] (-686.394) (-686.730) (-690.925) * [-687.194] (-685.603) (-690.230) (-696.465) -- 0:01:02
      74500 -- (-685.813) [-686.287] (-689.628) (-688.354) * [-685.481] (-687.197) (-686.884) (-690.231) -- 0:01:02
      75000 -- [-686.302] (-688.165) (-689.343) (-687.965) * [-685.993] (-687.701) (-688.210) (-688.403) -- 0:01:01

      Average standard deviation of split frequencies: 0.019587

      75500 -- (-687.326) [-685.591] (-689.639) (-689.267) * (-686.713) (-689.591) [-686.681] (-687.272) -- 0:01:01
      76000 -- [-686.627] (-687.736) (-689.050) (-686.705) * (-688.549) (-693.228) [-687.779] (-688.419) -- 0:01:00
      76500 -- (-687.819) [-687.151] (-687.672) (-685.652) * (-689.099) (-687.064) (-688.663) [-687.715] -- 0:01:00
      77000 -- (-689.407) [-685.476] (-686.873) (-685.787) * (-688.214) (-687.556) [-690.562] (-688.235) -- 0:00:59
      77500 -- (-686.174) [-686.635] (-686.094) (-687.916) * (-686.132) [-685.475] (-687.729) (-688.332) -- 0:00:59
      78000 -- (-686.827) (-688.164) [-686.403] (-687.219) * (-685.161) (-686.875) (-687.747) [-688.445] -- 0:00:59
      78500 -- (-685.491) (-687.014) (-687.152) [-687.227] * (-686.349) (-686.401) [-689.875] (-685.100) -- 0:00:58
      79000 -- (-685.509) (-688.922) (-686.166) [-685.915] * [-686.660] (-687.944) (-686.371) (-687.210) -- 0:00:58
      79500 -- (-685.682) (-686.319) [-687.954] (-686.590) * (-685.774) (-687.296) (-687.267) [-686.642] -- 0:00:57
      80000 -- (-688.047) (-686.441) [-687.573] (-686.908) * (-687.474) (-687.998) [-686.995] (-686.006) -- 0:00:57

      Average standard deviation of split frequencies: 0.019480

      80500 -- [-686.365] (-689.539) (-688.437) (-687.218) * (-686.447) [-687.987] (-686.815) (-688.083) -- 0:00:57
      81000 -- (-686.509) (-687.263) (-695.042) [-685.988] * (-688.318) (-687.582) [-686.604] (-692.540) -- 0:00:56
      81500 -- (-687.385) [-685.141] (-686.483) (-685.990) * (-687.553) [-685.353] (-686.482) (-687.392) -- 0:00:56
      82000 -- [-686.345] (-686.281) (-687.134) (-688.559) * (-686.075) (-684.754) [-688.080] (-688.614) -- 0:00:55
      82500 -- [-686.451] (-686.682) (-687.142) (-690.024) * (-685.675) (-686.221) [-686.402] (-691.077) -- 0:00:55
      83000 -- (-686.413) [-686.397] (-687.717) (-687.668) * [-688.371] (-687.471) (-685.830) (-688.279) -- 0:00:55
      83500 -- (-686.485) (-687.217) [-687.724] (-687.313) * (-692.649) (-685.624) (-687.354) [-684.935] -- 0:00:54
      84000 -- (-686.570) (-688.806) [-688.048] (-687.587) * (-691.576) (-686.948) [-690.035] (-685.765) -- 0:00:54
      84500 -- [-685.839] (-687.036) (-685.981) (-686.975) * [-687.075] (-685.851) (-685.785) (-686.343) -- 0:00:54
      85000 -- (-687.915) (-686.755) (-688.933) [-685.633] * [-688.474] (-686.999) (-684.925) (-685.927) -- 0:00:53

      Average standard deviation of split frequencies: 0.019733

      85500 -- (-692.527) [-685.719] (-685.133) (-689.354) * [-688.629] (-693.320) (-686.317) (-688.196) -- 0:00:53
      86000 -- [-687.121] (-687.539) (-685.361) (-685.401) * (-688.349) (-689.124) (-686.387) [-692.718] -- 0:00:53
      86500 -- (-686.548) (-688.594) [-685.358] (-685.377) * (-686.143) [-688.839] (-686.488) (-685.585) -- 0:00:52
      87000 -- (-685.567) (-694.350) (-687.909) [-686.799] * (-687.210) (-685.369) [-686.179] (-685.950) -- 0:00:52
      87500 -- (-685.180) (-687.099) [-685.519] (-686.454) * (-685.029) (-690.690) [-687.481] (-686.380) -- 0:00:52
      88000 -- [-686.341] (-686.080) (-688.389) (-687.083) * (-685.121) (-692.775) [-688.201] (-686.386) -- 0:00:51
      88500 -- (-684.635) [-687.498] (-690.288) (-685.820) * [-685.296] (-687.415) (-691.392) (-686.708) -- 0:00:51
      89000 -- [-688.143] (-686.790) (-685.132) (-686.492) * (-687.273) [-686.698] (-689.731) (-685.775) -- 0:01:01
      89500 -- (-689.288) [-687.760] (-686.370) (-686.696) * (-688.579) (-687.665) [-686.260] (-686.299) -- 0:01:01
      90000 -- (-686.786) [-688.751] (-691.040) (-686.258) * (-686.719) [-687.833] (-688.219) (-685.742) -- 0:01:00

      Average standard deviation of split frequencies: 0.018608

      90500 -- (-686.228) (-685.182) (-688.007) [-687.636] * (-686.740) (-685.756) [-685.993] (-687.275) -- 0:01:00
      91000 -- [-689.264] (-686.138) (-687.768) (-685.807) * (-688.587) (-686.310) (-685.563) [-688.252] -- 0:00:59
      91500 -- (-688.452) [-687.492] (-692.022) (-686.383) * (-688.014) [-688.311] (-686.153) (-688.825) -- 0:00:59
      92000 -- (-687.428) [-686.014] (-687.663) (-687.696) * [-685.810] (-689.903) (-686.595) (-687.573) -- 0:00:59
      92500 -- [-688.902] (-687.168) (-686.286) (-687.917) * (-686.341) (-687.887) [-685.676] (-686.064) -- 0:00:58
      93000 -- (-686.539) [-685.160] (-686.739) (-687.720) * (-691.601) (-685.813) (-688.588) [-686.324] -- 0:00:58
      93500 -- (-686.435) [-685.854] (-689.844) (-686.802) * (-690.079) (-687.915) (-687.863) [-687.044] -- 0:00:58
      94000 -- [-688.510] (-688.749) (-686.077) (-685.702) * (-685.225) (-689.239) (-686.595) [-690.475] -- 0:00:57
      94500 -- (-687.300) (-686.628) [-685.775] (-685.982) * (-685.165) [-687.494] (-686.610) (-685.931) -- 0:00:57
      95000 -- (-690.666) (-686.737) (-686.717) [-687.500] * (-686.661) [-685.436] (-686.083) (-690.629) -- 0:00:57

      Average standard deviation of split frequencies: 0.018091

      95500 -- (-685.373) [-688.865] (-689.601) (-687.414) * [-687.538] (-692.369) (-685.585) (-688.291) -- 0:00:56
      96000 -- (-685.117) (-685.557) [-687.071] (-686.912) * (-686.731) (-686.896) (-685.604) [-685.874] -- 0:00:56
      96500 -- [-686.114] (-686.550) (-688.703) (-691.035) * (-685.552) (-686.292) (-687.823) [-690.265] -- 0:00:56
      97000 -- (-686.306) (-688.348) [-685.834] (-685.290) * [-685.393] (-690.399) (-690.851) (-687.402) -- 0:00:55
      97500 -- [-685.782] (-688.951) (-685.965) (-685.981) * [-685.512] (-690.860) (-690.806) (-687.615) -- 0:00:55
      98000 -- [-685.014] (-688.382) (-687.066) (-685.391) * (-684.558) (-688.300) [-686.731] (-687.378) -- 0:00:55
      98500 -- (-686.181) [-688.394] (-686.933) (-686.643) * (-686.746) [-686.489] (-685.466) (-688.671) -- 0:00:54
      99000 -- (-688.000) (-685.774) [-686.186] (-686.781) * (-685.205) [-685.730] (-685.766) (-686.238) -- 0:00:54
      99500 -- (-688.986) (-691.418) [-689.191] (-687.231) * (-689.591) (-688.051) (-684.749) [-686.252] -- 0:00:54
      100000 -- (-689.921) [-686.695] (-686.055) (-685.886) * (-687.341) (-685.745) (-685.979) [-684.510] -- 0:00:54

      Average standard deviation of split frequencies: 0.017629

      100500 -- (-690.175) [-686.441] (-689.289) (-689.960) * (-684.998) (-686.983) (-685.282) [-684.958] -- 0:00:53
      101000 -- (-687.339) (-686.637) [-686.807] (-687.329) * [-687.782] (-686.732) (-687.805) (-686.348) -- 0:00:53
      101500 -- (-685.037) (-686.330) (-687.719) [-686.295] * (-692.495) [-685.323] (-687.932) (-688.058) -- 0:00:53
      102000 -- [-685.245] (-685.039) (-688.017) (-692.340) * (-689.837) [-686.914] (-686.201) (-687.213) -- 0:00:52
      102500 -- (-690.461) (-685.143) [-686.081] (-687.367) * (-690.811) (-685.385) (-687.198) [-687.434] -- 0:00:52
      103000 -- (-686.260) (-684.857) [-685.318] (-687.957) * (-687.751) [-685.432] (-685.646) (-688.638) -- 0:00:52
      103500 -- (-686.424) [-686.718] (-687.283) (-685.646) * (-686.140) [-686.062] (-688.941) (-685.373) -- 0:00:51
      104000 -- (-688.644) [-686.253] (-685.712) (-686.633) * (-685.992) [-688.155] (-685.314) (-685.421) -- 0:00:51
      104500 -- (-688.454) [-686.990] (-690.291) (-689.581) * [-686.322] (-688.814) (-685.315) (-685.334) -- 0:00:51
      105000 -- (-686.920) (-686.060) [-686.017] (-687.374) * (-689.013) (-691.235) [-687.354] (-685.350) -- 0:00:51

      Average standard deviation of split frequencies: 0.017566

      105500 -- (-687.153) (-685.924) (-690.435) [-687.616] * (-689.519) (-687.980) (-686.271) [-688.339] -- 0:00:59
      106000 -- [-685.800] (-685.570) (-688.471) (-686.072) * (-688.797) [-687.042] (-687.945) (-685.124) -- 0:00:59
      106500 -- (-686.239) (-684.516) [-688.264] (-687.034) * (-690.200) (-686.303) (-688.958) [-686.808] -- 0:00:58
      107000 -- [-684.858] (-687.470) (-686.108) (-688.417) * [-687.056] (-687.223) (-689.703) (-687.099) -- 0:00:58
      107500 -- (-686.245) [-685.327] (-689.240) (-687.687) * [-685.728] (-688.787) (-688.152) (-685.825) -- 0:00:58
      108000 -- (-687.369) (-688.044) [-689.730] (-685.409) * (-686.312) [-686.106] (-685.684) (-685.603) -- 0:00:57
      108500 -- (-687.456) (-690.691) (-685.596) [-685.993] * (-685.347) [-686.024] (-685.684) (-685.421) -- 0:00:57
      109000 -- (-687.075) (-686.853) [-685.330] (-687.170) * (-686.003) (-685.433) [-685.954] (-687.087) -- 0:00:57
      109500 -- (-688.502) (-685.519) [-687.832] (-685.822) * [-685.298] (-686.367) (-685.323) (-685.982) -- 0:00:56
      110000 -- (-685.687) (-686.547) (-685.894) [-685.960] * (-686.292) (-688.935) [-691.365] (-684.907) -- 0:00:56

      Average standard deviation of split frequencies: 0.017487

      110500 -- [-686.077] (-686.680) (-686.381) (-685.738) * (-688.047) [-687.887] (-688.925) (-688.015) -- 0:00:56
      111000 -- (-688.437) [-685.631] (-688.105) (-684.991) * (-689.734) (-687.440) [-687.399] (-687.448) -- 0:00:56
      111500 -- (-688.350) (-688.100) [-685.263] (-686.644) * (-688.190) (-686.303) [-687.746] (-687.046) -- 0:00:55
      112000 -- (-687.996) (-692.051) (-690.378) [-687.077] * (-690.639) [-685.054] (-687.233) (-688.002) -- 0:00:55
      112500 -- (-687.039) (-689.276) [-685.087] (-687.306) * (-687.652) (-691.057) (-687.729) [-687.687] -- 0:00:55
      113000 -- (-686.472) (-690.087) (-685.457) [-686.938] * [-688.244] (-685.067) (-686.706) (-688.460) -- 0:00:54
      113500 -- (-686.726) (-688.183) [-685.876] (-690.323) * (-688.622) (-686.647) (-685.953) [-686.597] -- 0:00:54
      114000 -- [-685.814] (-689.102) (-686.228) (-689.771) * [-686.517] (-686.696) (-686.544) (-685.839) -- 0:00:54
      114500 -- (-691.354) (-688.576) (-687.399) [-685.227] * (-686.320) (-687.778) (-687.444) [-684.600] -- 0:00:54
      115000 -- [-689.339] (-692.037) (-687.405) (-688.187) * (-685.984) (-685.734) (-689.801) [-686.381] -- 0:00:53

      Average standard deviation of split frequencies: 0.017158

      115500 -- [-686.551] (-685.919) (-687.783) (-689.165) * (-686.730) [-687.704] (-685.474) (-685.882) -- 0:00:53
      116000 -- (-687.541) (-686.941) (-686.701) [-689.843] * [-691.085] (-690.512) (-689.639) (-689.380) -- 0:00:53
      116500 -- (-688.182) (-685.627) [-686.601] (-690.218) * [-688.403] (-690.962) (-685.607) (-689.063) -- 0:00:53
      117000 -- (-688.423) (-685.720) [-689.391] (-686.067) * (-688.906) (-694.858) (-686.685) [-688.353] -- 0:00:52
      117500 -- (-688.158) (-693.394) [-686.732] (-686.435) * (-688.769) (-685.895) [-685.014] (-687.979) -- 0:00:52
      118000 -- (-685.224) [-686.739] (-685.688) (-688.213) * [-685.582] (-685.417) (-685.719) (-691.703) -- 0:00:52
      118500 -- [-686.338] (-686.369) (-688.330) (-688.260) * (-688.849) [-688.595] (-685.255) (-687.242) -- 0:00:52
      119000 -- (-686.347) (-687.171) [-684.768] (-688.391) * (-687.010) (-686.585) [-686.159] (-690.531) -- 0:00:51
      119500 -- (-688.658) (-685.156) (-686.799) [-692.119] * (-688.282) [-687.636] (-687.210) (-686.817) -- 0:00:51
      120000 -- (-685.894) (-687.261) (-686.133) [-691.229] * (-687.268) [-685.659] (-689.991) (-686.787) -- 0:00:51

      Average standard deviation of split frequencies: 0.015627

      120500 -- (-685.389) [-686.221] (-684.809) (-688.305) * (-689.090) (-688.620) (-688.101) [-685.018] -- 0:00:51
      121000 -- (-687.025) [-686.220] (-685.550) (-687.947) * (-686.647) (-689.521) [-688.019] (-686.824) -- 0:00:50
      121500 -- (-688.005) [-686.834] (-684.754) (-685.876) * [-685.240] (-693.667) (-685.422) (-688.165) -- 0:00:50
      122000 -- [-687.875] (-685.527) (-685.896) (-686.717) * [-687.740] (-695.136) (-688.159) (-686.243) -- 0:00:50
      122500 -- (-686.640) (-689.872) [-687.817] (-687.725) * (-687.281) [-686.349] (-686.874) (-686.369) -- 0:00:57
      123000 -- [-686.079] (-687.388) (-686.684) (-685.767) * (-687.114) (-686.336) [-685.852] (-686.582) -- 0:00:57
      123500 -- (-685.967) (-685.262) [-686.213] (-690.490) * [-688.188] (-685.175) (-685.966) (-685.845) -- 0:00:56
      124000 -- (-685.935) [-689.659] (-687.878) (-690.098) * [-688.784] (-685.865) (-686.579) (-686.705) -- 0:00:56
      124500 -- [-685.654] (-693.970) (-684.929) (-687.415) * (-687.458) [-686.988] (-691.614) (-689.750) -- 0:00:56
      125000 -- [-685.370] (-689.215) (-685.339) (-693.215) * (-687.789) (-687.020) [-687.565] (-686.805) -- 0:00:56

      Average standard deviation of split frequencies: 0.016004

      125500 -- (-685.885) (-685.620) [-685.796] (-685.446) * (-685.714) (-687.250) [-686.850] (-685.643) -- 0:00:55
      126000 -- (-691.883) [-685.786] (-685.635) (-686.158) * (-688.233) [-685.536] (-686.496) (-690.291) -- 0:00:55
      126500 -- (-685.934) (-692.285) [-687.336] (-685.599) * (-685.576) (-686.695) [-686.569] (-687.257) -- 0:00:55
      127000 -- (-685.899) (-693.221) (-687.901) [-685.325] * [-690.283] (-685.829) (-685.366) (-688.318) -- 0:00:54
      127500 -- (-686.527) (-685.217) [-689.042] (-687.553) * (-689.672) (-685.815) [-685.854] (-688.066) -- 0:00:54
      128000 -- (-693.377) (-685.635) (-686.707) [-685.377] * (-685.332) (-685.492) [-685.825] (-687.384) -- 0:00:54
      128500 -- (-687.072) (-685.413) [-687.176] (-686.406) * (-686.186) [-687.169] (-688.497) (-686.412) -- 0:00:54
      129000 -- (-687.191) (-687.197) (-685.522) [-687.411] * [-687.055] (-687.403) (-690.222) (-685.243) -- 0:00:54
      129500 -- (-688.594) (-685.939) [-687.664] (-686.671) * (-687.164) (-685.919) [-688.274] (-685.816) -- 0:00:53
      130000 -- [-684.785] (-685.667) (-686.498) (-686.015) * (-687.569) [-686.026] (-689.063) (-685.573) -- 0:00:53

      Average standard deviation of split frequencies: 0.016765

      130500 -- (-693.695) (-693.932) [-686.992] (-688.646) * [-684.911] (-685.912) (-687.545) (-686.529) -- 0:00:53
      131000 -- [-684.760] (-686.628) (-688.022) (-686.374) * (-686.662) (-688.047) (-688.352) [-685.613] -- 0:00:53
      131500 -- (-685.077) (-685.901) (-689.048) [-687.478] * (-685.023) [-687.079] (-686.861) (-685.769) -- 0:00:52
      132000 -- (-688.792) (-686.520) (-688.299) [-685.504] * (-686.313) [-690.557] (-688.190) (-686.644) -- 0:00:52
      132500 -- (-689.288) (-687.018) [-686.512] (-690.008) * (-688.037) (-687.702) (-686.626) [-688.293] -- 0:00:52
      133000 -- (-687.707) (-687.250) [-685.835] (-689.319) * [-693.730] (-688.780) (-687.290) (-688.805) -- 0:00:52
      133500 -- (-690.543) (-689.390) (-688.529) [-685.925] * [-687.973] (-687.747) (-684.995) (-693.784) -- 0:00:51
      134000 -- (-688.946) (-688.412) [-688.802] (-686.031) * (-691.476) (-687.122) (-686.750) [-688.952] -- 0:00:51
      134500 -- (-690.231) [-687.355] (-688.626) (-687.321) * (-686.764) (-687.882) [-686.265] (-689.379) -- 0:00:51
      135000 -- (-689.306) [-686.742] (-689.471) (-685.787) * [-687.194] (-686.093) (-687.936) (-688.327) -- 0:00:51

      Average standard deviation of split frequencies: 0.017739

      135500 -- (-687.985) (-689.573) [-686.227] (-691.283) * (-684.998) [-688.351] (-687.435) (-685.297) -- 0:00:51
      136000 -- (-685.735) (-686.407) [-691.417] (-685.607) * (-685.090) (-687.724) (-686.047) [-685.171] -- 0:00:50
      136500 -- (-688.703) [-687.099] (-692.310) (-686.408) * (-685.313) [-685.660] (-685.327) (-691.868) -- 0:00:50
      137000 -- [-686.933] (-687.905) (-688.675) (-685.676) * (-685.984) (-687.741) [-691.916] (-685.921) -- 0:00:50
      137500 -- (-684.675) [-687.551] (-685.225) (-689.971) * (-686.448) [-689.542] (-691.639) (-687.778) -- 0:00:50
      138000 -- (-685.656) (-693.363) [-684.587] (-685.481) * (-689.853) [-686.092] (-685.356) (-688.946) -- 0:00:49
      138500 -- (-686.807) (-689.779) [-684.606] (-686.043) * (-688.529) (-686.333) [-686.866] (-686.448) -- 0:00:49
      139000 -- [-685.642] (-687.728) (-685.247) (-685.395) * (-687.185) (-687.096) [-685.618] (-685.165) -- 0:00:49
      139500 -- (-686.434) [-687.256] (-685.434) (-686.593) * (-685.374) (-685.853) (-685.841) [-685.306] -- 0:00:55
      140000 -- (-685.568) (-687.283) (-689.307) [-686.211] * (-685.611) [-685.569] (-687.070) (-687.140) -- 0:00:55

      Average standard deviation of split frequencies: 0.016756

      140500 -- [-685.474] (-687.477) (-687.843) (-685.707) * [-690.601] (-686.740) (-686.759) (-686.531) -- 0:00:55
      141000 -- [-686.363] (-686.783) (-688.801) (-691.088) * (-685.824) (-687.617) (-687.250) [-686.943] -- 0:00:54
      141500 -- (-685.002) (-687.025) [-689.990] (-687.462) * (-685.268) (-686.503) (-687.323) [-685.486] -- 0:00:54
      142000 -- (-688.269) [-685.981] (-689.564) (-687.781) * (-688.589) (-686.766) [-686.871] (-688.929) -- 0:00:54
      142500 -- (-686.654) (-688.849) [-685.164] (-687.706) * (-685.316) [-685.820] (-688.379) (-686.909) -- 0:00:54
      143000 -- (-685.113) (-690.412) (-690.104) [-685.982] * [-687.958] (-685.834) (-686.402) (-686.219) -- 0:00:53
      143500 -- (-687.628) [-693.464] (-685.086) (-686.711) * (-685.325) [-686.894] (-686.144) (-687.256) -- 0:00:53
      144000 -- (-688.307) (-687.942) (-685.628) [-687.421] * (-689.944) (-687.336) (-690.638) [-686.820] -- 0:00:53
      144500 -- (-690.129) (-687.292) (-685.034) [-686.483] * (-687.404) [-686.230] (-690.583) (-685.958) -- 0:00:53
      145000 -- (-685.463) [-689.289] (-688.536) (-686.050) * (-686.509) [-688.005] (-690.810) (-688.728) -- 0:00:53

      Average standard deviation of split frequencies: 0.016862

      145500 -- [-686.799] (-685.346) (-691.066) (-685.985) * (-685.951) [-688.226] (-688.754) (-689.781) -- 0:00:52
      146000 -- (-688.023) [-684.749] (-686.135) (-684.742) * (-687.431) [-688.463] (-689.961) (-685.471) -- 0:00:52
      146500 -- (-687.172) (-690.815) [-685.106] (-687.888) * [-685.313] (-689.290) (-688.014) (-687.963) -- 0:00:52
      147000 -- (-685.048) [-688.346] (-685.015) (-689.366) * (-687.734) (-687.272) (-687.292) [-686.714] -- 0:00:52
      147500 -- (-685.358) (-685.356) (-686.143) [-689.726] * [-686.523] (-685.140) (-688.262) (-686.327) -- 0:00:52
      148000 -- (-686.855) (-686.692) (-687.346) [-687.589] * [-691.783] (-688.063) (-686.907) (-686.679) -- 0:00:51
      148500 -- (-686.010) (-685.326) [-685.219] (-688.059) * [-687.980] (-686.459) (-685.875) (-690.201) -- 0:00:51
      149000 -- (-685.814) (-689.536) [-687.901] (-689.115) * (-688.504) [-691.111] (-686.731) (-684.776) -- 0:00:51
      149500 -- (-687.323) (-688.472) (-686.282) [-686.471] * [-686.342] (-687.114) (-685.796) (-684.922) -- 0:00:51
      150000 -- [-685.840] (-687.433) (-687.908) (-685.742) * (-690.666) (-685.328) [-686.734] (-685.594) -- 0:00:51

      Average standard deviation of split frequencies: 0.015828

      150500 -- (-684.840) (-685.234) (-686.904) [-687.324] * (-694.291) [-685.734] (-692.567) (-686.246) -- 0:00:50
      151000 -- [-685.304] (-686.762) (-687.272) (-685.126) * (-691.049) (-685.916) (-692.818) [-691.760] -- 0:00:50
      151500 -- (-685.049) (-689.514) (-692.280) [-689.212] * (-688.497) [-685.821] (-685.130) (-688.087) -- 0:00:50
      152000 -- (-688.700) (-685.398) [-696.403] (-688.894) * (-684.819) [-684.718] (-688.749) (-688.851) -- 0:00:50
      152500 -- [-685.876] (-688.489) (-685.554) (-687.615) * (-687.529) (-685.715) (-688.281) [-685.226] -- 0:00:50
      153000 -- [-686.918] (-687.684) (-686.080) (-693.394) * (-684.800) [-685.874] (-686.724) (-694.458) -- 0:00:49
      153500 -- (-684.937) [-687.054] (-686.383) (-688.104) * [-684.647] (-685.606) (-687.656) (-690.706) -- 0:00:49
      154000 -- (-685.787) (-689.550) [-685.589] (-688.706) * (-686.036) [-685.596] (-687.009) (-687.153) -- 0:00:49
      154500 -- (-690.742) (-685.965) [-685.059] (-689.195) * (-687.935) [-685.319] (-685.222) (-687.224) -- 0:00:49
      155000 -- (-685.880) (-686.361) [-687.100] (-689.520) * (-688.022) (-685.204) (-685.703) [-688.602] -- 0:00:49

      Average standard deviation of split frequencies: 0.017124

      155500 -- (-685.680) (-688.091) [-687.581] (-684.622) * [-690.202] (-686.840) (-686.301) (-688.933) -- 0:00:48
      156000 -- (-689.027) [-686.401] (-685.319) (-686.203) * [-688.893] (-688.989) (-687.270) (-687.188) -- 0:00:54
      156500 -- [-686.102] (-687.617) (-685.593) (-687.408) * (-686.021) [-685.301] (-686.021) (-687.780) -- 0:00:53
      157000 -- (-686.628) (-690.073) [-687.210] (-687.183) * (-684.835) [-685.122] (-692.530) (-686.618) -- 0:00:53
      157500 -- (-688.448) [-686.146] (-688.690) (-686.776) * (-685.832) [-685.754] (-686.832) (-688.712) -- 0:00:53
      158000 -- (-688.550) (-687.456) (-687.633) [-688.392] * (-688.719) (-687.572) (-685.073) [-685.345] -- 0:00:53
      158500 -- [-685.291] (-689.786) (-690.356) (-688.888) * (-687.896) (-687.100) [-685.271] (-685.345) -- 0:00:53
      159000 -- (-689.384) [-688.214] (-685.513) (-691.724) * (-684.713) (-685.649) (-687.699) [-686.025] -- 0:00:52
      159500 -- (-689.056) (-689.724) (-687.245) [-690.408] * (-690.170) (-686.617) (-686.226) [-686.191] -- 0:00:52
      160000 -- [-685.031] (-686.521) (-685.700) (-689.064) * [-688.046] (-687.095) (-689.497) (-686.563) -- 0:00:52

      Average standard deviation of split frequencies: 0.018376

      160500 -- (-685.547) [-690.406] (-686.087) (-686.096) * [-685.968] (-686.668) (-693.455) (-685.964) -- 0:00:52
      161000 -- (-689.278) (-691.163) [-685.944] (-691.047) * [-684.997] (-688.003) (-685.800) (-685.964) -- 0:00:52
      161500 -- [-689.382] (-688.058) (-687.125) (-688.068) * [-687.090] (-690.757) (-690.519) (-686.282) -- 0:00:51
      162000 -- (-687.932) (-687.117) (-687.001) [-685.662] * (-687.697) (-685.315) [-690.518] (-685.605) -- 0:00:51
      162500 -- [-684.740] (-686.862) (-686.305) (-687.908) * (-687.604) (-689.730) (-690.361) [-686.133] -- 0:00:51
      163000 -- (-688.093) (-686.033) [-686.131] (-686.520) * [-687.337] (-687.916) (-688.591) (-689.647) -- 0:00:51
      163500 -- [-686.655] (-686.199) (-685.098) (-687.865) * (-686.452) (-686.226) [-687.516] (-688.009) -- 0:00:51
      164000 -- (-685.880) (-687.489) [-685.895] (-688.104) * (-687.557) (-686.039) (-691.212) [-686.780] -- 0:00:50
      164500 -- [-688.473] (-687.918) (-685.876) (-689.594) * [-689.739] (-685.948) (-686.075) (-686.769) -- 0:00:50
      165000 -- (-686.244) [-685.281] (-685.898) (-692.582) * (-695.220) [-685.815] (-687.455) (-687.924) -- 0:00:50

      Average standard deviation of split frequencies: 0.017323

      165500 -- (-685.530) (-685.468) [-685.857] (-689.164) * (-690.506) (-685.222) [-686.846] (-693.218) -- 0:00:50
      166000 -- (-686.351) [-689.352] (-690.458) (-689.087) * (-688.232) [-685.463] (-687.733) (-685.281) -- 0:00:50
      166500 -- (-688.177) [-686.455] (-688.842) (-686.522) * (-688.188) [-686.883] (-687.044) (-689.242) -- 0:00:50
      167000 -- (-692.508) [-685.205] (-685.733) (-690.508) * (-686.909) (-685.410) (-688.065) [-686.584] -- 0:00:49
      167500 -- (-687.298) (-685.256) [-687.975] (-688.887) * (-688.099) [-685.328] (-686.502) (-685.801) -- 0:00:49
      168000 -- (-686.295) (-685.466) (-687.034) [-688.949] * [-689.060] (-688.046) (-686.058) (-685.676) -- 0:00:49
      168500 -- [-688.608] (-686.234) (-685.410) (-689.970) * [-688.737] (-690.126) (-685.049) (-686.901) -- 0:00:49
      169000 -- (-686.383) (-686.422) [-694.168] (-688.956) * (-688.713) [-686.077] (-684.946) (-686.432) -- 0:00:49
      169500 -- (-687.842) (-687.257) (-692.360) [-685.190] * (-686.000) [-685.590] (-688.174) (-686.316) -- 0:00:48
      170000 -- [-689.207] (-686.196) (-686.775) (-685.611) * [-686.543] (-687.291) (-687.663) (-686.360) -- 0:00:48

      Average standard deviation of split frequencies: 0.015119

      170500 -- (-688.979) (-685.886) (-688.138) [-685.272] * (-687.976) (-686.424) (-689.654) [-686.081] -- 0:00:48
      171000 -- (-687.992) [-687.500] (-686.141) (-685.574) * [-685.530] (-690.460) (-685.367) (-688.994) -- 0:00:48
      171500 -- (-687.045) [-685.559] (-685.783) (-685.393) * (-687.540) (-690.347) (-690.499) [-687.551] -- 0:00:48
      172000 -- (-685.052) [-688.727] (-686.148) (-685.136) * (-688.278) (-690.865) (-686.159) [-684.961] -- 0:00:48
      172500 -- [-685.117] (-688.129) (-688.211) (-688.539) * (-686.255) (-691.232) (-686.023) [-688.432] -- 0:00:52
      173000 -- (-686.115) [-686.029] (-689.241) (-685.244) * (-688.201) [-686.055] (-685.495) (-688.624) -- 0:00:52
      173500 -- (-686.416) [-689.880] (-698.254) (-686.690) * (-686.265) (-686.639) [-685.789] (-691.554) -- 0:00:52
      174000 -- (-686.314) (-687.854) (-689.030) [-685.624] * (-688.103) [-689.460] (-686.412) (-685.595) -- 0:00:52
      174500 -- (-686.647) [-686.205] (-687.251) (-686.625) * (-686.257) (-687.717) (-691.744) [-686.165] -- 0:00:52
      175000 -- (-689.129) [-685.147] (-690.007) (-687.514) * (-686.745) (-689.129) [-688.605] (-690.521) -- 0:00:51

      Average standard deviation of split frequencies: 0.016212

      175500 -- [-685.125] (-685.073) (-689.055) (-686.807) * (-687.804) [-686.977] (-686.756) (-689.038) -- 0:00:51
      176000 -- (-688.799) [-685.265] (-690.006) (-688.016) * (-690.120) [-689.242] (-685.585) (-685.571) -- 0:00:51
      176500 -- [-685.751] (-685.685) (-691.789) (-686.782) * (-689.801) (-688.497) (-685.940) [-687.369] -- 0:00:51
      177000 -- (-686.004) (-688.252) (-687.745) [-684.740] * (-684.861) (-691.385) [-686.293] (-687.346) -- 0:00:51
      177500 -- (-685.955) (-688.508) (-687.245) [-685.952] * (-693.012) (-689.013) [-694.008] (-686.523) -- 0:00:50
      178000 -- (-685.779) [-685.368] (-687.101) (-685.348) * (-685.578) [-685.640] (-686.569) (-689.108) -- 0:00:50
      178500 -- (-685.491) (-685.339) [-686.674] (-687.291) * [-686.175] (-688.509) (-688.664) (-686.313) -- 0:00:50
      179000 -- (-692.203) [-687.085] (-687.074) (-692.034) * (-686.934) (-688.800) (-685.865) [-687.324] -- 0:00:50
      179500 -- (-688.203) [-685.374] (-686.514) (-687.728) * [-685.531] (-692.179) (-686.682) (-687.002) -- 0:00:50
      180000 -- (-686.235) (-686.772) [-685.470] (-687.435) * [-689.002] (-687.659) (-687.347) (-685.267) -- 0:00:50

      Average standard deviation of split frequencies: 0.016815

      180500 -- [-685.806] (-685.743) (-686.505) (-686.891) * (-686.646) [-687.054] (-692.647) (-689.770) -- 0:00:49
      181000 -- (-685.119) (-689.101) [-689.120] (-686.956) * (-686.749) (-688.017) [-687.972] (-686.746) -- 0:00:49
      181500 -- (-686.254) [-684.974] (-686.844) (-687.306) * [-686.875] (-689.037) (-687.763) (-691.809) -- 0:00:49
      182000 -- [-685.509] (-686.137) (-687.158) (-689.321) * (-685.226) [-688.166] (-686.912) (-691.398) -- 0:00:49
      182500 -- (-687.091) (-686.824) [-686.257] (-689.264) * [-686.449] (-686.619) (-687.621) (-689.968) -- 0:00:49
      183000 -- (-687.058) (-686.648) (-689.848) [-687.934] * (-684.864) [-686.182] (-686.484) (-687.772) -- 0:00:49
      183500 -- (-685.460) (-684.942) (-687.233) [-688.049] * (-685.973) [-687.263] (-685.588) (-688.514) -- 0:00:48
      184000 -- (-685.221) (-688.973) (-685.414) [-684.656] * (-687.356) (-687.042) (-686.085) [-689.433] -- 0:00:48
      184500 -- (-686.894) [-689.603] (-685.486) (-685.872) * [-688.654] (-688.047) (-690.822) (-687.249) -- 0:00:48
      185000 -- (-686.356) (-690.693) [-684.754] (-686.043) * (-685.632) [-686.280] (-690.677) (-686.530) -- 0:00:48

      Average standard deviation of split frequencies: 0.017882

      185500 -- (-686.437) (-688.616) (-685.306) [-688.500] * (-685.101) (-686.504) [-687.814] (-689.460) -- 0:00:48
      186000 -- (-688.864) [-685.433] (-688.222) (-688.469) * (-686.544) (-685.748) [-686.689] (-687.034) -- 0:00:48
      186500 -- (-691.127) (-687.550) [-687.178] (-685.357) * (-686.731) [-689.586] (-688.470) (-689.948) -- 0:00:47
      187000 -- (-687.548) (-687.806) (-685.553) [-687.140] * (-685.788) (-690.845) [-684.879] (-687.080) -- 0:00:47
      187500 -- (-686.839) (-687.806) [-687.090] (-685.362) * (-688.075) (-688.091) [-688.823] (-688.254) -- 0:00:47
      188000 -- [-685.581] (-687.325) (-686.767) (-685.423) * (-693.575) (-687.030) (-687.406) [-686.208] -- 0:00:47
      188500 -- (-684.859) (-688.045) [-686.055] (-685.476) * (-687.406) [-689.999] (-686.739) (-687.251) -- 0:00:47
      189000 -- (-686.686) [-687.589] (-688.450) (-688.594) * [-687.875] (-687.957) (-686.425) (-689.430) -- 0:00:47
      189500 -- (-686.690) [-688.351] (-687.413) (-687.936) * (-688.792) (-688.607) (-686.252) [-687.666] -- 0:00:51
      190000 -- [-686.190] (-686.976) (-693.429) (-686.936) * (-687.614) (-686.286) [-685.806] (-688.658) -- 0:00:51

      Average standard deviation of split frequencies: 0.018179

      190500 -- (-685.879) (-690.968) [-686.622] (-689.448) * (-687.605) [-686.788] (-687.209) (-686.987) -- 0:00:50
      191000 -- (-687.465) (-687.361) (-686.837) [-686.380] * [-686.449] (-685.539) (-686.691) (-686.427) -- 0:00:50
      191500 -- (-688.009) (-686.466) [-686.329] (-689.015) * (-686.544) [-686.012] (-688.840) (-686.469) -- 0:00:50
      192000 -- [-684.903] (-685.021) (-686.789) (-688.983) * (-687.328) [-687.762] (-687.264) (-688.669) -- 0:00:50
      192500 -- (-684.856) (-686.891) [-688.385] (-694.342) * [-685.197] (-686.230) (-685.305) (-685.989) -- 0:00:50
      193000 -- [-688.202] (-686.321) (-689.823) (-690.111) * [-688.632] (-685.888) (-687.461) (-687.218) -- 0:00:50
      193500 -- (-686.447) (-688.922) (-689.119) [-686.489] * (-686.300) (-687.430) (-690.016) [-686.505] -- 0:00:50
      194000 -- [-687.185] (-687.753) (-689.507) (-688.033) * (-686.024) (-686.164) [-685.308] (-686.236) -- 0:00:49
      194500 -- [-687.358] (-687.847) (-693.534) (-687.604) * [-685.587] (-688.847) (-688.563) (-688.205) -- 0:00:49
      195000 -- (-687.803) (-689.007) (-687.739) [-686.329] * (-685.822) (-687.963) (-692.336) [-688.354] -- 0:00:49

      Average standard deviation of split frequencies: 0.017402

      195500 -- (-691.160) (-685.865) (-686.544) [-685.244] * (-686.340) (-686.445) (-689.986) [-689.420] -- 0:00:49
      196000 -- (-688.215) (-686.636) [-686.365] (-686.216) * (-685.803) (-686.427) [-685.903] (-689.776) -- 0:00:49
      196500 -- (-685.876) [-687.146] (-688.261) (-689.754) * (-686.736) (-687.003) [-686.054] (-685.360) -- 0:00:49
      197000 -- (-689.325) (-690.008) (-687.061) [-688.588] * (-685.388) (-686.500) [-686.981] (-686.239) -- 0:00:48
      197500 -- (-686.778) (-689.600) (-686.993) [-687.352] * (-690.887) (-687.579) (-686.813) [-687.294] -- 0:00:48
      198000 -- (-685.031) (-685.896) [-686.598] (-687.337) * (-689.596) (-689.436) (-687.294) [-685.195] -- 0:00:48
      198500 -- (-688.333) (-685.939) (-689.733) [-686.672] * (-687.872) (-685.126) (-685.077) [-686.367] -- 0:00:48
      199000 -- [-690.812] (-685.412) (-687.423) (-685.333) * (-688.385) [-685.141] (-685.963) (-687.452) -- 0:00:48
      199500 -- (-691.353) (-686.895) (-686.246) [-686.262] * (-685.877) (-687.961) [-685.473] (-687.498) -- 0:00:48
      200000 -- [-686.361] (-689.090) (-686.217) (-688.740) * (-685.077) (-686.520) (-687.075) [-688.599] -- 0:00:48

      Average standard deviation of split frequencies: 0.017826

      200500 -- (-686.555) (-690.029) [-687.625] (-686.855) * (-687.015) (-687.786) (-687.692) [-684.979] -- 0:00:47
      201000 -- (-686.641) (-685.732) (-687.507) [-686.989] * (-686.717) (-685.212) (-693.415) [-687.119] -- 0:00:47
      201500 -- [-687.118] (-685.973) (-685.650) (-687.842) * [-690.242] (-689.378) (-687.774) (-687.040) -- 0:00:47
      202000 -- (-687.330) (-687.644) (-687.197) [-688.956] * (-688.182) [-687.059] (-689.576) (-690.715) -- 0:00:47
      202500 -- (-687.004) (-686.929) [-685.407] (-686.013) * (-688.153) (-685.835) (-687.497) [-686.383] -- 0:00:47
      203000 -- [-686.822] (-690.279) (-688.037) (-687.715) * (-696.998) (-686.189) [-689.930] (-685.270) -- 0:00:47
      203500 -- (-686.505) (-685.301) [-688.550] (-685.813) * (-691.230) [-686.080] (-689.908) (-687.950) -- 0:00:46
      204000 -- (-688.161) (-687.032) [-684.621] (-686.726) * (-687.280) [-685.857] (-685.906) (-687.753) -- 0:00:46
      204500 -- (-687.452) [-685.542] (-684.641) (-687.077) * [-686.878] (-686.354) (-687.085) (-686.104) -- 0:00:46
      205000 -- [-689.354] (-686.238) (-685.252) (-688.461) * (-691.548) [-685.301] (-686.442) (-688.006) -- 0:00:46

      Average standard deviation of split frequencies: 0.017290

      205500 -- [-688.915] (-688.755) (-687.237) (-687.621) * (-687.080) (-687.389) (-687.399) [-688.543] -- 0:00:46
      206000 -- (-687.503) [-686.615] (-688.905) (-693.307) * (-686.070) (-687.321) [-686.022] (-687.494) -- 0:00:50
      206500 -- (-685.763) [-686.477] (-685.601) (-690.621) * (-687.522) (-689.304) [-686.217] (-685.762) -- 0:00:49
      207000 -- [-685.809] (-687.720) (-688.277) (-687.643) * (-684.985) (-689.743) (-686.267) [-685.361] -- 0:00:49
      207500 -- (-688.747) (-689.848) (-686.550) [-686.650] * [-690.884] (-690.783) (-686.019) (-687.525) -- 0:00:49
      208000 -- (-686.103) (-687.849) (-687.167) [-685.236] * [-684.778] (-687.722) (-685.439) (-684.908) -- 0:00:49
      208500 -- (-690.638) (-687.214) (-685.329) [-685.812] * (-686.172) (-684.945) (-687.213) [-687.162] -- 0:00:49
      209000 -- (-688.087) (-687.812) (-685.547) [-689.897] * (-687.362) (-693.612) [-685.893] (-686.926) -- 0:00:49
      209500 -- [-687.229] (-685.912) (-687.091) (-695.103) * (-686.605) [-688.802] (-687.338) (-686.281) -- 0:00:49
      210000 -- [-687.506] (-685.979) (-685.834) (-685.575) * (-688.095) (-687.050) (-687.442) [-689.100] -- 0:00:48

      Average standard deviation of split frequencies: 0.015788

      210500 -- (-688.032) (-686.196) (-685.812) [-685.196] * (-687.639) (-686.303) [-685.878] (-684.770) -- 0:00:48
      211000 -- (-690.411) [-687.275] (-686.788) (-687.630) * (-685.214) (-684.972) [-688.161] (-686.648) -- 0:00:48
      211500 -- (-688.688) (-688.703) [-684.696] (-687.018) * (-685.298) (-685.383) [-687.375] (-689.198) -- 0:00:48
      212000 -- [-685.127] (-686.025) (-684.699) (-686.925) * (-687.909) (-687.592) [-687.004] (-689.451) -- 0:00:48
      212500 -- [-686.825] (-685.816) (-684.822) (-686.806) * (-687.282) (-689.607) [-686.604] (-691.737) -- 0:00:48
      213000 -- (-686.814) [-688.593] (-687.085) (-686.118) * (-686.769) [-686.714] (-686.960) (-688.716) -- 0:00:48
      213500 -- (-687.024) (-688.780) [-688.100] (-685.645) * (-686.651) (-695.010) [-687.424] (-686.427) -- 0:00:47
      214000 -- [-688.450] (-687.327) (-687.828) (-685.549) * [-686.597] (-685.922) (-684.825) (-687.158) -- 0:00:47
      214500 -- [-689.685] (-686.579) (-692.066) (-688.596) * [-684.890] (-684.942) (-685.074) (-687.911) -- 0:00:47
      215000 -- (-691.830) (-686.327) (-689.445) [-688.080] * (-689.287) [-690.472] (-686.763) (-685.051) -- 0:00:47

      Average standard deviation of split frequencies: 0.015405

      215500 -- (-696.151) [-690.055] (-688.090) (-685.152) * [-686.386] (-688.375) (-685.017) (-685.020) -- 0:00:47
      216000 -- (-684.969) (-685.032) [-687.364] (-690.746) * (-685.507) (-685.419) [-689.213] (-685.393) -- 0:00:47
      216500 -- (-689.098) (-688.686) (-686.700) [-692.169] * (-687.892) (-687.325) (-688.623) [-686.413] -- 0:00:47
      217000 -- (-687.439) [-686.985] (-685.684) (-686.028) * (-687.598) (-686.273) (-686.846) [-685.288] -- 0:00:46
      217500 -- (-688.094) (-685.740) (-685.859) [-685.931] * [-688.263] (-688.662) (-686.086) (-687.839) -- 0:00:46
      218000 -- [-685.455] (-686.365) (-686.919) (-688.754) * (-692.816) (-687.361) [-686.961] (-685.469) -- 0:00:46
      218500 -- (-688.587) (-685.554) [-686.838] (-689.717) * (-688.161) [-685.003] (-687.548) (-685.849) -- 0:00:46
      219000 -- (-689.769) (-686.507) [-686.368] (-684.715) * [-687.316] (-687.662) (-685.744) (-687.114) -- 0:00:46
      219500 -- [-686.902] (-691.505) (-684.812) (-685.437) * (-688.642) (-694.476) (-687.068) [-685.834] -- 0:00:46
      220000 -- (-684.879) (-685.933) (-686.990) [-684.903] * (-688.932) [-686.081] (-687.323) (-685.487) -- 0:00:46

      Average standard deviation of split frequencies: 0.015755

      220500 -- (-686.578) (-685.652) [-687.482] (-686.999) * (-687.571) (-688.040) [-690.550] (-687.758) -- 0:00:45
      221000 -- [-688.288] (-686.797) (-686.544) (-689.652) * [-687.202] (-687.113) (-687.624) (-687.058) -- 0:00:45
      221500 -- [-688.948] (-687.565) (-685.469) (-692.465) * [-691.003] (-685.534) (-686.198) (-686.682) -- 0:00:45
      222000 -- [-687.945] (-687.331) (-686.112) (-685.905) * (-686.494) (-686.556) (-687.644) [-685.966] -- 0:00:45
      222500 -- (-686.956) [-685.663] (-685.811) (-687.992) * [-687.888] (-686.497) (-685.736) (-685.283) -- 0:00:48
      223000 -- (-689.853) (-685.271) [-684.932] (-685.947) * (-686.025) (-694.754) (-685.690) [-685.143] -- 0:00:48
      223500 -- (-685.662) [-684.628] (-686.884) (-687.668) * [-686.452] (-686.323) (-685.735) (-691.821) -- 0:00:48
      224000 -- [-687.174] (-688.756) (-686.752) (-685.618) * (-687.382) (-693.971) [-686.627] (-690.295) -- 0:00:48
      224500 -- (-688.866) (-686.989) (-686.479) [-685.553] * (-686.359) (-688.536) [-684.498] (-689.631) -- 0:00:48
      225000 -- (-685.693) (-687.043) (-686.785) [-686.902] * (-685.082) (-688.276) [-684.961] (-687.669) -- 0:00:48

      Average standard deviation of split frequencies: 0.015383

      225500 -- (-687.668) (-687.511) (-686.102) [-687.923] * [-685.578] (-685.125) (-685.070) (-686.147) -- 0:00:48
      226000 -- [-685.233] (-685.585) (-685.439) (-688.046) * (-687.258) (-689.714) (-689.266) [-688.722] -- 0:00:47
      226500 -- [-687.107] (-687.312) (-688.333) (-690.357) * (-692.546) (-689.486) (-688.274) [-686.259] -- 0:00:47
      227000 -- [-687.871] (-686.168) (-689.460) (-693.562) * (-684.934) (-687.274) (-686.710) [-686.040] -- 0:00:47
      227500 -- [-686.778] (-686.203) (-687.268) (-685.589) * [-685.676] (-687.337) (-692.720) (-685.819) -- 0:00:47
      228000 -- (-685.087) (-689.654) (-687.836) [-686.428] * [-686.115] (-687.680) (-687.788) (-685.101) -- 0:00:47
      228500 -- (-685.267) (-687.097) (-688.836) [-687.777] * [-685.745] (-686.571) (-689.243) (-684.823) -- 0:00:47
      229000 -- (-685.725) (-685.251) (-687.694) [-686.717] * [-685.953] (-686.769) (-688.782) (-685.138) -- 0:00:47
      229500 -- (-685.300) [-688.675] (-685.290) (-687.521) * (-684.637) (-685.617) (-687.274) [-684.945] -- 0:00:47
      230000 -- (-685.721) [-685.962] (-686.795) (-686.021) * (-688.646) (-686.079) (-687.926) [-686.249] -- 0:00:46

      Average standard deviation of split frequencies: 0.014178

      230500 -- (-690.371) [-685.835] (-685.106) (-687.156) * [-685.846] (-689.700) (-688.561) (-686.481) -- 0:00:46
      231000 -- [-688.293] (-685.114) (-685.498) (-685.494) * (-688.148) (-686.989) [-688.239] (-687.401) -- 0:00:46
      231500 -- (-687.332) (-686.598) (-686.064) [-686.203] * [-687.317] (-687.347) (-684.620) (-688.770) -- 0:00:46
      232000 -- (-687.274) [-688.775] (-686.417) (-690.850) * (-688.047) (-685.439) [-685.536] (-687.285) -- 0:00:46
      232500 -- (-687.171) [-684.952] (-691.837) (-690.790) * (-685.817) (-688.041) (-688.783) [-686.290] -- 0:00:46
      233000 -- (-686.312) (-686.677) [-687.427] (-688.162) * [-685.814] (-689.066) (-687.364) (-689.950) -- 0:00:46
      233500 -- (-684.776) (-684.627) [-685.910] (-687.703) * [-685.007] (-686.766) (-685.341) (-696.620) -- 0:00:45
      234000 -- [-686.872] (-687.976) (-686.399) (-687.197) * (-689.836) (-685.859) [-684.817] (-686.516) -- 0:00:45
      234500 -- (-688.347) (-686.236) (-685.465) [-685.127] * (-685.488) [-685.762] (-690.862) (-689.706) -- 0:00:45
      235000 -- [-686.567] (-685.551) (-685.103) (-691.095) * (-690.111) (-685.643) [-687.710] (-686.441) -- 0:00:45

      Average standard deviation of split frequencies: 0.014981

      235500 -- [-686.308] (-685.875) (-688.994) (-689.126) * [-686.980] (-687.850) (-686.418) (-686.275) -- 0:00:45
      236000 -- [-685.829] (-685.735) (-688.444) (-686.171) * [-687.435] (-687.465) (-692.368) (-684.963) -- 0:00:45
      236500 -- (-685.667) (-685.795) (-684.957) [-686.510] * (-687.773) [-689.252] (-685.454) (-684.882) -- 0:00:45
      237000 -- (-686.716) [-685.274] (-686.548) (-685.851) * (-687.073) (-687.287) (-685.495) [-685.749] -- 0:00:45
      237500 -- (-689.050) (-685.222) [-690.451] (-684.940) * (-687.378) (-689.428) [-685.555] (-684.600) -- 0:00:44
      238000 -- [-685.852] (-687.941) (-688.976) (-687.787) * [-692.231] (-689.707) (-686.476) (-686.784) -- 0:00:44
      238500 -- (-686.210) (-691.459) (-687.600) [-685.944] * [-694.142] (-688.528) (-689.070) (-686.441) -- 0:00:44
      239000 -- (-685.578) (-688.333) (-688.353) [-685.378] * (-694.123) (-690.395) (-686.761) [-684.924] -- 0:00:44
      239500 -- (-695.055) (-686.971) [-685.392] (-684.998) * (-691.518) [-686.582] (-687.596) (-687.217) -- 0:00:47
      240000 -- [-688.062] (-685.739) (-686.198) (-687.804) * (-688.927) (-687.456) (-686.451) [-685.788] -- 0:00:47

      Average standard deviation of split frequencies: 0.014446

      240500 -- (-687.279) (-685.152) (-692.771) [-685.593] * (-686.892) [-686.266] (-685.664) (-685.059) -- 0:00:47
      241000 -- (-689.079) [-690.410] (-693.735) (-689.840) * (-688.147) (-686.087) [-684.928] (-686.332) -- 0:00:47
      241500 -- (-686.089) (-688.012) [-686.658] (-690.154) * [-692.355] (-685.532) (-686.429) (-691.512) -- 0:00:47
      242000 -- (-688.621) (-685.883) (-686.980) [-686.834] * (-687.557) (-685.562) [-686.252] (-690.716) -- 0:00:46
      242500 -- (-685.100) (-685.394) (-689.644) [-685.791] * (-689.270) (-691.168) [-685.089] (-686.971) -- 0:00:46
      243000 -- (-685.670) (-685.250) (-686.836) [-687.105] * (-687.391) (-686.953) [-688.513] (-684.891) -- 0:00:46
      243500 -- [-688.409] (-685.862) (-686.480) (-686.380) * (-687.483) (-686.413) [-686.808] (-687.443) -- 0:00:46
      244000 -- (-686.650) (-691.611) [-687.407] (-685.342) * [-687.757] (-687.750) (-686.064) (-686.779) -- 0:00:46
      244500 -- (-686.643) (-689.876) (-686.813) [-685.165] * (-686.843) (-686.292) [-685.130] (-686.100) -- 0:00:46
      245000 -- [-685.969] (-689.201) (-684.969) (-686.253) * [-685.497] (-686.484) (-685.977) (-686.910) -- 0:00:46

      Average standard deviation of split frequencies: 0.015450

      245500 -- (-685.533) (-687.001) (-685.238) [-686.527] * (-687.589) [-687.363] (-690.665) (-685.656) -- 0:00:46
      246000 -- [-687.186] (-686.466) (-685.336) (-685.603) * (-689.499) [-686.993] (-688.396) (-689.384) -- 0:00:45
      246500 -- (-687.723) [-687.474] (-685.012) (-686.181) * (-689.037) [-686.376] (-690.826) (-684.905) -- 0:00:45
      247000 -- (-685.673) [-688.056] (-685.281) (-685.094) * [-687.385] (-687.224) (-687.258) (-687.203) -- 0:00:45
      247500 -- (-687.460) (-691.361) [-688.316] (-685.000) * (-690.696) (-689.762) (-685.398) [-688.227] -- 0:00:45
      248000 -- [-687.669] (-686.751) (-688.422) (-685.554) * [-687.504] (-691.979) (-692.064) (-686.623) -- 0:00:45
      248500 -- (-685.404) (-689.304) [-687.620] (-686.020) * (-688.557) [-686.515] (-688.032) (-686.834) -- 0:00:45
      249000 -- (-687.189) [-694.856] (-685.128) (-686.990) * (-686.565) [-691.066] (-685.493) (-686.720) -- 0:00:45
      249500 -- [-688.380] (-695.332) (-685.212) (-687.918) * [-687.065] (-691.723) (-686.904) (-686.291) -- 0:00:45
      250000 -- (-688.050) (-690.481) [-687.597] (-688.191) * (-689.007) [-688.787] (-688.850) (-687.198) -- 0:00:45

      Average standard deviation of split frequencies: 0.014810

      250500 -- [-687.457] (-690.780) (-685.989) (-687.600) * [-688.983] (-694.297) (-687.492) (-687.040) -- 0:00:44
      251000 -- (-690.646) [-689.344] (-688.629) (-690.033) * (-689.300) (-693.034) [-686.158] (-687.385) -- 0:00:44
      251500 -- (-684.800) [-684.970] (-687.991) (-689.090) * (-686.406) [-687.347] (-685.220) (-691.067) -- 0:00:44
      252000 -- (-685.104) (-685.675) [-687.949] (-686.241) * (-687.829) (-686.280) (-686.731) [-687.253] -- 0:00:44
      252500 -- [-685.216] (-685.360) (-690.616) (-687.047) * (-688.308) (-694.955) [-688.057] (-687.389) -- 0:00:44
      253000 -- [-685.373] (-685.821) (-690.183) (-687.001) * (-690.229) (-689.263) [-689.012] (-687.268) -- 0:00:44
      253500 -- (-690.595) (-688.392) [-685.965] (-688.614) * [-685.019] (-687.872) (-692.344) (-688.308) -- 0:00:44
      254000 -- (-687.249) (-685.994) [-686.423] (-689.095) * [-685.899] (-685.255) (-689.259) (-689.072) -- 0:00:44
      254500 -- (-686.070) (-685.124) (-686.522) [-686.022] * [-687.091] (-686.872) (-688.097) (-687.820) -- 0:00:43
      255000 -- (-685.097) (-687.426) [-686.021] (-690.823) * [-685.518] (-691.768) (-686.836) (-687.447) -- 0:00:43

      Average standard deviation of split frequencies: 0.014406

      255500 -- (-685.242) (-685.834) [-687.292] (-691.366) * (-689.302) (-689.312) (-691.486) [-686.420] -- 0:00:43
      256000 -- [-688.624] (-687.274) (-687.000) (-686.782) * (-689.269) (-686.084) (-686.213) [-688.024] -- 0:00:46
      256500 -- (-685.641) [-688.238] (-687.021) (-687.310) * [-685.182] (-686.092) (-688.699) (-689.859) -- 0:00:46
      257000 -- (-686.999) [-687.576] (-687.764) (-686.740) * (-685.220) [-686.033] (-685.471) (-686.377) -- 0:00:46
      257500 -- (-686.314) [-685.154] (-686.509) (-686.310) * (-685.007) [-685.349] (-691.003) (-686.375) -- 0:00:46
      258000 -- [-686.285] (-686.793) (-686.588) (-686.654) * (-684.717) [-686.775] (-690.418) (-686.481) -- 0:00:46
      258500 -- (-687.584) [-685.906] (-686.275) (-685.084) * (-689.130) (-686.385) (-688.213) [-697.236] -- 0:00:45
      259000 -- (-686.642) (-685.554) [-685.212] (-684.743) * (-688.765) [-686.934] (-687.743) (-686.098) -- 0:00:45
      259500 -- (-687.588) (-685.898) [-690.086] (-686.848) * (-687.409) [-687.936] (-686.999) (-686.432) -- 0:00:45
      260000 -- (-686.837) (-687.667) [-687.225] (-687.108) * [-687.756] (-688.690) (-687.665) (-688.358) -- 0:00:45

      Average standard deviation of split frequencies: 0.013510

      260500 -- (-691.157) [-686.574] (-685.876) (-688.745) * (-687.377) (-689.823) [-685.023] (-689.905) -- 0:00:45
      261000 -- (-688.119) (-686.040) (-687.457) [-688.996] * (-686.364) [-686.424] (-687.265) (-686.719) -- 0:00:45
      261500 -- (-687.340) (-688.511) (-686.825) [-686.764] * (-686.737) (-687.985) (-685.878) [-686.356] -- 0:00:45
      262000 -- (-686.130) [-688.771] (-686.957) (-687.579) * (-686.419) (-691.286) [-686.672] (-687.164) -- 0:00:45
      262500 -- (-685.563) [-687.022] (-686.091) (-685.739) * (-688.699) (-692.620) (-687.246) [-687.540] -- 0:00:44
      263000 -- (-685.241) (-689.435) (-686.910) [-685.603] * (-689.353) (-689.940) [-685.500] (-688.087) -- 0:00:44
      263500 -- [-684.894] (-685.422) (-686.398) (-687.361) * (-686.110) [-685.776] (-685.623) (-691.078) -- 0:00:44
      264000 -- [-686.102] (-686.602) (-686.400) (-689.656) * (-686.120) (-685.506) (-686.262) [-685.410] -- 0:00:44
      264500 -- (-687.594) (-687.935) (-685.142) [-686.197] * [-686.371] (-685.130) (-686.135) (-687.425) -- 0:00:44
      265000 -- (-689.017) (-687.029) [-687.011] (-691.202) * [-688.221] (-687.768) (-689.962) (-693.234) -- 0:00:44

      Average standard deviation of split frequencies: 0.012799

      265500 -- (-688.418) (-685.313) [-686.045] (-688.764) * (-688.407) (-686.738) [-685.420] (-688.917) -- 0:00:44
      266000 -- (-687.042) [-685.436] (-693.349) (-686.863) * (-686.714) (-686.143) (-685.994) [-685.719] -- 0:00:44
      266500 -- (-687.637) (-686.915) [-688.689] (-686.796) * (-690.019) (-686.226) [-685.998] (-685.155) -- 0:00:44
      267000 -- (-691.698) (-687.122) (-691.182) [-686.387] * [-686.120] (-685.139) (-686.536) (-685.809) -- 0:00:43
      267500 -- (-686.699) (-690.158) (-687.276) [-685.542] * (-686.277) [-685.177] (-687.321) (-685.476) -- 0:00:43
      268000 -- (-684.909) (-686.280) (-686.925) [-687.774] * (-685.670) (-685.875) [-687.301] (-686.941) -- 0:00:43
      268500 -- (-686.232) (-689.033) (-687.765) [-685.048] * [-687.061] (-692.301) (-686.174) (-688.442) -- 0:00:43
      269000 -- (-687.435) [-688.820] (-686.541) (-685.048) * (-686.316) (-689.454) [-686.538] (-688.327) -- 0:00:43
      269500 -- (-685.412) [-687.065] (-686.494) (-685.433) * (-685.152) (-689.280) [-687.774] (-689.006) -- 0:00:43
      270000 -- (-690.290) (-687.916) (-688.544) [-685.799] * (-685.352) [-687.583] (-686.323) (-685.977) -- 0:00:43

      Average standard deviation of split frequencies: 0.013256

      270500 -- [-689.186] (-685.798) (-686.844) (-685.654) * (-686.717) (-685.965) (-689.266) [-685.612] -- 0:00:43
      271000 -- [-687.409] (-686.625) (-687.206) (-687.591) * [-685.579] (-693.741) (-688.716) (-685.556) -- 0:00:43
      271500 -- [-688.727] (-688.640) (-687.882) (-687.904) * (-688.830) [-685.867] (-691.653) (-689.042) -- 0:00:42
      272000 -- (-688.543) (-687.656) [-687.056] (-689.133) * [-687.212] (-686.415) (-690.921) (-686.987) -- 0:00:42
      272500 -- (-688.085) (-689.484) (-686.508) [-687.800] * [-686.936] (-690.821) (-687.023) (-686.519) -- 0:00:45
      273000 -- (-688.997) [-686.218] (-689.109) (-687.602) * [-688.172] (-689.951) (-686.908) (-690.071) -- 0:00:45
      273500 -- [-689.201] (-685.805) (-689.490) (-685.625) * (-685.654) [-687.438] (-687.339) (-686.702) -- 0:00:45
      274000 -- [-687.976] (-685.329) (-686.594) (-685.191) * (-685.461) (-686.818) [-685.624] (-685.437) -- 0:00:45
      274500 -- (-684.686) [-685.055] (-688.484) (-687.265) * [-685.086] (-686.805) (-688.512) (-686.293) -- 0:00:44
      275000 -- [-686.456] (-685.925) (-686.680) (-685.413) * (-686.687) [-685.209] (-685.690) (-685.773) -- 0:00:44

      Average standard deviation of split frequencies: 0.013474

      275500 -- (-686.404) (-689.427) [-685.743] (-687.623) * [-687.000] (-685.209) (-688.451) (-686.736) -- 0:00:44
      276000 -- (-688.592) [-686.589] (-686.457) (-692.195) * [-687.011] (-687.372) (-691.775) (-686.673) -- 0:00:44
      276500 -- (-689.090) (-688.345) [-687.918] (-686.981) * (-689.541) (-685.809) [-689.724] (-686.379) -- 0:00:44
      277000 -- (-687.063) [-688.614] (-688.129) (-689.590) * [-690.043] (-688.334) (-689.775) (-686.742) -- 0:00:44
      277500 -- (-688.787) (-690.096) (-687.378) [-684.956] * [-687.551] (-687.608) (-685.618) (-685.173) -- 0:00:44
      278000 -- (-690.391) (-691.831) (-687.261) [-685.474] * (-688.079) [-687.198] (-685.519) (-685.943) -- 0:00:44
      278500 -- [-685.282] (-686.001) (-685.984) (-688.215) * (-685.127) (-688.251) (-690.284) [-685.428] -- 0:00:44
      279000 -- [-687.170] (-688.087) (-685.871) (-685.953) * (-689.912) (-687.491) [-687.380] (-684.783) -- 0:00:43
      279500 -- (-684.892) (-687.642) [-686.063] (-686.148) * (-685.706) (-687.229) [-687.933] (-684.813) -- 0:00:43
      280000 -- [-684.882] (-685.098) (-694.411) (-693.770) * (-687.135) [-687.449] (-689.395) (-690.272) -- 0:00:43

      Average standard deviation of split frequencies: 0.014326

      280500 -- [-687.802] (-684.994) (-687.267) (-687.299) * (-687.033) [-689.851] (-689.103) (-690.050) -- 0:00:43
      281000 -- (-686.947) (-685.431) [-686.876] (-689.674) * (-686.610) (-687.965) (-688.047) [-688.999] -- 0:00:43
      281500 -- (-687.226) (-685.730) (-687.593) [-685.448] * (-688.063) (-691.289) (-688.584) [-687.312] -- 0:00:43
      282000 -- (-686.752) [-686.540] (-685.745) (-687.146) * (-686.636) (-687.410) [-689.261] (-685.695) -- 0:00:43
      282500 -- [-690.558] (-684.772) (-687.840) (-686.170) * (-686.366) (-690.032) [-688.446] (-686.638) -- 0:00:43
      283000 -- (-685.677) (-686.962) [-689.792] (-687.258) * (-687.184) [-686.491] (-685.284) (-684.904) -- 0:00:43
      283500 -- (-691.448) [-686.936] (-688.430) (-685.638) * [-687.992] (-687.077) (-685.444) (-689.535) -- 0:00:42
      284000 -- [-687.485] (-686.148) (-686.552) (-686.217) * (-686.098) (-687.984) [-686.687] (-689.176) -- 0:00:42
      284500 -- (-689.011) [-688.309] (-689.452) (-686.829) * (-685.421) (-693.108) [-684.802] (-687.201) -- 0:00:42
      285000 -- (-686.736) (-689.501) (-689.212) [-686.680] * (-685.329) (-686.488) (-685.065) [-686.731] -- 0:00:42

      Average standard deviation of split frequencies: 0.013962

      285500 -- (-686.045) [-689.034] (-687.603) (-685.734) * (-687.004) (-685.688) [-688.504] (-685.769) -- 0:00:42
      286000 -- [-687.500] (-686.878) (-685.643) (-686.169) * [-685.839] (-686.987) (-691.821) (-688.056) -- 0:00:42
      286500 -- [-687.055] (-691.315) (-687.578) (-686.516) * (-688.337) (-685.847) (-688.948) [-686.465] -- 0:00:42
      287000 -- (-686.412) (-691.407) (-685.279) [-688.935] * [-687.279] (-685.649) (-687.584) (-685.664) -- 0:00:42
      287500 -- [-687.716] (-687.097) (-685.871) (-687.068) * (-687.154) [-686.292] (-687.946) (-686.995) -- 0:00:42
      288000 -- (-686.498) [-686.511] (-687.678) (-686.156) * (-686.605) (-685.408) [-686.212] (-686.013) -- 0:00:42
      288500 -- (-685.545) (-687.763) (-686.800) [-685.591] * (-687.330) [-685.653] (-686.958) (-685.924) -- 0:00:44
      289000 -- (-686.093) [-686.722] (-687.805) (-687.206) * (-684.972) (-690.875) (-688.323) [-688.782] -- 0:00:44
      289500 -- (-689.713) (-692.277) [-688.987] (-689.680) * (-684.992) (-692.639) [-685.176] (-685.475) -- 0:00:44
      290000 -- (-692.006) (-689.236) [-686.576] (-685.657) * (-687.941) (-686.983) [-687.557] (-689.626) -- 0:00:44

      Average standard deviation of split frequencies: 0.015169

      290500 -- (-685.449) [-689.350] (-690.422) (-685.454) * (-686.025) (-685.459) (-686.755) [-687.357] -- 0:00:43
      291000 -- (-685.283) (-685.229) (-690.267) [-685.550] * [-686.778] (-688.869) (-690.017) (-686.287) -- 0:00:43
      291500 -- (-688.304) (-690.058) [-686.755] (-687.279) * (-686.328) [-687.408] (-690.256) (-690.309) -- 0:00:43
      292000 -- (-686.709) (-691.507) (-685.846) [-686.180] * (-685.601) [-687.213] (-688.397) (-692.820) -- 0:00:43
      292500 -- (-688.684) (-685.470) [-685.193] (-686.858) * [-685.620] (-685.371) (-686.124) (-691.654) -- 0:00:43
      293000 -- [-685.277] (-686.760) (-688.686) (-687.273) * (-686.020) [-688.067] (-693.918) (-688.044) -- 0:00:43
      293500 -- [-686.815] (-690.153) (-688.390) (-687.682) * [-685.515] (-686.218) (-687.724) (-693.509) -- 0:00:43
      294000 -- [-685.532] (-687.498) (-686.384) (-688.463) * [-686.953] (-686.502) (-688.589) (-689.730) -- 0:00:43
      294500 -- (-688.598) [-685.149] (-684.886) (-686.663) * [-685.120] (-686.372) (-688.701) (-690.373) -- 0:00:43
      295000 -- (-685.644) (-687.380) (-687.053) [-686.281] * (-685.048) (-685.153) (-685.131) [-685.998] -- 0:00:43

      Average standard deviation of split frequencies: 0.015738

      295500 -- (-685.936) (-687.874) (-684.923) [-688.028] * (-686.670) (-689.726) (-684.944) [-687.430] -- 0:00:42
      296000 -- (-687.212) (-686.896) (-685.213) [-686.205] * (-688.303) (-686.022) (-687.260) [-686.247] -- 0:00:42
      296500 -- (-688.053) (-688.364) [-685.383] (-686.454) * (-686.185) (-685.864) [-684.742] (-687.574) -- 0:00:42
      297000 -- (-689.643) (-690.435) [-689.912] (-691.048) * (-688.557) (-685.864) [-687.897] (-687.816) -- 0:00:42
      297500 -- (-687.284) (-686.285) [-691.980] (-687.873) * (-687.236) (-686.398) [-688.431] (-689.245) -- 0:00:42
      298000 -- [-685.257] (-685.260) (-689.481) (-688.619) * [-687.291] (-687.340) (-686.010) (-689.283) -- 0:00:42
      298500 -- (-685.668) (-688.140) (-686.863) [-686.787] * [-685.808] (-688.419) (-686.755) (-688.342) -- 0:00:42
      299000 -- [-686.642] (-687.490) (-684.969) (-688.014) * (-686.144) [-687.371] (-690.637) (-688.574) -- 0:00:42
      299500 -- (-687.956) (-689.529) [-686.639] (-687.668) * [-686.465] (-687.146) (-687.535) (-687.766) -- 0:00:42
      300000 -- (-687.806) (-685.461) [-686.707] (-685.788) * [-686.205] (-684.962) (-689.232) (-688.707) -- 0:00:42

      Average standard deviation of split frequencies: 0.016140

      300500 -- (-687.616) (-685.833) [-688.835] (-686.645) * (-688.019) (-686.061) (-685.797) [-688.785] -- 0:00:41
      301000 -- [-685.315] (-688.516) (-687.682) (-686.613) * (-689.269) (-685.034) (-687.769) [-688.207] -- 0:00:41
      301500 -- (-685.410) [-684.994] (-687.768) (-687.024) * (-685.838) (-688.485) [-690.242] (-686.805) -- 0:00:41
      302000 -- [-687.186] (-685.603) (-688.767) (-687.805) * [-688.406] (-688.276) (-693.699) (-685.881) -- 0:00:41
      302500 -- (-689.381) [-687.390] (-690.654) (-690.769) * (-694.364) (-690.281) [-691.994] (-685.074) -- 0:00:41
      303000 -- [-686.028] (-687.799) (-687.708) (-688.157) * (-688.258) (-687.056) [-689.005] (-685.036) -- 0:00:41
      303500 -- (-686.704) (-690.249) [-685.558] (-686.345) * (-685.521) (-686.369) (-686.505) [-688.437] -- 0:00:41
      304000 -- (-688.137) [-686.677] (-685.429) (-688.578) * (-685.525) (-688.245) [-685.412] (-686.293) -- 0:00:41
      304500 -- (-685.922) (-691.965) [-686.939] (-689.606) * (-689.211) (-686.195) (-685.315) [-686.658] -- 0:00:43
      305000 -- (-686.444) (-688.487) (-687.665) [-690.251] * (-686.349) (-690.264) (-687.463) [-687.724] -- 0:00:43

      Average standard deviation of split frequencies: 0.016090

      305500 -- (-688.207) (-687.768) (-690.338) [-690.411] * (-692.009) (-685.712) [-685.164] (-685.775) -- 0:00:43
      306000 -- (-688.031) (-685.908) (-687.319) [-686.111] * (-686.922) (-692.400) (-688.239) [-686.995] -- 0:00:43
      306500 -- (-688.784) (-687.364) (-685.972) [-687.019] * [-688.812] (-689.736) (-687.951) (-686.136) -- 0:00:42
      307000 -- (-686.984) (-686.553) [-686.434] (-685.294) * (-689.419) (-687.386) (-688.935) [-686.257] -- 0:00:42
      307500 -- (-688.674) [-685.253] (-686.196) (-685.603) * [-687.381] (-685.681) (-686.830) (-690.846) -- 0:00:42
      308000 -- (-692.350) (-686.775) [-686.304] (-690.638) * (-685.514) [-685.128] (-687.337) (-687.590) -- 0:00:42
      308500 -- [-688.819] (-685.725) (-686.559) (-690.526) * (-686.955) [-686.657] (-686.618) (-686.488) -- 0:00:42
      309000 -- (-687.022) [-688.346] (-686.874) (-688.202) * (-686.709) [-684.599] (-685.951) (-688.062) -- 0:00:42
      309500 -- (-686.492) (-688.144) (-688.126) [-686.698] * [-688.040] (-685.204) (-685.555) (-688.450) -- 0:00:42
      310000 -- (-686.462) (-686.789) [-685.953] (-688.615) * [-687.083] (-689.907) (-690.007) (-689.390) -- 0:00:42

      Average standard deviation of split frequencies: 0.016781

      310500 -- (-684.759) (-688.880) (-688.023) [-688.572] * (-686.778) [-687.385] (-693.278) (-687.150) -- 0:00:42
      311000 -- (-686.203) [-688.908] (-686.466) (-686.313) * (-686.393) [-689.349] (-687.325) (-688.744) -- 0:00:42
      311500 -- (-685.603) (-686.360) [-686.024] (-688.188) * [-685.756] (-687.091) (-685.454) (-685.445) -- 0:00:41
      312000 -- (-687.841) (-688.671) (-686.301) [-686.354] * (-685.266) (-685.266) [-686.466] (-686.617) -- 0:00:41
      312500 -- (-685.652) (-685.469) (-687.577) [-687.741] * (-688.168) [-686.227] (-688.446) (-687.795) -- 0:00:41
      313000 -- (-685.523) [-684.809] (-686.108) (-687.757) * (-685.582) (-688.238) (-687.472) [-686.401] -- 0:00:41
      313500 -- (-689.451) (-685.697) [-684.889] (-685.931) * (-686.751) [-688.145] (-687.073) (-688.936) -- 0:00:41
      314000 -- [-685.043] (-688.948) (-689.075) (-686.164) * (-686.263) [-685.065] (-685.453) (-685.626) -- 0:00:41
      314500 -- [-685.681] (-688.019) (-686.705) (-685.907) * (-688.270) (-686.803) (-685.584) [-686.508] -- 0:00:41
      315000 -- (-686.228) (-685.625) (-686.145) [-690.479] * (-689.845) (-685.811) [-686.804] (-685.606) -- 0:00:41

      Average standard deviation of split frequencies: 0.016761

      315500 -- (-686.751) (-686.196) (-685.854) [-687.326] * [-687.802] (-687.414) (-686.432) (-688.142) -- 0:00:41
      316000 -- [-685.510] (-687.904) (-687.207) (-690.010) * (-685.463) (-687.567) [-687.860] (-689.067) -- 0:00:41
      316500 -- (-685.795) [-685.673] (-685.885) (-686.153) * [-685.308] (-689.212) (-685.580) (-688.306) -- 0:00:41
      317000 -- (-687.911) [-685.981] (-686.351) (-686.739) * (-684.776) (-690.950) [-685.289] (-688.022) -- 0:00:40
      317500 -- (-686.697) (-687.637) [-686.399] (-686.115) * (-685.583) (-686.660) (-684.967) [-686.817] -- 0:00:40
      318000 -- (-687.611) [-686.486] (-685.629) (-688.189) * (-689.417) (-693.581) [-686.922] (-685.120) -- 0:00:40
      318500 -- (-685.467) (-686.500) [-688.214] (-685.612) * [-686.205] (-687.852) (-687.469) (-688.310) -- 0:00:40
      319000 -- (-687.011) (-685.600) [-688.598] (-688.405) * [-687.710] (-685.702) (-685.503) (-687.654) -- 0:00:40
      319500 -- (-686.070) (-688.526) (-685.123) [-684.933] * (-686.567) [-685.931] (-686.120) (-692.954) -- 0:00:40
      320000 -- (-685.927) (-687.176) [-685.123] (-685.270) * (-686.065) [-684.882] (-687.906) (-689.230) -- 0:00:40

      Average standard deviation of split frequencies: 0.016517

      320500 -- (-688.795) (-687.928) [-685.840] (-685.665) * (-687.489) (-686.276) (-684.752) [-687.377] -- 0:00:40
      321000 -- (-687.100) (-692.634) [-686.129] (-687.862) * (-685.179) (-686.474) [-686.134] (-690.167) -- 0:00:40
      321500 -- (-686.301) [-686.742] (-688.797) (-686.997) * (-688.197) (-686.334) [-689.858] (-689.508) -- 0:00:42
      322000 -- (-690.185) (-689.322) (-690.619) [-684.942] * (-688.095) (-687.973) [-684.672] (-698.418) -- 0:00:42
      322500 -- (-685.908) (-688.468) [-688.580] (-688.074) * (-688.012) [-687.704] (-685.242) (-686.971) -- 0:00:42
      323000 -- (-690.634) (-686.528) (-689.522) [-686.149] * [-687.361] (-695.451) (-687.032) (-686.330) -- 0:00:41
      323500 -- (-687.701) (-687.005) [-684.943] (-685.336) * (-685.621) (-695.056) (-689.321) [-685.909] -- 0:00:41
      324000 -- [-687.958] (-689.147) (-686.137) (-686.464) * (-686.629) (-690.246) (-685.427) [-688.194] -- 0:00:41
      324500 -- (-684.879) (-686.689) (-688.916) [-684.742] * (-691.843) (-686.407) [-685.900] (-685.927) -- 0:00:41
      325000 -- [-685.434] (-685.806) (-686.794) (-685.855) * (-685.913) [-685.718] (-687.284) (-684.753) -- 0:00:41

      Average standard deviation of split frequencies: 0.015736

      325500 -- [-686.997] (-687.261) (-685.741) (-687.506) * (-686.248) (-687.413) (-685.524) [-685.683] -- 0:00:41
      326000 -- (-690.743) [-686.496] (-695.524) (-690.052) * [-687.865] (-686.909) (-686.364) (-686.387) -- 0:00:41
      326500 -- (-686.078) [-685.943] (-687.083) (-690.058) * (-685.989) (-685.126) (-689.758) [-687.286] -- 0:00:41
      327000 -- (-690.603) (-687.279) (-686.331) [-686.289] * (-686.250) [-685.132] (-686.858) (-685.897) -- 0:00:41
      327500 -- (-686.659) (-685.176) [-686.748] (-686.986) * (-686.695) (-688.194) [-685.220] (-690.283) -- 0:00:41
      328000 -- [-685.737] (-686.606) (-685.956) (-686.734) * (-690.112) (-687.465) (-687.348) [-686.236] -- 0:00:40
      328500 -- (-692.582) (-687.062) [-687.229] (-686.576) * (-689.279) (-686.669) (-686.541) [-685.890] -- 0:00:40
      329000 -- [-688.016] (-686.944) (-689.871) (-688.012) * (-686.146) (-686.967) [-686.906] (-687.915) -- 0:00:40
      329500 -- [-688.326] (-688.027) (-688.164) (-685.310) * [-684.722] (-686.600) (-687.910) (-690.165) -- 0:00:40
      330000 -- (-689.977) (-687.855) [-689.028] (-685.308) * [-685.278] (-691.513) (-688.121) (-687.306) -- 0:00:40

      Average standard deviation of split frequencies: 0.014843

      330500 -- (-689.493) (-692.133) [-687.577] (-685.187) * (-686.048) (-691.787) [-684.906] (-686.949) -- 0:00:40
      331000 -- (-687.697) [-687.235] (-688.230) (-686.763) * (-686.943) (-686.687) (-685.437) [-686.793] -- 0:00:40
      331500 -- (-689.592) [-686.641] (-685.630) (-686.349) * (-688.138) [-687.837] (-685.892) (-685.639) -- 0:00:40
      332000 -- (-687.282) [-688.229] (-686.334) (-685.626) * (-688.932) (-686.556) (-686.052) [-691.054] -- 0:00:40
      332500 -- [-687.855] (-688.374) (-685.777) (-685.990) * (-686.373) (-685.121) [-685.599] (-689.117) -- 0:00:40
      333000 -- [-685.149] (-686.082) (-688.066) (-687.152) * (-687.606) (-685.359) (-685.728) [-687.968] -- 0:00:40
      333500 -- (-685.993) (-685.554) (-686.200) [-687.149] * (-686.024) (-686.543) (-687.981) [-685.742] -- 0:00:39
      334000 -- (-686.634) (-685.102) (-688.089) [-686.032] * (-687.759) [-685.272] (-686.452) (-687.697) -- 0:00:39
      334500 -- [-686.467] (-686.954) (-687.643) (-686.561) * (-687.075) (-685.024) [-686.269] (-686.365) -- 0:00:39
      335000 -- (-685.961) (-687.539) [-685.748] (-689.245) * (-688.885) (-686.133) (-686.049) [-685.854] -- 0:00:39

      Average standard deviation of split frequencies: 0.012978

      335500 -- (-685.476) (-687.127) (-690.347) [-688.014] * (-685.857) (-687.171) [-685.281] (-687.881) -- 0:00:39
      336000 -- (-687.070) (-686.665) [-685.465] (-685.471) * (-687.712) [-688.510] (-685.472) (-685.880) -- 0:00:39
      336500 -- (-688.626) (-691.963) (-688.270) [-688.079] * [-688.668] (-687.309) (-687.878) (-689.216) -- 0:00:39
      337000 -- (-687.493) (-685.490) (-687.352) [-687.500] * (-687.279) [-686.461] (-686.911) (-687.308) -- 0:00:39
      337500 -- (-691.539) (-685.501) [-686.848] (-686.228) * (-686.324) (-687.965) [-686.571] (-687.723) -- 0:00:39
      338000 -- (-687.594) (-685.200) (-691.831) [-686.456] * [-684.937] (-687.568) (-685.233) (-686.876) -- 0:00:41
      338500 -- (-689.824) (-684.898) (-688.626) [-685.912] * (-685.926) (-685.854) [-685.766] (-694.272) -- 0:00:41
      339000 -- (-687.954) (-686.035) [-688.882] (-687.454) * [-684.558] (-688.824) (-686.936) (-686.095) -- 0:00:40
      339500 -- [-685.234] (-689.548) (-686.981) (-687.860) * (-686.076) (-690.588) [-690.129] (-691.284) -- 0:00:40
      340000 -- (-686.784) (-685.230) (-684.988) [-687.176] * [-690.742] (-685.662) (-686.689) (-688.154) -- 0:00:40

      Average standard deviation of split frequencies: 0.013405

      340500 -- [-687.706] (-686.424) (-686.076) (-687.463) * (-685.619) (-687.073) [-686.620] (-686.332) -- 0:00:40
      341000 -- (-688.159) (-686.553) (-685.173) [-686.691] * (-685.301) (-685.646) [-684.932] (-686.890) -- 0:00:40
      341500 -- (-688.109) (-687.848) (-687.264) [-685.515] * (-687.048) (-685.175) [-685.636] (-686.447) -- 0:00:40
      342000 -- [-687.191] (-690.956) (-686.325) (-685.478) * (-686.995) (-687.550) (-685.525) [-687.738] -- 0:00:40
      342500 -- (-686.377) (-690.512) (-684.903) [-687.595] * (-687.158) [-685.633] (-690.068) (-687.293) -- 0:00:40
      343000 -- (-686.001) (-688.773) [-685.480] (-685.196) * (-685.728) (-686.371) [-687.950] (-686.328) -- 0:00:40
      343500 -- (-689.101) (-690.140) (-686.293) [-686.239] * (-685.317) (-685.444) [-687.802] (-686.867) -- 0:00:40
      344000 -- [-687.484] (-687.118) (-687.348) (-688.511) * [-686.247] (-686.160) (-686.012) (-687.236) -- 0:00:40
      344500 -- (-691.195) (-685.114) [-685.831] (-687.848) * [-685.332] (-687.923) (-686.155) (-687.266) -- 0:00:39
      345000 -- (-686.881) [-686.826] (-684.965) (-687.944) * (-686.072) [-689.409] (-686.339) (-685.383) -- 0:00:39

      Average standard deviation of split frequencies: 0.013304

      345500 -- (-688.327) [-685.944] (-685.932) (-687.648) * [-688.956] (-689.017) (-686.175) (-688.733) -- 0:00:39
      346000 -- (-686.224) [-686.174] (-685.897) (-686.410) * (-687.227) (-687.941) (-685.506) [-687.268] -- 0:00:39
      346500 -- (-685.713) [-687.742] (-685.630) (-686.013) * [-687.057] (-692.513) (-686.657) (-689.182) -- 0:00:39
      347000 -- [-687.207] (-687.050) (-687.646) (-686.214) * (-693.218) [-685.825] (-686.277) (-689.148) -- 0:00:39
      347500 -- (-687.571) [-685.707] (-687.904) (-686.195) * (-686.038) (-685.046) [-691.158] (-690.225) -- 0:00:39
      348000 -- [-687.432] (-685.872) (-689.094) (-687.612) * (-685.626) [-686.015] (-685.743) (-686.261) -- 0:00:39
      348500 -- (-685.522) (-685.035) [-685.593] (-685.806) * (-685.433) (-685.848) (-685.536) [-687.363] -- 0:00:39
      349000 -- (-684.564) (-688.176) [-689.795] (-685.694) * (-685.594) (-686.257) (-686.079) [-689.249] -- 0:00:39
      349500 -- (-684.658) (-687.232) [-686.777] (-687.941) * [-687.397] (-686.437) (-686.703) (-685.906) -- 0:00:39
      350000 -- (-685.418) [-685.141] (-689.600) (-687.759) * (-684.668) [-689.332] (-688.083) (-689.262) -- 0:00:39

      Average standard deviation of split frequencies: 0.012731

      350500 -- (-687.614) (-685.951) (-686.813) [-687.509] * [-688.723] (-687.847) (-688.139) (-688.026) -- 0:00:38
      351000 -- [-686.534] (-688.806) (-688.365) (-687.766) * (-689.314) (-687.448) (-685.099) [-685.692] -- 0:00:38
      351500 -- (-686.385) [-687.441] (-685.795) (-685.254) * (-688.116) (-685.519) [-686.035] (-685.243) -- 0:00:38
      352000 -- [-685.354] (-686.728) (-687.133) (-686.310) * [-690.678] (-686.895) (-691.648) (-687.027) -- 0:00:38
      352500 -- (-687.297) [-686.945] (-688.023) (-689.111) * (-688.802) (-686.309) (-685.979) [-686.704] -- 0:00:38
      353000 -- [-693.740] (-687.608) (-689.855) (-686.897) * [-686.630] (-689.791) (-685.404) (-688.098) -- 0:00:38
      353500 -- [-687.872] (-685.661) (-687.839) (-688.431) * [-686.837] (-685.440) (-685.343) (-689.464) -- 0:00:38
      354000 -- [-685.703] (-687.304) (-686.535) (-688.816) * (-689.069) [-687.478] (-686.923) (-687.883) -- 0:00:38
      354500 -- (-684.832) [-686.063] (-686.953) (-686.154) * (-689.325) (-687.546) [-685.874] (-685.968) -- 0:00:38
      355000 -- (-684.877) [-687.428] (-687.265) (-689.150) * (-687.232) [-690.299] (-690.006) (-685.728) -- 0:00:39

      Average standard deviation of split frequencies: 0.013573

      355500 -- (-687.389) [-687.378] (-684.994) (-688.144) * (-686.986) [-685.731] (-688.472) (-686.616) -- 0:00:39
      356000 -- (-693.080) [-685.606] (-688.736) (-686.292) * (-687.041) (-686.299) (-688.454) [-686.616] -- 0:00:39
      356500 -- [-687.163] (-684.721) (-688.611) (-687.190) * (-688.222) [-686.116] (-686.454) (-693.432) -- 0:00:39
      357000 -- (-687.432) (-686.639) (-690.553) [-687.499] * (-688.951) (-685.837) (-688.883) [-685.587] -- 0:00:39
      357500 -- (-690.462) (-686.404) (-692.276) [-688.344] * [-688.964] (-687.121) (-688.274) (-689.221) -- 0:00:39
      358000 -- [-687.058] (-686.779) (-690.210) (-686.004) * (-691.008) (-686.234) [-685.678] (-687.446) -- 0:00:39
      358500 -- [-686.223] (-685.334) (-689.594) (-686.475) * (-695.813) [-684.944] (-685.119) (-686.446) -- 0:00:39
      359000 -- [-685.109] (-688.731) (-690.644) (-686.946) * [-684.796] (-685.388) (-691.074) (-688.245) -- 0:00:39
      359500 -- [-685.573] (-687.197) (-686.544) (-686.969) * (-685.222) (-685.404) [-687.885] (-685.929) -- 0:00:39
      360000 -- (-688.090) (-686.408) [-687.667] (-685.991) * (-685.543) (-687.907) (-685.048) [-685.672] -- 0:00:39

      Average standard deviation of split frequencies: 0.014070

      360500 -- [-686.741] (-692.627) (-686.544) (-686.761) * (-685.506) (-686.011) (-690.040) [-687.062] -- 0:00:39
      361000 -- (-688.156) (-689.853) [-684.531] (-685.665) * (-685.075) [-685.303] (-686.490) (-687.910) -- 0:00:38
      361500 -- (-690.712) (-690.224) (-689.486) [-686.295] * (-690.558) (-684.968) [-686.634] (-685.957) -- 0:00:38
      362000 -- (-687.263) (-686.833) (-688.195) [-687.051] * (-685.541) (-685.896) (-690.288) [-686.156] -- 0:00:38
      362500 -- (-688.984) (-691.322) (-690.178) [-687.763] * (-685.342) [-686.607] (-689.766) (-685.861) -- 0:00:38
      363000 -- [-686.399] (-692.167) (-687.842) (-686.472) * (-687.963) (-685.906) (-687.254) [-685.760] -- 0:00:38
      363500 -- [-684.872] (-686.150) (-688.006) (-684.899) * [-687.063] (-686.302) (-686.192) (-691.140) -- 0:00:38
      364000 -- [-688.511] (-685.357) (-687.768) (-684.644) * (-686.816) [-685.427] (-689.063) (-687.983) -- 0:00:38
      364500 -- (-692.428) (-685.776) (-688.723) [-687.973] * [-688.653] (-687.135) (-687.695) (-686.262) -- 0:00:38
      365000 -- (-693.042) (-687.011) [-687.332] (-688.105) * [-686.402] (-687.608) (-688.276) (-685.037) -- 0:00:38

      Average standard deviation of split frequencies: 0.013183

      365500 -- (-690.496) (-687.622) (-688.885) [-688.722] * (-686.066) (-684.773) (-685.197) [-685.574] -- 0:00:38
      366000 -- [-689.462] (-689.744) (-687.394) (-690.204) * (-687.295) (-684.918) (-690.429) [-685.298] -- 0:00:38
      366500 -- (-687.591) (-686.663) (-685.055) [-685.510] * (-686.813) (-687.646) (-687.682) [-686.917] -- 0:00:38
      367000 -- (-686.169) [-684.848] (-686.752) (-685.503) * [-687.239] (-690.932) (-687.442) (-688.658) -- 0:00:37
      367500 -- (-688.826) [-686.835] (-685.639) (-685.849) * [-685.993] (-684.848) (-686.037) (-687.931) -- 0:00:37
      368000 -- (-686.279) (-687.277) (-686.831) [-687.399] * (-687.092) [-685.939] (-693.083) (-684.883) -- 0:00:37
      368500 -- (-684.993) (-686.790) (-686.509) [-690.801] * (-687.589) (-686.855) [-689.274] (-686.508) -- 0:00:37
      369000 -- (-685.865) (-685.027) (-688.995) [-685.589] * (-687.584) (-688.059) (-685.393) [-685.114] -- 0:00:37
      369500 -- (-685.366) [-686.997] (-688.013) (-685.243) * (-691.289) (-685.436) [-686.628] (-687.707) -- 0:00:37
      370000 -- (-687.345) (-690.645) (-690.297) [-685.071] * (-688.779) [-686.156] (-691.163) (-689.255) -- 0:00:37

      Average standard deviation of split frequencies: 0.012867

      370500 -- (-687.043) [-685.995] (-687.086) (-687.958) * (-687.233) (-686.155) (-686.500) [-687.031] -- 0:00:37
      371000 -- (-685.500) [-690.415] (-685.179) (-686.583) * (-687.341) (-688.701) (-686.558) [-686.032] -- 0:00:38
      371500 -- (-685.357) (-689.901) [-687.399] (-686.074) * (-687.719) [-686.710] (-685.399) (-687.874) -- 0:00:38
      372000 -- (-689.425) [-687.774] (-690.212) (-684.633) * (-685.917) (-687.206) (-687.008) [-689.191] -- 0:00:38
      372500 -- (-688.824) (-687.761) (-689.192) [-684.727] * (-688.542) (-687.895) [-689.680] (-691.033) -- 0:00:38
      373000 -- (-687.429) (-687.814) (-688.749) [-688.502] * (-687.326) (-687.544) (-687.823) [-687.243] -- 0:00:38
      373500 -- (-685.786) [-687.342] (-686.139) (-687.777) * (-687.770) [-686.208] (-685.080) (-689.018) -- 0:00:38
      374000 -- (-692.413) (-687.731) [-685.240] (-687.552) * [-684.650] (-685.585) (-687.525) (-688.026) -- 0:00:38
      374500 -- (-686.815) [-686.121] (-689.800) (-686.179) * (-686.732) [-687.506] (-686.833) (-686.685) -- 0:00:38
      375000 -- (-685.212) (-687.640) (-692.257) [-684.616] * (-686.690) (-686.902) (-685.053) [-685.651] -- 0:00:38

      Average standard deviation of split frequencies: 0.013349

      375500 -- (-686.273) (-686.275) (-688.848) [-688.218] * [-685.192] (-687.313) (-686.147) (-685.240) -- 0:00:38
      376000 -- (-687.742) (-685.051) [-685.606] (-685.049) * (-690.974) (-688.955) [-687.331] (-687.045) -- 0:00:38
      376500 -- [-686.919] (-686.680) (-685.388) (-687.760) * (-686.945) (-687.708) [-687.290] (-687.915) -- 0:00:38
      377000 -- [-689.786] (-685.881) (-685.721) (-685.129) * (-687.609) (-685.764) [-686.094] (-686.064) -- 0:00:38
      377500 -- (-685.853) [-686.517] (-684.833) (-685.415) * (-689.622) (-685.463) [-686.867] (-686.503) -- 0:00:37
      378000 -- (-688.000) (-686.591) (-687.937) [-686.783] * (-686.573) (-687.102) [-686.163] (-686.578) -- 0:00:37
      378500 -- (-686.195) [-688.839] (-691.542) (-687.897) * (-686.026) [-685.873] (-688.878) (-696.604) -- 0:00:37
      379000 -- [-686.806] (-685.669) (-685.504) (-691.230) * (-687.668) (-688.301) (-686.930) [-687.033] -- 0:00:37
      379500 -- (-686.823) (-687.610) [-684.868] (-685.820) * (-687.697) (-685.118) [-686.445] (-686.746) -- 0:00:37
      380000 -- (-690.309) [-689.018] (-684.987) (-686.986) * (-686.098) (-686.551) [-686.407] (-686.240) -- 0:00:37

      Average standard deviation of split frequencies: 0.013140

      380500 -- (-690.642) [-688.409] (-685.095) (-685.479) * [-685.630] (-688.103) (-685.276) (-689.718) -- 0:00:37
      381000 -- (-692.818) (-686.306) (-687.630) [-687.022] * (-686.667) (-687.866) [-690.538] (-688.015) -- 0:00:37
      381500 -- (-686.829) (-689.570) (-685.494) [-685.649] * [-684.994] (-688.427) (-689.625) (-687.195) -- 0:00:37
      382000 -- (-688.611) (-686.845) [-685.473] (-688.448) * (-686.418) [-689.506] (-685.065) (-687.371) -- 0:00:37
      382500 -- (-689.816) (-685.949) (-688.233) [-685.704] * (-686.328) (-687.605) (-685.343) [-686.634] -- 0:00:37
      383000 -- (-686.080) [-686.481] (-685.398) (-689.352) * (-685.650) (-687.355) [-685.208] (-688.739) -- 0:00:37
      383500 -- [-686.312] (-687.070) (-686.678) (-690.512) * (-685.650) [-684.701] (-686.718) (-689.688) -- 0:00:36
      384000 -- (-687.626) (-687.038) [-685.872] (-691.245) * (-685.214) (-689.107) [-685.170] (-686.921) -- 0:00:36
      384500 -- (-687.116) [-686.802] (-687.281) (-689.473) * (-685.456) (-690.942) [-686.806] (-686.873) -- 0:00:36
      385000 -- (-687.493) (-689.446) (-685.008) [-686.666] * (-688.672) [-686.666] (-686.043) (-689.247) -- 0:00:36

      Average standard deviation of split frequencies: 0.013773

      385500 -- [-687.760] (-688.702) (-688.231) (-686.060) * (-688.955) [-689.192] (-687.411) (-686.373) -- 0:00:36
      386000 -- (-687.989) (-685.820) [-686.803] (-686.719) * [-686.611] (-686.406) (-689.690) (-690.797) -- 0:00:36
      386500 -- (-688.759) [-685.342] (-686.285) (-691.579) * (-685.449) (-687.751) (-689.963) [-686.885] -- 0:00:36
      387000 -- [-687.099] (-685.282) (-687.264) (-687.543) * (-687.934) (-686.872) (-690.886) [-687.884] -- 0:00:36
      387500 -- (-687.657) (-687.865) [-685.651] (-684.986) * (-684.965) (-687.225) (-686.785) [-685.643] -- 0:00:36
      388000 -- (-686.510) [-689.646] (-690.258) (-685.288) * (-687.011) [-686.126] (-687.324) (-686.658) -- 0:00:37
      388500 -- [-684.970] (-686.266) (-688.247) (-687.364) * (-697.159) (-685.223) (-685.643) [-686.068] -- 0:00:37
      389000 -- (-687.979) (-687.091) (-689.570) [-686.885] * (-694.154) (-686.965) (-685.552) [-687.119] -- 0:00:37
      389500 -- (-688.666) [-686.905] (-688.374) (-689.059) * (-699.311) (-688.144) (-686.897) [-686.430] -- 0:00:37
      390000 -- (-690.369) [-687.798] (-686.482) (-688.119) * [-691.277] (-685.369) (-685.502) (-686.982) -- 0:00:37

      Average standard deviation of split frequencies: 0.014346

      390500 -- (-684.508) (-686.975) [-686.195] (-685.800) * [-685.256] (-686.081) (-685.785) (-690.064) -- 0:00:37
      391000 -- (-685.865) (-685.711) [-687.937] (-690.742) * (-687.819) [-689.040] (-685.984) (-690.863) -- 0:00:37
      391500 -- [-685.796] (-685.890) (-689.162) (-685.436) * (-689.793) [-686.394] (-686.393) (-689.312) -- 0:00:37
      392000 -- (-685.363) (-688.444) (-688.836) [-686.952] * [-688.205] (-687.986) (-689.810) (-687.960) -- 0:00:37
      392500 -- (-685.598) [-686.977] (-685.068) (-692.457) * (-685.919) [-688.390] (-690.201) (-691.737) -- 0:00:37
      393000 -- (-685.055) (-686.603) (-685.038) [-686.143] * (-687.102) [-685.008] (-687.091) (-686.036) -- 0:00:37
      393500 -- (-686.958) (-690.849) [-686.596] (-688.560) * (-686.413) (-685.327) [-687.652] (-685.986) -- 0:00:36
      394000 -- (-688.257) (-685.970) (-688.022) [-688.236] * (-686.648) (-685.252) (-687.785) [-687.296] -- 0:00:36
      394500 -- (-687.694) [-685.596] (-686.004) (-691.700) * (-686.925) (-689.696) (-687.606) [-687.973] -- 0:00:36
      395000 -- (-685.407) [-686.832] (-687.055) (-692.155) * (-688.469) (-689.956) [-685.397] (-688.021) -- 0:00:36

      Average standard deviation of split frequencies: 0.014087

      395500 -- (-686.411) [-686.930] (-688.361) (-687.586) * (-686.313) (-685.117) (-689.084) [-686.729] -- 0:00:36
      396000 -- (-685.309) (-686.180) [-686.921] (-687.532) * [-686.899] (-688.657) (-685.824) (-685.902) -- 0:00:36
      396500 -- (-685.245) [-686.510] (-687.394) (-687.031) * (-685.546) (-689.802) (-685.665) [-687.263] -- 0:00:36
      397000 -- (-687.790) (-686.223) [-686.189] (-688.887) * (-685.674) (-689.867) (-685.501) [-686.991] -- 0:00:36
      397500 -- (-685.347) [-690.172] (-689.698) (-688.679) * (-686.132) (-686.673) (-686.465) [-685.563] -- 0:00:36
      398000 -- (-687.368) (-690.785) [-689.023] (-686.620) * [-686.373] (-685.389) (-687.446) (-686.637) -- 0:00:36
      398500 -- [-685.434] (-685.353) (-689.752) (-684.963) * (-690.245) [-686.083] (-686.408) (-688.358) -- 0:00:36
      399000 -- (-686.833) (-690.098) (-684.846) [-685.594] * (-687.022) (-686.268) (-686.247) [-687.052] -- 0:00:36
      399500 -- (-686.978) [-687.510] (-685.226) (-686.329) * (-687.815) (-687.054) (-687.488) [-688.590] -- 0:00:36
      400000 -- (-687.150) [-687.408] (-686.967) (-688.087) * (-686.711) [-685.888] (-687.139) (-689.853) -- 0:00:36

      Average standard deviation of split frequencies: 0.013726

      400500 -- (-687.302) [-686.791] (-686.205) (-686.878) * (-686.198) (-685.731) [-685.492] (-686.419) -- 0:00:35
      401000 -- (-689.447) (-686.270) (-695.175) [-685.880] * (-688.529) (-687.612) [-686.062] (-684.823) -- 0:00:35
      401500 -- [-689.079] (-685.603) (-690.892) (-685.590) * [-686.213] (-690.755) (-685.536) (-685.445) -- 0:00:35
      402000 -- (-689.922) (-690.113) [-689.940] (-688.325) * [-686.234] (-688.613) (-685.348) (-687.382) -- 0:00:35
      402500 -- (-687.363) (-687.893) [-685.928] (-691.120) * (-685.913) (-692.714) [-684.936] (-684.732) -- 0:00:35
      403000 -- (-687.782) [-685.562] (-685.655) (-686.942) * (-686.529) (-692.882) (-686.637) [-687.207] -- 0:00:35
      403500 -- (-694.427) [-687.620] (-686.327) (-685.646) * (-687.719) (-688.067) (-686.317) [-688.470] -- 0:00:35
      404000 -- (-688.375) [-685.819] (-685.444) (-686.465) * (-684.757) [-690.982] (-688.829) (-686.123) -- 0:00:35
      404500 -- (-686.270) [-686.622] (-685.300) (-686.344) * (-686.270) (-686.209) (-686.979) [-685.939] -- 0:00:35
      405000 -- [-685.809] (-686.207) (-688.222) (-686.182) * [-686.017] (-684.873) (-687.415) (-685.046) -- 0:00:36

      Average standard deviation of split frequencies: 0.013159

      405500 -- (-686.040) [-687.001] (-686.463) (-690.023) * (-689.071) (-685.592) (-695.397) [-687.062] -- 0:00:36
      406000 -- (-689.436) (-689.326) (-687.581) [-688.950] * (-687.837) (-691.681) (-690.819) [-687.645] -- 0:00:36
      406500 -- (-685.845) [-684.639] (-689.270) (-688.159) * (-686.694) [-686.364] (-689.147) (-687.060) -- 0:00:36
      407000 -- (-688.120) (-686.556) (-687.603) [-687.211] * (-688.178) (-687.434) [-688.055] (-685.555) -- 0:00:36
      407500 -- (-687.121) [-685.145] (-687.566) (-685.934) * (-688.927) (-686.115) [-685.668] (-687.120) -- 0:00:36
      408000 -- [-685.995] (-686.217) (-689.342) (-686.322) * (-688.381) (-686.450) [-685.566] (-687.649) -- 0:00:36
      408500 -- (-688.057) (-688.608) (-686.921) [-686.512] * [-686.792] (-685.639) (-688.469) (-689.152) -- 0:00:36
      409000 -- (-689.563) [-685.974] (-688.113) (-685.158) * [-687.367] (-685.850) (-686.702) (-692.690) -- 0:00:36
      409500 -- (-685.654) (-686.938) (-690.098) [-689.291] * (-685.468) (-686.084) [-686.470] (-686.215) -- 0:00:36
      410000 -- [-685.575] (-693.763) (-685.680) (-686.786) * (-690.442) [-690.853] (-685.621) (-685.545) -- 0:00:35

      Average standard deviation of split frequencies: 0.013392

      410500 -- [-684.680] (-686.092) (-692.697) (-686.480) * [-688.566] (-687.199) (-687.184) (-687.399) -- 0:00:35
      411000 -- (-687.491) (-684.954) [-687.972] (-688.144) * [-687.398] (-686.212) (-688.480) (-689.269) -- 0:00:35
      411500 -- [-689.135] (-686.598) (-688.207) (-689.405) * (-688.165) [-685.107] (-686.956) (-687.378) -- 0:00:35
      412000 -- (-691.461) [-686.771] (-684.789) (-689.277) * (-688.556) (-690.570) [-687.024] (-688.012) -- 0:00:35
      412500 -- [-690.550] (-684.982) (-689.161) (-686.105) * (-686.356) (-687.693) (-688.109) [-685.454] -- 0:00:35
      413000 -- (-691.967) [-685.784] (-684.855) (-685.073) * (-687.433) (-690.402) [-686.350] (-686.436) -- 0:00:35
      413500 -- (-687.427) (-685.433) [-689.663] (-685.211) * (-686.448) (-689.830) (-690.345) [-685.329] -- 0:00:35
      414000 -- (-686.185) (-684.949) (-686.685) [-685.121] * (-685.273) (-685.160) (-686.743) [-686.654] -- 0:00:35
      414500 -- (-689.224) (-687.198) [-686.642] (-684.829) * (-685.349) (-687.665) [-688.414] (-685.420) -- 0:00:35
      415000 -- (-687.897) (-688.087) (-685.595) [-686.675] * [-687.718] (-685.803) (-689.011) (-685.793) -- 0:00:35

      Average standard deviation of split frequencies: 0.013332

      415500 -- (-690.548) (-686.494) (-687.293) [-686.735] * [-687.843] (-687.166) (-686.680) (-685.799) -- 0:00:35
      416000 -- [-686.286] (-687.315) (-685.060) (-687.618) * (-690.980) [-686.698] (-688.192) (-687.451) -- 0:00:35
      416500 -- [-685.761] (-686.843) (-687.697) (-687.441) * [-687.703] (-688.236) (-689.750) (-685.216) -- 0:00:35
      417000 -- (-690.660) [-693.835] (-688.319) (-689.088) * (-688.126) (-685.167) [-686.187] (-685.484) -- 0:00:34
      417500 -- (-693.448) (-689.215) [-686.977] (-696.173) * (-687.075) [-684.965] (-691.714) (-685.874) -- 0:00:34
      418000 -- (-688.080) (-688.416) (-686.480) [-691.019] * [-687.600] (-685.041) (-687.467) (-691.329) -- 0:00:34
      418500 -- (-685.702) (-688.407) [-685.238] (-686.864) * (-686.160) (-686.449) (-688.583) [-686.414] -- 0:00:34
      419000 -- (-687.226) (-685.813) (-685.690) [-685.277] * (-687.242) (-686.222) [-690.186] (-688.857) -- 0:00:34
      419500 -- (-685.911) (-685.861) [-686.107] (-687.570) * [-688.841] (-686.307) (-688.537) (-689.242) -- 0:00:34
      420000 -- [-685.990] (-688.139) (-687.397) (-686.446) * (-685.798) (-687.214) (-687.586) [-686.973] -- 0:00:34

      Average standard deviation of split frequencies: 0.013579

      420500 -- (-695.451) (-685.715) (-687.166) [-686.368] * [-686.016] (-688.604) (-687.315) (-686.634) -- 0:00:35
      421000 -- (-685.759) (-685.999) (-689.959) [-684.881] * (-688.865) (-685.844) (-688.669) [-684.905] -- 0:00:35
      421500 -- (-684.738) (-687.219) (-687.009) [-685.028] * [-685.297] (-686.669) (-693.375) (-686.030) -- 0:00:35
      422000 -- (-684.698) (-685.854) [-688.166] (-693.417) * (-685.725) (-689.277) [-688.926] (-689.540) -- 0:00:35
      422500 -- [-687.494] (-686.345) (-685.329) (-689.515) * [-687.085] (-688.828) (-687.097) (-686.716) -- 0:00:35
      423000 -- (-686.033) (-688.042) [-686.062] (-689.978) * (-686.983) [-687.926] (-687.885) (-689.659) -- 0:00:35
      423500 -- [-687.427] (-687.997) (-686.954) (-687.939) * (-687.545) [-688.049] (-691.168) (-686.430) -- 0:00:35
      424000 -- (-685.135) (-687.091) (-686.572) [-685.903] * [-686.289] (-687.353) (-688.388) (-685.087) -- 0:00:35
      424500 -- (-686.066) (-686.071) (-686.737) [-686.612] * [-687.087] (-685.555) (-685.833) (-686.277) -- 0:00:35
      425000 -- [-688.418] (-685.287) (-686.605) (-686.526) * (-688.828) (-685.677) [-687.252] (-689.763) -- 0:00:35

      Average standard deviation of split frequencies: 0.013735

      425500 -- [-688.517] (-686.169) (-686.671) (-685.795) * [-686.619] (-685.499) (-686.710) (-686.540) -- 0:00:35
      426000 -- (-688.150) (-685.577) [-686.822] (-687.036) * (-688.371) (-687.208) (-690.661) [-688.463] -- 0:00:35
      426500 -- (-685.025) [-688.360] (-686.286) (-687.314) * (-686.815) (-685.983) (-685.990) [-686.439] -- 0:00:34
      427000 -- (-690.744) (-686.303) [-689.599] (-686.414) * (-687.316) (-686.376) (-690.890) [-686.922] -- 0:00:34
      427500 -- (-686.326) (-685.732) (-686.362) [-686.119] * (-686.552) (-687.875) [-685.420] (-687.012) -- 0:00:34
      428000 -- (-686.556) (-690.471) [-685.611] (-686.535) * (-685.609) [-686.047] (-688.054) (-689.009) -- 0:00:34
      428500 -- (-690.418) (-684.869) (-687.716) [-686.566] * (-686.471) (-689.580) [-688.405] (-688.021) -- 0:00:34
      429000 -- (-687.447) (-685.226) (-685.973) [-687.892] * [-687.607] (-684.619) (-686.740) (-691.181) -- 0:00:34
      429500 -- (-686.388) (-685.055) [-684.910] (-686.575) * (-688.056) [-687.001] (-688.385) (-693.025) -- 0:00:34
      430000 -- (-686.297) (-686.816) (-684.852) [-685.011] * [-686.834] (-687.385) (-687.132) (-685.988) -- 0:00:34

      Average standard deviation of split frequencies: 0.013843

      430500 -- (-685.162) [-686.324] (-686.258) (-692.351) * (-688.063) (-685.789) (-687.728) [-688.824] -- 0:00:34
      431000 -- [-684.959] (-685.869) (-685.938) (-695.082) * [-687.227] (-684.808) (-688.266) (-685.245) -- 0:00:34
      431500 -- (-689.619) [-688.213] (-686.299) (-687.798) * (-688.123) [-684.843] (-690.062) (-686.152) -- 0:00:34
      432000 -- (-686.005) (-691.251) (-685.128) [-688.370] * (-686.359) (-684.883) [-686.557] (-691.099) -- 0:00:34
      432500 -- [-685.634] (-685.351) (-690.250) (-686.485) * [-686.067] (-685.349) (-689.900) (-689.520) -- 0:00:34
      433000 -- (-687.004) [-691.992] (-689.743) (-686.717) * (-685.072) (-684.757) [-685.626] (-686.846) -- 0:00:34
      433500 -- [-686.014] (-690.958) (-687.757) (-686.599) * (-687.156) (-687.166) (-686.896) [-686.666] -- 0:00:33
      434000 -- (-686.138) (-688.319) [-685.945] (-686.051) * (-690.020) (-687.137) [-687.556] (-687.976) -- 0:00:33
      434500 -- (-684.892) (-686.002) [-686.005] (-685.872) * (-687.110) [-684.625] (-685.731) (-685.062) -- 0:00:33
      435000 -- (-685.068) [-685.950] (-687.290) (-685.658) * (-687.852) (-685.883) [-687.300] (-687.851) -- 0:00:33

      Average standard deviation of split frequencies: 0.013801

      435500 -- (-686.972) [-684.930] (-686.957) (-690.023) * (-689.771) [-686.559] (-685.370) (-689.893) -- 0:00:33
      436000 -- (-686.930) [-684.899] (-685.977) (-687.600) * (-686.607) [-687.475] (-685.607) (-687.358) -- 0:00:33
      436500 -- (-685.515) (-687.904) (-686.688) [-686.756] * [-687.431] (-686.609) (-685.266) (-689.161) -- 0:00:33
      437000 -- (-686.160) (-685.125) [-685.526] (-687.467) * (-687.545) (-685.224) (-685.993) [-692.778] -- 0:00:34
      437500 -- (-687.313) (-687.634) (-690.829) [-687.777] * (-686.689) (-689.125) [-685.038] (-686.975) -- 0:00:34
      438000 -- (-687.221) (-687.013) (-690.421) [-686.905] * (-687.506) (-686.591) [-685.959] (-686.945) -- 0:00:34
      438500 -- [-686.098] (-687.555) (-685.008) (-685.841) * (-686.240) (-687.880) [-686.820] (-686.185) -- 0:00:34
      439000 -- (-686.804) [-686.866] (-686.299) (-687.648) * (-686.216) (-686.961) [-685.135] (-689.555) -- 0:00:34
      439500 -- (-686.543) [-691.164] (-684.900) (-687.338) * (-686.539) (-685.870) [-684.989] (-686.626) -- 0:00:34
      440000 -- (-686.794) [-689.179] (-688.891) (-693.594) * (-685.089) (-687.811) [-686.542] (-685.148) -- 0:00:34

      Average standard deviation of split frequencies: 0.013439

      440500 -- [-685.370] (-688.770) (-687.040) (-686.954) * (-685.041) (-684.660) [-685.228] (-685.216) -- 0:00:34
      441000 -- (-685.758) (-691.340) (-685.630) [-686.582] * [-685.029] (-688.918) (-688.070) (-688.135) -- 0:00:34
      441500 -- (-692.082) (-691.262) [-687.220] (-685.012) * (-686.379) (-689.643) (-685.415) [-685.174] -- 0:00:34
      442000 -- (-687.685) [-686.692] (-687.101) (-685.565) * (-688.113) (-689.090) (-687.702) [-685.516] -- 0:00:34
      442500 -- [-686.078] (-685.829) (-686.896) (-685.359) * [-685.460] (-689.403) (-689.917) (-685.736) -- 0:00:34
      443000 -- (-685.647) (-686.355) (-685.534) [-685.241] * [-684.983] (-691.411) (-687.657) (-684.907) -- 0:00:33
      443500 -- (-685.080) (-698.676) [-688.362] (-686.253) * (-685.232) (-687.391) (-686.123) [-685.163] -- 0:00:33
      444000 -- (-685.385) (-698.128) [-688.581] (-690.973) * [-685.484] (-686.833) (-687.923) (-684.784) -- 0:00:33
      444500 -- (-686.566) (-691.374) [-687.261] (-690.464) * (-685.058) [-686.996] (-686.714) (-686.154) -- 0:00:33
      445000 -- (-686.485) [-689.413] (-687.595) (-686.684) * (-685.404) (-691.072) [-687.639] (-689.031) -- 0:00:33

      Average standard deviation of split frequencies: 0.014114

      445500 -- (-686.587) (-688.224) (-685.807) [-686.283] * [-685.651] (-689.641) (-690.498) (-689.710) -- 0:00:33
      446000 -- (-688.349) (-686.311) [-686.008] (-691.378) * (-686.137) [-687.453] (-685.575) (-685.817) -- 0:00:33
      446500 -- (-688.012) (-686.754) (-686.000) [-686.181] * (-687.582) (-685.518) (-692.510) [-688.209] -- 0:00:33
      447000 -- (-686.864) (-692.683) (-686.720) [-686.363] * (-690.065) [-685.279] (-695.214) (-688.166) -- 0:00:33
      447500 -- (-685.533) (-688.538) [-687.749] (-687.052) * [-686.887] (-685.840) (-686.888) (-685.574) -- 0:00:33
      448000 -- [-686.084] (-686.630) (-686.625) (-687.862) * [-685.046] (-687.215) (-685.994) (-688.101) -- 0:00:33
      448500 -- [-686.239] (-687.862) (-687.420) (-688.667) * (-688.104) (-687.234) [-685.335] (-685.584) -- 0:00:33
      449000 -- [-686.644] (-686.291) (-685.434) (-689.551) * (-687.345) (-687.508) (-686.766) [-686.690] -- 0:00:33
      449500 -- [-688.272] (-689.896) (-690.070) (-688.889) * (-686.725) [-686.875] (-688.438) (-689.630) -- 0:00:33
      450000 -- (-688.117) (-687.485) (-690.070) [-687.548] * [-688.724] (-690.166) (-687.528) (-686.394) -- 0:00:33

      Average standard deviation of split frequencies: 0.014710

      450500 -- (-685.838) [-685.179] (-688.408) (-687.952) * (-687.629) (-690.317) [-691.050] (-689.075) -- 0:00:32
      451000 -- (-686.140) (-687.070) [-688.456] (-688.218) * [-686.236] (-688.195) (-687.146) (-689.081) -- 0:00:32
      451500 -- (-687.412) (-684.705) [-687.620] (-688.470) * (-685.947) (-694.094) (-687.404) [-687.118] -- 0:00:32
      452000 -- (-685.708) [-684.840] (-686.549) (-687.119) * [-685.436] (-686.755) (-686.289) (-687.293) -- 0:00:32
      452500 -- (-684.707) [-684.840] (-685.601) (-685.447) * (-690.663) (-688.661) [-685.686] (-686.365) -- 0:00:32
      453000 -- (-686.578) (-686.317) [-685.919] (-687.337) * [-686.593] (-689.611) (-689.245) (-686.273) -- 0:00:32
      453500 -- (-686.721) [-687.083] (-687.917) (-690.837) * (-687.006) [-687.775] (-688.184) (-685.597) -- 0:00:32
      454000 -- (-686.224) (-686.748) [-689.293] (-688.747) * [-685.953] (-686.341) (-686.998) (-685.564) -- 0:00:33
      454500 -- [-687.912] (-688.772) (-689.064) (-687.568) * [-687.225] (-685.686) (-687.214) (-687.227) -- 0:00:33
      455000 -- (-691.591) (-688.743) [-685.340] (-688.261) * (-685.319) [-686.192] (-688.123) (-686.132) -- 0:00:33

      Average standard deviation of split frequencies: 0.014731

      455500 -- (-689.006) (-687.215) [-686.585] (-686.330) * [-687.070] (-686.352) (-689.465) (-684.515) -- 0:00:33
      456000 -- (-686.490) (-687.777) (-685.140) [-685.118] * (-688.601) [-685.487] (-685.763) (-685.891) -- 0:00:33
      456500 -- [-686.716] (-688.199) (-684.644) (-693.159) * (-686.251) [-686.597] (-687.467) (-686.355) -- 0:00:33
      457000 -- [-687.236] (-692.459) (-687.348) (-687.889) * (-684.980) (-689.740) [-686.290] (-685.316) -- 0:00:33
      457500 -- (-688.374) (-690.000) [-685.297] (-688.496) * (-686.529) (-685.014) (-693.543) [-686.603] -- 0:00:33
      458000 -- [-686.486] (-688.226) (-689.902) (-686.042) * [-689.551] (-686.423) (-688.340) (-687.027) -- 0:00:33
      458500 -- (-686.155) (-685.204) [-686.203] (-684.719) * (-688.609) (-689.357) (-689.291) [-685.694] -- 0:00:33
      459000 -- (-684.860) (-686.129) (-686.808) [-686.688] * [-685.769] (-688.279) (-690.478) (-687.356) -- 0:00:33
      459500 -- (-685.607) [-685.337] (-684.856) (-685.710) * (-686.832) (-687.593) [-689.569] (-687.310) -- 0:00:32
      460000 -- (-686.690) (-686.729) (-687.978) [-687.738] * (-686.152) (-687.249) (-687.816) [-688.617] -- 0:00:32

      Average standard deviation of split frequencies: 0.014902

      460500 -- (-685.048) (-688.452) [-685.696] (-686.417) * (-686.458) (-686.169) (-687.706) [-687.203] -- 0:00:32
      461000 -- (-685.461) (-688.620) [-686.440] (-686.040) * (-686.159) (-689.718) (-686.186) [-686.209] -- 0:00:32
      461500 -- (-686.927) [-685.663] (-687.597) (-686.605) * (-686.081) (-685.431) (-686.345) [-685.985] -- 0:00:32
      462000 -- (-688.692) (-685.109) [-686.724] (-686.962) * (-685.842) (-686.811) (-687.800) [-688.918] -- 0:00:32
      462500 -- (-689.893) (-689.414) [-685.869] (-688.357) * (-685.830) [-686.501] (-686.553) (-685.744) -- 0:00:32
      463000 -- (-687.335) [-688.341] (-685.464) (-687.912) * [-687.087] (-688.119) (-684.746) (-686.134) -- 0:00:32
      463500 -- (-691.540) (-689.733) [-685.599] (-690.475) * (-687.099) (-687.468) (-685.305) [-685.577] -- 0:00:32
      464000 -- (-691.123) (-687.859) (-687.469) [-688.979] * (-699.521) [-686.046] (-686.983) (-685.192) -- 0:00:32
      464500 -- (-687.225) [-685.277] (-687.285) (-687.413) * (-687.741) (-688.099) (-686.203) [-688.953] -- 0:00:32
      465000 -- [-685.613] (-691.106) (-689.320) (-686.408) * (-687.101) (-685.981) [-687.092] (-690.461) -- 0:00:32

      Average standard deviation of split frequencies: 0.014099

      465500 -- (-686.872) (-687.418) (-685.159) [-685.112] * (-690.481) (-685.860) (-686.432) [-687.458] -- 0:00:32
      466000 -- (-685.105) (-689.015) (-686.560) [-684.733] * (-686.525) (-685.594) (-687.514) [-689.699] -- 0:00:32
      466500 -- (-687.576) [-686.162] (-686.616) (-685.499) * (-687.680) (-687.192) [-686.136] (-686.876) -- 0:00:32
      467000 -- (-687.888) (-685.605) [-686.783] (-685.753) * [-689.040] (-689.543) (-687.675) (-686.606) -- 0:00:31
      467500 -- [-686.917] (-686.140) (-686.528) (-687.249) * (-686.512) [-686.469] (-685.551) (-697.757) -- 0:00:31
      468000 -- (-686.589) (-687.048) (-686.963) [-686.311] * (-686.623) (-688.897) (-685.687) [-687.326] -- 0:00:31
      468500 -- (-685.985) [-684.804] (-687.650) (-687.560) * (-688.044) (-687.088) [-685.114] (-689.526) -- 0:00:31
      469000 -- (-686.071) [-686.458] (-685.741) (-685.692) * [-686.835] (-689.351) (-687.129) (-687.096) -- 0:00:31
      469500 -- (-685.664) [-685.271] (-686.255) (-689.279) * (-689.095) (-687.328) (-689.945) [-684.919] -- 0:00:31
      470000 -- (-686.008) (-688.867) (-687.632) [-685.429] * (-688.188) (-689.556) [-687.574] (-687.418) -- 0:00:31

      Average standard deviation of split frequencies: 0.014335

      470500 -- (-685.991) [-687.155] (-686.171) (-685.894) * (-686.258) [-687.623] (-690.588) (-687.445) -- 0:00:32
      471000 -- (-685.745) (-691.362) [-686.240] (-685.066) * (-687.590) [-686.355] (-685.137) (-686.333) -- 0:00:32
      471500 -- (-688.262) (-685.586) (-690.754) [-685.908] * (-685.457) [-686.123] (-685.398) (-688.419) -- 0:00:32
      472000 -- (-687.517) [-686.951] (-684.830) (-691.227) * (-686.233) (-685.804) (-686.183) [-687.200] -- 0:00:32
      472500 -- (-692.504) (-685.078) [-687.639] (-687.639) * (-693.702) (-686.411) (-688.697) [-689.131] -- 0:00:32
      473000 -- [-690.481] (-691.522) (-688.051) (-685.299) * (-686.665) (-686.946) (-688.000) [-687.679] -- 0:00:32
      473500 -- (-685.237) (-686.651) (-688.866) [-688.884] * (-689.691) (-687.395) (-686.271) [-685.793] -- 0:00:32
      474000 -- [-686.625] (-685.860) (-697.004) (-692.426) * [-686.108] (-687.393) (-685.188) (-688.421) -- 0:00:32
      474500 -- (-686.564) (-685.868) (-689.775) [-685.539] * (-686.921) (-688.326) [-685.713] (-687.812) -- 0:00:32
      475000 -- [-686.559] (-686.829) (-689.918) (-686.480) * (-685.235) [-685.317] (-687.711) (-686.753) -- 0:00:32

      Average standard deviation of split frequencies: 0.013803

      475500 -- (-685.034) [-686.360] (-686.469) (-686.420) * (-689.679) (-685.879) (-690.044) [-688.371] -- 0:00:31
      476000 -- (-685.499) (-685.708) [-684.525] (-690.853) * [-686.012] (-686.095) (-690.716) (-687.225) -- 0:00:31
      476500 -- [-685.437] (-685.146) (-685.462) (-685.483) * [-687.363] (-686.787) (-690.534) (-690.358) -- 0:00:31
      477000 -- (-686.671) (-688.730) (-687.820) [-688.868] * (-689.952) (-687.034) (-686.218) [-685.038] -- 0:00:31
      477500 -- (-686.753) (-689.166) [-689.283] (-687.018) * (-689.474) (-686.232) (-688.178) [-688.308] -- 0:00:31
      478000 -- (-687.986) [-687.404] (-687.573) (-687.767) * (-684.923) (-688.271) [-687.290] (-687.505) -- 0:00:31
      478500 -- (-686.542) (-688.587) [-687.589] (-691.986) * (-684.838) (-692.272) [-685.928] (-687.276) -- 0:00:31
      479000 -- (-685.342) [-688.989] (-686.944) (-690.433) * (-685.561) [-689.452] (-687.402) (-690.070) -- 0:00:31
      479500 -- [-685.209] (-685.582) (-686.990) (-686.768) * (-685.042) (-689.764) [-686.603] (-687.165) -- 0:00:31
      480000 -- [-687.688] (-686.183) (-685.678) (-686.566) * (-685.275) [-687.653] (-686.965) (-685.871) -- 0:00:31

      Average standard deviation of split frequencies: 0.013669

      480500 -- [-686.833] (-689.959) (-685.249) (-685.940) * (-685.741) (-685.471) [-685.844] (-689.894) -- 0:00:31
      481000 -- (-686.325) (-687.801) (-687.607) [-687.425] * [-685.849] (-687.002) (-688.880) (-686.690) -- 0:00:31
      481500 -- (-687.486) (-685.807) (-689.528) [-685.659] * (-685.219) [-686.861] (-686.524) (-685.688) -- 0:00:31
      482000 -- (-684.962) (-685.164) (-688.336) [-686.528] * (-689.602) [-686.168] (-686.137) (-685.235) -- 0:00:31
      482500 -- [-685.799] (-691.533) (-688.371) (-685.385) * (-687.295) (-686.283) [-685.883] (-686.591) -- 0:00:31
      483000 -- (-685.987) (-687.877) [-686.480] (-692.206) * (-685.823) (-687.140) [-685.311] (-687.044) -- 0:00:31
      483500 -- (-687.133) (-688.259) (-686.981) [-685.672] * (-687.843) (-688.652) [-684.942] (-688.739) -- 0:00:30
      484000 -- (-690.270) [-689.244] (-686.520) (-687.388) * [-685.943] (-687.002) (-685.485) (-687.009) -- 0:00:30
      484500 -- (-687.096) [-688.765] (-685.497) (-686.195) * (-684.643) [-685.075] (-688.825) (-687.841) -- 0:00:30
      485000 -- (-686.216) (-688.466) [-685.437] (-685.159) * (-687.902) (-685.331) (-691.067) [-687.308] -- 0:00:30

      Average standard deviation of split frequencies: 0.012670

      485500 -- (-685.742) [-687.243] (-686.089) (-687.213) * (-689.432) (-687.749) (-687.564) [-688.806] -- 0:00:30
      486000 -- (-689.775) (-685.539) (-687.953) [-687.161] * (-686.628) (-691.071) (-685.018) [-685.905] -- 0:00:30
      486500 -- (-688.325) (-686.210) [-685.205] (-685.750) * (-686.273) [-688.124] (-684.969) (-686.706) -- 0:00:30
      487000 -- (-686.757) (-686.384) [-685.380] (-685.089) * (-685.409) (-691.606) (-691.168) [-688.607] -- 0:00:30
      487500 -- [-686.081] (-686.445) (-690.598) (-684.663) * [-686.890] (-689.757) (-691.031) (-686.662) -- 0:00:31
      488000 -- (-687.960) [-686.507] (-697.839) (-687.351) * (-688.770) (-688.650) [-687.171] (-686.433) -- 0:00:31
      488500 -- (-690.347) (-691.648) [-686.456] (-686.749) * (-688.788) (-685.059) [-685.577] (-686.458) -- 0:00:31
      489000 -- (-689.691) [-685.267] (-688.405) (-687.233) * (-686.871) (-684.970) (-687.761) [-688.364] -- 0:00:31
      489500 -- (-686.508) (-690.351) [-687.985] (-688.625) * (-685.942) [-686.418] (-685.798) (-687.446) -- 0:00:31
      490000 -- (-685.885) (-689.095) (-688.075) [-685.012] * (-687.328) (-686.405) (-687.048) [-685.762] -- 0:00:31

      Average standard deviation of split frequencies: 0.012790

      490500 -- (-687.669) (-688.492) [-687.669] (-685.254) * (-687.531) [-686.951] (-687.054) (-686.998) -- 0:00:31
      491000 -- (-688.059) [-689.787] (-687.079) (-684.894) * (-686.076) (-685.330) (-685.605) [-686.477] -- 0:00:31
      491500 -- (-689.906) (-689.727) [-689.039] (-690.117) * (-686.979) (-685.627) [-687.938] (-686.813) -- 0:00:31
      492000 -- [-688.112] (-686.326) (-685.929) (-688.638) * (-687.295) [-685.873] (-688.756) (-688.869) -- 0:00:30
      492500 -- [-687.059] (-687.446) (-686.496) (-688.463) * (-689.559) (-688.739) [-687.595] (-687.466) -- 0:00:30
      493000 -- (-685.732) (-692.659) [-686.284] (-685.314) * (-688.154) (-688.831) (-686.067) [-685.965] -- 0:00:30
      493500 -- (-689.264) [-685.508] (-688.038) (-686.830) * (-687.383) (-689.910) [-685.762] (-685.672) -- 0:00:30
      494000 -- (-687.625) [-686.689] (-690.207) (-686.751) * (-686.367) (-688.104) (-686.231) [-686.953] -- 0:00:30
      494500 -- (-685.710) [-690.534] (-686.516) (-686.761) * (-686.788) [-688.262] (-686.123) (-687.722) -- 0:00:30
      495000 -- (-685.108) [-688.549] (-690.996) (-686.531) * (-686.064) (-687.617) [-684.969] (-686.445) -- 0:00:30

      Average standard deviation of split frequencies: 0.012474

      495500 -- (-688.978) (-687.164) (-687.485) [-688.235] * (-688.364) [-689.105] (-688.612) (-687.977) -- 0:00:30
      496000 -- [-686.614] (-685.556) (-688.483) (-687.616) * [-690.773] (-686.547) (-689.662) (-686.447) -- 0:00:30
      496500 -- [-686.836] (-687.376) (-688.845) (-686.467) * (-689.082) (-685.992) [-688.873] (-686.407) -- 0:00:30
      497000 -- (-686.519) (-690.627) [-686.073] (-687.236) * [-689.627] (-687.693) (-685.414) (-686.631) -- 0:00:30
      497500 -- (-687.444) [-688.553] (-685.771) (-685.293) * (-689.735) (-690.940) [-685.293] (-688.934) -- 0:00:30
      498000 -- [-687.971] (-687.791) (-685.523) (-687.178) * [-686.296] (-689.917) (-690.012) (-688.860) -- 0:00:30
      498500 -- (-691.421) (-686.340) [-686.734] (-686.653) * [-687.337] (-688.519) (-687.796) (-689.659) -- 0:00:30
      499000 -- (-685.861) (-685.999) [-686.561] (-686.941) * (-690.520) (-685.186) (-686.774) [-685.562] -- 0:00:30
      499500 -- (-690.092) (-685.842) (-688.536) [-687.980] * [-688.879] (-686.549) (-688.334) (-688.426) -- 0:00:30
      500000 -- (-686.728) [-686.852] (-685.995) (-692.736) * (-691.575) (-686.613) [-685.722] (-685.091) -- 0:00:30

      Average standard deviation of split frequencies: 0.012123

      500500 -- [-687.226] (-685.436) (-688.085) (-685.405) * (-688.342) (-687.052) [-686.772] (-686.564) -- 0:00:29
      501000 -- [-686.603] (-690.383) (-688.564) (-686.264) * (-687.078) (-686.427) (-689.211) [-687.922] -- 0:00:29
      501500 -- (-687.522) (-685.414) (-688.861) [-687.251] * [-689.126] (-686.343) (-691.419) (-688.099) -- 0:00:29
      502000 -- (-687.913) [-687.533] (-689.317) (-686.159) * (-688.989) (-685.311) (-687.656) [-685.547] -- 0:00:29
      502500 -- (-689.669) (-685.273) [-689.033] (-686.164) * [-688.265] (-686.174) (-686.100) (-686.584) -- 0:00:29
      503000 -- (-690.835) [-686.340] (-691.648) (-686.023) * (-687.785) (-685.624) [-686.231] (-685.200) -- 0:00:29
      503500 -- [-686.356] (-685.100) (-686.959) (-687.842) * (-688.041) (-688.677) [-685.796] (-687.378) -- 0:00:29
      504000 -- (-685.615) (-685.043) [-687.861] (-689.099) * [-686.340] (-685.837) (-686.218) (-687.544) -- 0:00:29
      504500 -- (-685.202) (-686.129) (-689.372) [-688.303] * [-685.804] (-685.491) (-685.601) (-687.089) -- 0:00:30
      505000 -- (-688.316) (-687.000) [-689.851] (-687.431) * (-685.294) [-687.422] (-685.745) (-687.212) -- 0:00:30

      Average standard deviation of split frequencies: 0.012169

      505500 -- (-686.917) (-689.364) [-687.533] (-690.767) * (-685.261) (-687.610) (-685.563) [-685.752] -- 0:00:30
      506000 -- [-685.984] (-689.916) (-688.441) (-688.039) * (-688.062) [-687.968] (-689.783) (-685.606) -- 0:00:30
      506500 -- (-686.834) [-686.836] (-690.119) (-685.673) * [-686.098] (-686.521) (-687.566) (-687.133) -- 0:00:30
      507000 -- (-686.791) (-684.887) (-687.518) [-689.422] * (-685.943) (-686.685) (-688.797) [-686.306] -- 0:00:30
      507500 -- (-686.195) [-684.878] (-692.936) (-689.922) * (-688.384) [-685.890] (-686.024) (-685.121) -- 0:00:30
      508000 -- (-694.244) (-685.106) [-685.546] (-687.682) * [-685.025] (-687.606) (-686.213) (-692.518) -- 0:00:30
      508500 -- (-688.235) (-685.637) (-686.637) [-691.166] * (-684.996) (-688.807) (-688.028) [-688.995] -- 0:00:29
      509000 -- (-685.693) (-687.805) [-689.886] (-687.536) * [-686.563] (-686.365) (-685.595) (-685.092) -- 0:00:29
      509500 -- (-687.366) (-689.637) [-687.782] (-686.889) * (-685.742) [-685.664] (-688.169) (-687.577) -- 0:00:29
      510000 -- [-686.211] (-687.432) (-686.571) (-686.293) * [-685.763] (-686.899) (-688.484) (-688.403) -- 0:00:29

      Average standard deviation of split frequencies: 0.012174

      510500 -- (-686.646) [-686.077] (-685.768) (-685.408) * (-685.433) [-688.682] (-687.631) (-685.972) -- 0:00:29
      511000 -- [-687.183] (-685.654) (-688.897) (-686.737) * [-685.036] (-687.507) (-686.902) (-686.546) -- 0:00:29
      511500 -- (-687.263) (-688.396) [-685.230] (-687.300) * (-687.513) [-686.302] (-685.560) (-688.574) -- 0:00:29
      512000 -- (-687.313) [-686.093] (-685.003) (-685.905) * (-689.399) [-687.840] (-684.639) (-690.839) -- 0:00:29
      512500 -- (-686.328) [-686.296] (-685.675) (-689.367) * [-686.651] (-685.458) (-690.034) (-690.456) -- 0:00:29
      513000 -- (-685.199) (-689.998) (-686.497) [-686.353] * (-685.744) [-688.987] (-691.051) (-690.538) -- 0:00:29
      513500 -- (-685.509) (-688.408) (-687.505) [-690.610] * [-690.017] (-685.922) (-687.025) (-688.385) -- 0:00:29
      514000 -- [-687.014] (-688.041) (-688.163) (-686.150) * [-687.069] (-686.295) (-686.144) (-685.797) -- 0:00:29
      514500 -- (-685.094) (-687.381) (-688.428) [-686.006] * [-684.790] (-688.148) (-688.118) (-686.674) -- 0:00:29
      515000 -- (-686.912) [-687.275] (-687.763) (-685.466) * (-685.691) [-686.242] (-685.487) (-690.572) -- 0:00:29

      Average standard deviation of split frequencies: 0.012219

      515500 -- (-686.577) [-685.234] (-688.455) (-689.650) * (-685.614) [-685.120] (-685.034) (-688.496) -- 0:00:29
      516000 -- (-690.875) [-687.630] (-686.204) (-689.040) * [-687.852] (-685.874) (-686.874) (-687.703) -- 0:00:29
      516500 -- (-691.897) (-685.527) [-685.862] (-687.842) * (-692.095) (-685.925) (-685.970) [-687.457] -- 0:00:29
      517000 -- (-686.879) [-685.615] (-686.411) (-686.789) * (-691.173) (-686.465) (-688.239) [-686.531] -- 0:00:28
      517500 -- [-687.845] (-686.790) (-690.648) (-686.244) * (-690.480) [-687.333] (-688.089) (-686.693) -- 0:00:28
      518000 -- (-687.020) (-687.276) [-687.480] (-685.248) * [-690.470] (-686.431) (-686.517) (-689.256) -- 0:00:28
      518500 -- (-687.315) (-688.308) (-692.112) [-687.570] * (-684.974) [-686.004] (-686.277) (-686.810) -- 0:00:28
      519000 -- (-692.942) [-685.678] (-688.302) (-686.438) * (-685.473) (-689.911) [-690.553] (-684.935) -- 0:00:28
      519500 -- (-691.994) (-688.002) (-685.776) [-685.769] * (-684.792) [-689.562] (-686.463) (-687.031) -- 0:00:28
      520000 -- (-689.444) (-688.154) (-688.072) [-688.672] * (-686.544) (-685.409) [-688.946] (-687.021) -- 0:00:28

      Average standard deviation of split frequencies: 0.012449

      520500 -- [-686.278] (-686.754) (-688.729) (-685.415) * (-689.692) (-685.420) [-687.288] (-685.234) -- 0:00:28
      521000 -- (-685.969) (-686.572) [-688.770] (-685.980) * [-689.785] (-684.929) (-686.083) (-686.801) -- 0:00:29
      521500 -- [-687.105] (-687.245) (-687.980) (-685.819) * [-692.443] (-688.379) (-687.309) (-687.757) -- 0:00:29
      522000 -- (-687.591) [-690.347] (-687.940) (-685.613) * [-688.907] (-687.616) (-685.596) (-686.545) -- 0:00:29
      522500 -- (-685.710) (-693.773) (-686.066) [-686.478] * (-686.381) (-685.869) [-687.519] (-687.322) -- 0:00:29
      523000 -- (-688.242) (-689.768) (-687.714) [-685.170] * (-688.582) [-686.032] (-686.424) (-687.837) -- 0:00:29
      523500 -- (-686.448) (-689.328) [-688.909] (-687.008) * (-687.262) [-687.516] (-688.305) (-696.637) -- 0:00:29
      524000 -- (-688.449) (-688.584) [-685.070] (-687.962) * (-686.775) (-686.363) (-692.145) [-687.003] -- 0:00:29
      524500 -- (-687.206) (-688.579) (-686.048) [-686.273] * (-685.404) (-687.104) [-688.624] (-684.937) -- 0:00:29
      525000 -- (-686.208) (-688.623) [-686.672] (-684.936) * (-686.639) (-686.215) [-689.143] (-689.086) -- 0:00:28

      Average standard deviation of split frequencies: 0.012379

      525500 -- (-687.994) [-689.322] (-687.269) (-685.051) * [-686.654] (-687.005) (-689.888) (-687.846) -- 0:00:28
      526000 -- (-692.071) [-686.746] (-687.875) (-687.607) * (-686.034) (-686.227) [-690.768] (-690.330) -- 0:00:28
      526500 -- (-687.396) [-689.527] (-690.138) (-687.686) * [-685.965] (-686.983) (-687.968) (-687.584) -- 0:00:28
      527000 -- [-686.913] (-688.125) (-689.766) (-686.991) * [-687.904] (-688.406) (-684.494) (-686.343) -- 0:00:28
      527500 -- (-688.853) (-689.491) [-686.477] (-688.675) * (-687.526) [-686.612] (-684.850) (-687.548) -- 0:00:28
      528000 -- (-689.687) (-687.512) [-686.902] (-686.099) * (-688.217) (-686.494) [-688.080] (-686.014) -- 0:00:28
      528500 -- (-684.699) [-686.981] (-690.075) (-685.302) * (-687.548) [-685.431] (-687.020) (-686.408) -- 0:00:28
      529000 -- [-685.017] (-686.595) (-688.249) (-685.136) * [-685.432] (-693.754) (-687.692) (-690.253) -- 0:00:28
      529500 -- [-685.761] (-685.162) (-688.499) (-686.655) * (-687.097) (-687.161) [-687.210] (-690.405) -- 0:00:28
      530000 -- (-685.071) [-686.556] (-686.851) (-686.509) * (-686.574) [-688.412] (-687.309) (-689.169) -- 0:00:28

      Average standard deviation of split frequencies: 0.012603

      530500 -- [-684.934] (-687.059) (-687.484) (-686.457) * (-686.345) [-686.699] (-691.297) (-688.760) -- 0:00:28
      531000 -- (-685.405) [-686.750] (-688.625) (-686.929) * (-685.439) [-688.225] (-688.995) (-686.192) -- 0:00:28
      531500 -- (-685.360) (-685.651) [-686.090] (-687.476) * (-689.570) (-686.224) [-686.308] (-685.697) -- 0:00:28
      532000 -- (-687.959) (-687.583) (-686.717) [-685.932] * [-687.220] (-685.189) (-686.224) (-684.935) -- 0:00:28
      532500 -- (-685.434) (-692.174) [-686.941] (-686.042) * (-686.901) (-686.194) (-685.232) [-685.292] -- 0:00:28
      533000 -- (-689.704) (-687.515) [-688.532] (-690.006) * (-687.792) [-686.000] (-687.004) (-686.400) -- 0:00:28
      533500 -- (-685.736) (-691.288) (-687.563) [-687.958] * [-685.868] (-687.680) (-686.331) (-689.703) -- 0:00:27
      534000 -- [-685.243] (-690.146) (-686.603) (-689.110) * (-686.293) [-684.868] (-686.334) (-686.201) -- 0:00:27
      534500 -- (-686.695) (-686.623) (-685.272) [-685.306] * (-685.862) (-686.007) (-691.126) [-686.637] -- 0:00:27
      535000 -- (-686.264) [-688.815] (-690.604) (-685.866) * (-685.833) [-690.980] (-690.047) (-689.004) -- 0:00:27

      Average standard deviation of split frequencies: 0.012478

      535500 -- [-685.739] (-690.038) (-686.380) (-686.080) * (-686.341) (-688.191) (-689.400) [-687.170] -- 0:00:27
      536000 -- (-687.806) [-685.869] (-692.683) (-689.219) * (-687.722) [-685.840] (-685.876) (-689.483) -- 0:00:27
      536500 -- (-687.474) (-685.033) (-687.520) [-687.931] * (-686.932) (-686.678) (-687.585) [-687.086] -- 0:00:27
      537000 -- (-686.761) [-687.751] (-686.959) (-686.057) * [-688.576] (-685.976) (-686.625) (-689.383) -- 0:00:27
      537500 -- (-686.071) (-685.378) [-685.553] (-686.372) * [-685.864] (-687.786) (-687.746) (-686.513) -- 0:00:27
      538000 -- (-686.911) (-685.424) [-685.093] (-688.147) * (-689.675) (-687.557) [-687.613] (-688.162) -- 0:00:28
      538500 -- (-685.898) (-686.194) [-687.248] (-686.752) * (-685.696) [-686.883] (-685.483) (-688.157) -- 0:00:28
      539000 -- (-692.159) (-685.705) [-684.967] (-687.279) * (-689.690) (-686.272) [-689.707] (-687.438) -- 0:00:28
      539500 -- [-686.385] (-688.117) (-685.403) (-689.053) * (-687.425) (-687.760) (-689.484) [-685.602] -- 0:00:28
      540000 -- [-687.774] (-686.720) (-688.202) (-688.256) * (-688.113) (-687.924) (-690.024) [-687.152] -- 0:00:28

      Average standard deviation of split frequencies: 0.012730

      540500 -- [-686.919] (-685.001) (-687.560) (-687.287) * [-685.925] (-687.310) (-687.328) (-687.719) -- 0:00:28
      541000 -- (-688.042) (-687.393) (-687.948) [-685.262] * [-685.377] (-686.832) (-687.160) (-686.905) -- 0:00:27
      541500 -- [-685.401] (-688.172) (-686.801) (-685.155) * (-686.960) (-692.281) (-686.344) [-686.699] -- 0:00:27
      542000 -- (-685.774) (-686.064) (-686.167) [-688.671] * (-687.999) (-686.382) [-685.506] (-685.539) -- 0:00:27
      542500 -- (-685.828) [-686.367] (-687.124) (-685.966) * (-687.028) [-685.522] (-686.216) (-690.108) -- 0:00:27
      543000 -- (-693.319) [-686.268] (-688.484) (-686.366) * (-692.723) (-686.895) [-685.857] (-685.479) -- 0:00:27
      543500 -- [-689.415] (-686.030) (-686.444) (-688.911) * [-684.958] (-685.179) (-686.780) (-686.926) -- 0:00:27
      544000 -- (-686.628) (-685.267) (-687.438) [-686.655] * [-689.713] (-685.669) (-686.440) (-690.099) -- 0:00:27
      544500 -- (-691.978) (-685.740) [-686.947] (-689.095) * [-686.479] (-685.015) (-685.815) (-689.097) -- 0:00:27
      545000 -- (-687.966) [-685.698] (-687.339) (-687.179) * (-687.248) [-687.894] (-686.294) (-686.409) -- 0:00:27

      Average standard deviation of split frequencies: 0.012573

      545500 -- (-687.437) (-685.929) (-688.010) [-687.998] * (-691.760) (-691.890) (-686.777) [-688.274] -- 0:00:27
      546000 -- (-687.026) (-686.988) (-687.454) [-686.610] * (-687.439) (-688.412) [-686.151] (-687.988) -- 0:00:27
      546500 -- (-686.835) [-686.642] (-687.195) (-685.698) * (-685.947) [-686.423] (-688.160) (-686.157) -- 0:00:27
      547000 -- (-686.881) [-687.528] (-686.691) (-686.047) * (-687.778) (-690.031) [-686.489] (-685.558) -- 0:00:27
      547500 -- (-688.524) (-689.147) [-687.084] (-686.379) * [-687.260] (-689.281) (-688.121) (-686.080) -- 0:00:27
      548000 -- [-686.702] (-686.001) (-686.450) (-686.346) * (-690.298) [-685.505] (-693.852) (-685.737) -- 0:00:27
      548500 -- (-685.741) (-693.424) [-686.401] (-686.764) * [-685.786] (-686.784) (-692.456) (-689.683) -- 0:00:27
      549000 -- (-687.906) (-689.530) [-689.501] (-686.290) * [-687.207] (-689.406) (-687.490) (-690.949) -- 0:00:27
      549500 -- [-686.603] (-687.419) (-688.161) (-688.670) * (-687.570) [-691.112] (-686.371) (-686.323) -- 0:00:27
      550000 -- (-686.729) (-685.996) (-687.484) [-684.862] * (-688.112) [-685.665] (-687.049) (-685.692) -- 0:00:27

      Average standard deviation of split frequencies: 0.012627

      550500 -- [-685.767] (-686.267) (-686.176) (-685.854) * [-688.266] (-687.781) (-688.271) (-688.162) -- 0:00:26
      551000 -- (-687.572) (-685.893) [-688.627] (-688.188) * (-686.358) (-687.531) [-687.086] (-685.332) -- 0:00:26
      551500 -- (-688.623) (-687.253) [-685.341] (-685.633) * (-686.255) (-687.531) [-686.082] (-688.041) -- 0:00:26
      552000 -- (-686.420) (-688.171) (-686.692) [-686.112] * (-688.111) [-689.436] (-686.871) (-685.911) -- 0:00:26
      552500 -- (-687.950) (-688.018) [-687.661] (-686.166) * (-685.035) (-688.232) [-685.081] (-685.798) -- 0:00:26
      553000 -- [-685.927] (-686.902) (-687.296) (-686.897) * [-685.837] (-685.184) (-685.528) (-687.221) -- 0:00:26
      553500 -- (-685.508) [-684.941] (-687.856) (-687.726) * [-687.382] (-685.826) (-684.996) (-688.411) -- 0:00:26
      554000 -- (-685.589) [-686.832] (-689.301) (-687.773) * [-685.569] (-688.541) (-686.595) (-689.112) -- 0:00:26
      554500 -- (-686.854) (-687.717) (-687.601) [-690.893] * (-686.333) [-686.979] (-686.983) (-688.042) -- 0:00:26
      555000 -- (-685.879) (-690.321) (-688.846) [-687.049] * (-686.556) (-690.350) (-688.672) [-685.221] -- 0:00:27

      Average standard deviation of split frequencies: 0.012548

      555500 -- [-688.205] (-691.152) (-688.780) (-685.167) * (-690.302) [-685.313] (-687.574) (-687.373) -- 0:00:27
      556000 -- [-685.519] (-686.026) (-686.203) (-686.891) * (-691.878) (-686.932) (-688.170) [-688.492] -- 0:00:27
      556500 -- [-687.459] (-685.742) (-686.255) (-687.757) * (-686.758) (-687.381) [-686.553] (-689.453) -- 0:00:27
      557000 -- (-685.479) (-685.475) [-686.249] (-686.738) * (-686.199) (-687.068) [-689.399] (-688.471) -- 0:00:27
      557500 -- (-687.389) [-685.494] (-686.264) (-686.907) * (-686.329) [-689.035] (-689.951) (-687.341) -- 0:00:26
      558000 -- [-686.278] (-686.030) (-686.442) (-688.078) * [-690.039] (-685.407) (-691.054) (-693.226) -- 0:00:26
      558500 -- (-684.879) (-689.833) [-688.222] (-686.140) * [-687.581] (-686.910) (-685.445) (-693.945) -- 0:00:26
      559000 -- (-685.706) (-686.712) (-689.201) [-686.323] * [-686.096] (-685.878) (-685.504) (-694.295) -- 0:00:26
      559500 -- (-686.407) [-686.292] (-687.762) (-685.773) * (-686.179) (-688.476) [-686.355] (-688.309) -- 0:00:26
      560000 -- [-686.034] (-689.499) (-686.934) (-687.467) * (-688.919) (-685.929) (-685.759) [-685.219] -- 0:00:26

      Average standard deviation of split frequencies: 0.012780

      560500 -- (-686.441) [-689.020] (-685.826) (-688.465) * (-687.275) (-687.266) [-685.582] (-687.276) -- 0:00:26
      561000 -- (-687.042) (-685.903) (-687.701) [-688.935] * (-687.082) [-687.341] (-688.656) (-687.482) -- 0:00:26
      561500 -- (-684.661) [-686.484] (-684.573) (-686.259) * [-689.460] (-688.119) (-686.292) (-685.902) -- 0:00:26
      562000 -- [-684.778] (-687.011) (-687.142) (-689.331) * (-686.543) (-688.579) (-686.603) [-685.095] -- 0:00:26
      562500 -- [-688.264] (-686.686) (-686.209) (-686.457) * (-685.324) [-687.447] (-687.995) (-685.514) -- 0:00:26
      563000 -- (-692.421) (-685.877) (-686.408) [-685.615] * (-691.212) (-688.250) [-689.692] (-687.194) -- 0:00:26
      563500 -- (-688.355) (-687.621) (-684.964) [-688.460] * (-686.570) (-686.728) [-684.823] (-687.741) -- 0:00:26
      564000 -- (-694.232) [-685.640] (-689.245) (-686.360) * (-686.150) [-687.142] (-685.517) (-686.722) -- 0:00:26
      564500 -- (-688.636) (-686.901) (-687.013) [-686.650] * [-686.232] (-686.167) (-685.441) (-688.625) -- 0:00:26
      565000 -- (-688.218) [-688.766] (-685.877) (-686.941) * [-684.709] (-688.398) (-685.302) (-686.092) -- 0:00:26

      Average standard deviation of split frequencies: 0.012382

      565500 -- (-686.427) (-687.558) [-685.186] (-686.200) * [-686.091] (-687.109) (-684.724) (-685.245) -- 0:00:26
      566000 -- (-687.481) [-691.887] (-686.340) (-685.909) * (-685.558) (-688.683) [-687.463] (-686.731) -- 0:00:26
      566500 -- (-687.734) (-689.225) [-687.349] (-685.506) * (-686.597) (-687.941) (-686.349) [-688.219] -- 0:00:26
      567000 -- [-685.062] (-686.924) (-689.692) (-686.606) * (-686.549) [-686.596] (-686.382) (-691.370) -- 0:00:25
      567500 -- (-684.918) [-688.389] (-685.695) (-686.430) * (-687.025) (-685.791) [-686.286] (-685.679) -- 0:00:25
      568000 -- [-686.295] (-685.676) (-688.237) (-689.128) * (-691.311) (-685.572) (-687.186) [-687.726] -- 0:00:25
      568500 -- (-687.560) (-686.706) [-685.353] (-687.167) * [-685.896] (-685.306) (-695.046) (-689.286) -- 0:00:25
      569000 -- (-690.269) (-687.214) (-688.640) [-686.840] * (-685.600) (-685.468) [-692.511] (-686.773) -- 0:00:25
      569500 -- (-686.610) [-687.046] (-687.338) (-688.098) * (-686.323) (-686.532) [-685.625] (-688.893) -- 0:00:25
      570000 -- (-686.786) (-687.029) [-686.215] (-689.497) * [-685.193] (-688.119) (-690.490) (-687.685) -- 0:00:25

      Average standard deviation of split frequencies: 0.012171

      570500 -- [-688.786] (-685.910) (-688.446) (-689.053) * (-685.751) (-687.339) [-688.019] (-687.361) -- 0:00:25
      571000 -- (-687.980) (-685.817) [-685.940] (-685.784) * (-690.179) (-685.816) [-687.713] (-688.403) -- 0:00:25
      571500 -- (-689.677) (-686.060) [-686.904] (-687.478) * (-686.498) (-689.940) (-687.940) [-687.987] -- 0:00:25
      572000 -- (-687.971) (-686.571) (-688.114) [-686.232] * (-684.616) (-689.185) (-685.624) [-689.543] -- 0:00:26
      572500 -- (-689.648) [-689.235] (-690.219) (-689.620) * (-686.590) (-687.441) [-688.515] (-686.301) -- 0:00:26
      573000 -- (-692.659) (-694.136) [-690.563] (-687.748) * (-691.832) (-687.126) (-687.849) [-687.945] -- 0:00:26
      573500 -- (-689.832) [-687.155] (-690.449) (-686.548) * (-685.554) (-691.488) (-687.875) [-686.259] -- 0:00:26
      574000 -- (-689.504) (-686.200) [-687.954] (-686.747) * (-686.829) (-692.088) (-686.805) [-689.753] -- 0:00:25
      574500 -- (-689.231) (-685.054) (-684.966) [-687.200] * (-685.752) (-685.325) (-684.860) [-688.514] -- 0:00:25
      575000 -- (-690.946) [-685.244] (-690.875) (-687.009) * (-689.217) (-695.038) (-684.547) [-687.692] -- 0:00:25

      Average standard deviation of split frequencies: 0.012604

      575500 -- (-689.070) (-686.965) [-686.566] (-684.846) * (-688.459) (-686.080) (-689.745) [-687.584] -- 0:00:25
      576000 -- (-688.807) (-689.138) [-685.302] (-687.830) * (-685.874) (-690.202) (-687.663) [-685.756] -- 0:00:25
      576500 -- (-688.684) (-687.176) [-684.988] (-691.194) * (-687.875) [-686.664] (-690.285) (-685.220) -- 0:00:25
      577000 -- [-685.765] (-687.697) (-685.442) (-691.240) * [-688.636] (-685.981) (-688.360) (-684.878) -- 0:00:25
      577500 -- (-685.792) (-687.161) [-684.978] (-688.174) * (-689.170) (-686.125) [-686.280] (-690.545) -- 0:00:25
      578000 -- (-685.968) (-688.882) (-688.287) [-686.500] * (-686.337) (-685.530) [-686.520] (-687.627) -- 0:00:25
      578500 -- (-685.531) [-687.004] (-688.315) (-686.839) * (-686.509) [-684.977] (-686.159) (-687.173) -- 0:00:25
      579000 -- (-687.746) (-687.730) (-686.760) [-687.939] * (-684.846) (-686.475) [-687.504] (-685.604) -- 0:00:25
      579500 -- (-688.494) (-688.749) [-685.722] (-688.491) * [-688.037] (-686.599) (-686.233) (-685.126) -- 0:00:25
      580000 -- (-686.761) (-686.765) (-687.871) [-685.805] * [-687.202] (-687.037) (-686.954) (-686.963) -- 0:00:25

      Average standard deviation of split frequencies: 0.012773

      580500 -- (-686.579) [-685.472] (-685.640) (-686.177) * (-686.976) (-686.801) [-692.615] (-685.821) -- 0:00:25
      581000 -- [-685.311] (-687.184) (-688.558) (-687.644) * (-686.139) [-684.947] (-688.311) (-688.275) -- 0:00:25
      581500 -- [-688.177] (-687.007) (-693.576) (-684.953) * (-686.950) (-684.894) (-686.597) [-685.523] -- 0:00:25
      582000 -- [-684.578] (-687.040) (-689.582) (-685.514) * (-688.940) (-685.429) (-687.008) [-686.792] -- 0:00:25
      582500 -- (-686.702) (-685.065) (-687.321) [-685.635] * [-686.039] (-685.063) (-690.731) (-684.878) -- 0:00:25
      583000 -- [-684.824] (-685.544) (-685.912) (-685.413) * (-686.058) (-684.935) (-686.431) [-687.878] -- 0:00:25
      583500 -- (-688.665) (-687.343) (-684.867) [-685.592] * [-685.894] (-685.679) (-686.265) (-686.927) -- 0:00:24
      584000 -- (-689.939) (-686.077) (-687.790) [-688.155] * (-685.293) (-688.708) [-686.815] (-687.138) -- 0:00:24
      584500 -- (-693.040) (-686.914) [-687.356] (-687.705) * [-685.484] (-688.293) (-687.742) (-687.517) -- 0:00:24
      585000 -- (-685.445) (-685.978) [-687.981] (-690.067) * (-687.509) (-688.498) [-685.571] (-687.134) -- 0:00:24

      Average standard deviation of split frequencies: 0.013086

      585500 -- [-685.407] (-687.163) (-689.300) (-688.396) * (-686.071) (-686.462) [-686.968] (-686.744) -- 0:00:24
      586000 -- (-688.557) [-684.733] (-686.295) (-692.914) * (-687.447) (-686.530) (-689.101) [-685.889] -- 0:00:24
      586500 -- [-690.896] (-685.651) (-687.778) (-695.765) * (-687.342) (-689.880) (-687.052) [-686.587] -- 0:00:24
      587000 -- (-687.695) (-686.023) [-686.090] (-689.464) * [-692.529] (-685.421) (-686.057) (-687.115) -- 0:00:24
      587500 -- (-688.264) (-685.059) (-686.415) [-685.215] * (-687.821) (-688.128) (-685.687) [-686.522] -- 0:00:24
      588000 -- (-688.458) [-686.195] (-685.872) (-685.806) * [-686.788] (-688.148) (-684.694) (-690.346) -- 0:00:24
      588500 -- [-687.033] (-689.765) (-686.471) (-684.971) * (-690.258) (-689.643) (-685.915) [-686.885] -- 0:00:25
      589000 -- [-686.043] (-687.392) (-687.410) (-687.099) * (-687.465) (-685.571) (-685.140) [-685.109] -- 0:00:25
      589500 -- [-687.103] (-692.604) (-685.720) (-686.009) * (-686.797) (-685.116) [-686.326] (-685.090) -- 0:00:25
      590000 -- [-686.714] (-685.454) (-688.260) (-686.579) * (-688.581) [-686.059] (-687.558) (-685.425) -- 0:00:25

      Average standard deviation of split frequencies: 0.012823

      590500 -- (-686.671) (-685.564) (-687.909) [-686.079] * (-688.721) [-685.257] (-686.158) (-692.431) -- 0:00:24
      591000 -- [-688.531] (-686.055) (-688.067) (-686.023) * (-688.997) (-687.918) [-687.374] (-687.219) -- 0:00:24
      591500 -- [-688.315] (-685.951) (-687.876) (-688.401) * (-689.035) (-688.401) (-686.814) [-686.961] -- 0:00:24
      592000 -- (-688.391) (-690.125) [-689.941] (-688.166) * [-690.262] (-686.619) (-689.459) (-686.923) -- 0:00:24
      592500 -- (-686.064) (-686.994) (-685.708) [-686.322] * (-688.140) (-689.208) [-685.493] (-687.482) -- 0:00:24
      593000 -- (-689.437) (-685.874) [-687.010] (-686.733) * (-688.680) [-688.084] (-686.000) (-686.202) -- 0:00:24
      593500 -- (-687.491) (-685.823) [-685.344] (-688.895) * (-688.149) (-687.801) (-687.082) [-687.545] -- 0:00:24
      594000 -- (-688.539) [-686.045] (-686.401) (-687.385) * (-687.524) (-687.095) (-690.617) [-686.353] -- 0:00:24
      594500 -- (-688.520) (-685.942) [-688.408] (-690.220) * [-687.198] (-686.181) (-689.854) (-689.758) -- 0:00:24
      595000 -- (-686.032) (-684.703) (-688.164) [-690.086] * [-690.234] (-684.936) (-686.644) (-686.286) -- 0:00:24

      Average standard deviation of split frequencies: 0.013130

      595500 -- (-690.401) [-686.712] (-688.152) (-690.223) * [-687.041] (-694.143) (-686.388) (-686.253) -- 0:00:24
      596000 -- (-686.243) [-685.429] (-689.179) (-695.525) * [-686.489] (-685.045) (-686.360) (-686.322) -- 0:00:24
      596500 -- (-687.206) (-686.060) (-686.261) [-685.739] * (-688.090) (-685.589) [-685.441] (-686.227) -- 0:00:24
      597000 -- (-687.659) (-687.030) [-692.901] (-686.801) * (-686.748) (-685.477) (-687.758) [-688.010] -- 0:00:24
      597500 -- (-688.382) [-686.476] (-685.506) (-686.933) * (-685.691) (-686.388) [-687.438] (-686.538) -- 0:00:24
      598000 -- [-688.230] (-687.880) (-685.427) (-685.415) * (-687.497) (-687.412) (-689.591) [-686.631] -- 0:00:24
      598500 -- (-689.984) (-684.727) (-685.394) [-684.859] * (-685.861) (-686.334) (-685.639) [-686.273] -- 0:00:24
      599000 -- (-689.560) (-689.273) [-689.191] (-686.208) * (-685.861) [-685.838] (-685.081) (-688.227) -- 0:00:24
      599500 -- (-686.106) (-685.094) [-690.936] (-686.074) * (-694.250) [-688.075] (-685.105) (-687.580) -- 0:00:24
      600000 -- (-686.445) (-685.636) (-686.256) [-686.679] * [-689.055] (-688.368) (-686.278) (-685.389) -- 0:00:24

      Average standard deviation of split frequencies: 0.013237

      600500 -- [-686.046] (-691.156) (-685.827) (-686.608) * (-688.518) [-687.071] (-688.291) (-687.588) -- 0:00:23
      601000 -- (-690.947) [-687.673] (-686.074) (-686.188) * (-691.345) [-688.016] (-686.752) (-687.795) -- 0:00:23
      601500 -- (-686.711) (-688.750) (-685.563) [-685.716] * (-688.033) [-688.919] (-685.976) (-686.356) -- 0:00:23
      602000 -- (-687.589) (-687.251) (-686.871) [-686.733] * (-688.400) [-686.573] (-685.415) (-688.394) -- 0:00:23
      602500 -- [-687.177] (-686.290) (-685.350) (-687.753) * (-688.141) (-689.424) [-686.052] (-687.922) -- 0:00:23
      603000 -- [-685.001] (-685.864) (-688.638) (-686.916) * (-688.498) (-688.793) (-685.774) [-688.247] -- 0:00:23
      603500 -- (-685.618) (-685.802) [-688.065] (-687.338) * (-684.818) [-685.623] (-685.832) (-690.346) -- 0:00:23
      604000 -- (-686.259) (-688.161) (-689.712) [-687.642] * (-689.857) (-684.697) (-690.496) [-687.593] -- 0:00:23
      604500 -- (-685.094) (-689.161) [-686.867] (-687.422) * (-689.313) [-685.567] (-686.798) (-686.738) -- 0:00:23
      605000 -- (-685.797) [-685.057] (-687.113) (-688.118) * (-690.432) [-686.357] (-687.056) (-686.302) -- 0:00:23

      Average standard deviation of split frequencies: 0.012446

      605500 -- (-689.108) [-686.660] (-691.539) (-685.957) * (-685.980) (-686.194) (-685.977) [-684.854] -- 0:00:24
      606000 -- (-686.457) [-685.542] (-687.024) (-686.620) * (-686.253) [-686.293] (-685.530) (-685.965) -- 0:00:24
      606500 -- (-685.592) [-684.761] (-688.278) (-695.654) * (-689.338) (-685.467) [-685.144] (-686.773) -- 0:00:24
      607000 -- (-690.854) (-684.867) (-687.469) [-686.621] * (-692.036) (-688.108) [-684.754] (-686.054) -- 0:00:23
      607500 -- [-686.148] (-688.184) (-686.923) (-687.536) * (-696.398) (-685.449) [-687.056] (-685.392) -- 0:00:23
      608000 -- (-687.064) (-687.565) (-688.161) [-687.025] * (-686.223) (-688.537) (-685.005) [-684.876] -- 0:00:23
      608500 -- (-688.618) (-685.530) [-687.427] (-686.925) * (-685.772) (-693.686) (-685.452) [-686.185] -- 0:00:23
      609000 -- (-687.590) [-686.854] (-685.790) (-684.978) * (-685.407) (-690.277) [-687.707] (-686.154) -- 0:00:23
      609500 -- (-688.687) (-687.681) (-685.742) [-688.957] * (-685.574) (-692.769) (-685.416) [-689.211] -- 0:00:23
      610000 -- [-687.069] (-687.044) (-691.224) (-690.208) * [-688.651] (-690.098) (-685.411) (-685.053) -- 0:00:23

      Average standard deviation of split frequencies: 0.013123

      610500 -- (-685.312) [-685.609] (-686.273) (-687.844) * (-686.578) (-686.064) [-686.052] (-685.737) -- 0:00:23
      611000 -- [-685.711] (-686.862) (-686.646) (-687.826) * [-688.701] (-686.715) (-685.225) (-693.389) -- 0:00:23
      611500 -- (-687.563) (-685.260) [-688.352] (-689.005) * (-687.774) (-691.195) [-686.042] (-687.350) -- 0:00:23
      612000 -- (-686.736) (-687.231) [-685.503] (-686.584) * (-686.108) (-687.591) (-687.892) [-686.908] -- 0:00:23
      612500 -- (-688.341) [-687.651] (-687.656) (-686.075) * [-684.714] (-686.839) (-686.634) (-691.839) -- 0:00:23
      613000 -- (-686.733) [-686.254] (-688.535) (-692.036) * (-685.084) (-685.762) [-685.266] (-687.184) -- 0:00:23
      613500 -- (-687.607) [-686.295] (-686.578) (-687.784) * (-688.331) (-688.068) (-687.237) [-685.644] -- 0:00:23
      614000 -- (-686.556) (-687.240) (-688.173) [-687.666] * (-686.919) (-687.754) [-688.777] (-685.657) -- 0:00:23
      614500 -- (-690.040) [-691.135] (-687.927) (-685.443) * (-688.817) (-686.129) (-686.503) [-685.831] -- 0:00:23
      615000 -- (-692.217) (-685.782) [-688.285] (-685.901) * (-685.378) [-686.443] (-687.713) (-686.750) -- 0:00:23

      Average standard deviation of split frequencies: 0.012754

      615500 -- (-689.161) [-686.804] (-685.374) (-685.873) * (-685.746) (-686.149) [-690.485] (-685.439) -- 0:00:23
      616000 -- (-687.419) (-687.233) (-686.503) [-687.506] * (-687.708) (-686.398) [-688.916] (-688.013) -- 0:00:23
      616500 -- (-686.551) (-686.431) (-686.043) [-688.062] * [-692.505] (-685.448) (-686.485) (-688.495) -- 0:00:23
      617000 -- (-687.907) (-688.564) [-687.139] (-687.494) * (-688.284) (-687.810) (-689.102) [-692.279] -- 0:00:22
      617500 -- [-687.288] (-687.629) (-687.147) (-693.526) * (-685.813) [-691.454] (-687.776) (-690.522) -- 0:00:22
      618000 -- [-686.791] (-686.199) (-688.410) (-685.892) * (-689.176) (-688.319) [-686.089] (-686.629) -- 0:00:22
      618500 -- (-691.032) (-686.499) (-685.563) [-686.895] * (-694.328) (-688.877) [-684.809] (-687.238) -- 0:00:22
      619000 -- (-691.448) (-687.939) (-686.593) [-687.308] * (-698.920) (-687.253) (-685.267) [-685.776] -- 0:00:22
      619500 -- (-690.832) (-700.552) (-686.660) [-685.606] * [-690.804] (-687.896) (-686.877) (-685.787) -- 0:00:22
      620000 -- (-686.054) [-687.175] (-686.334) (-690.481) * (-685.606) (-685.508) (-689.048) [-690.226] -- 0:00:22

      Average standard deviation of split frequencies: 0.012760

      620500 -- (-685.709) [-685.301] (-687.147) (-688.703) * (-688.443) (-686.005) (-693.725) [-685.858] -- 0:00:22
      621000 -- (-687.424) (-686.913) [-690.303] (-685.816) * [-685.583] (-686.607) (-686.174) (-686.715) -- 0:00:22
      621500 -- [-685.712] (-685.752) (-686.431) (-688.175) * (-685.321) (-688.466) (-685.022) [-688.658] -- 0:00:22
      622000 -- [-686.232] (-688.002) (-684.853) (-688.755) * (-689.735) (-686.976) (-688.163) [-686.660] -- 0:00:23
      622500 -- [-686.976] (-688.233) (-686.558) (-685.438) * (-690.921) (-685.360) [-684.773] (-686.907) -- 0:00:23
      623000 -- (-686.045) (-685.105) (-685.003) [-685.524] * (-686.480) [-687.062] (-688.874) (-685.128) -- 0:00:22
      623500 -- (-686.630) [-686.904] (-686.532) (-687.294) * [-687.313] (-688.512) (-696.515) (-687.525) -- 0:00:22
      624000 -- (-686.621) [-685.626] (-689.795) (-689.205) * (-690.199) (-687.236) (-686.815) [-686.755] -- 0:00:22
      624500 -- (-686.911) (-686.947) [-687.448] (-687.426) * (-691.589) (-686.898) (-687.776) [-686.676] -- 0:00:22
      625000 -- (-686.123) [-688.252] (-691.485) (-685.587) * (-687.789) (-687.948) (-688.140) [-688.498] -- 0:00:22

      Average standard deviation of split frequencies: 0.012613

      625500 -- (-685.193) (-687.958) (-687.303) [-685.688] * (-687.759) [-687.105] (-688.404) (-692.270) -- 0:00:22
      626000 -- (-688.429) (-685.527) (-688.243) [-687.204] * (-689.778) [-685.688] (-687.388) (-687.273) -- 0:00:22
      626500 -- [-685.547] (-686.135) (-689.410) (-685.241) * (-688.013) (-685.893) [-688.466] (-685.961) -- 0:00:22
      627000 -- (-687.821) (-685.459) [-688.153] (-686.221) * (-691.752) [-686.383] (-685.671) (-686.996) -- 0:00:22
      627500 -- (-687.500) [-686.086] (-689.921) (-688.644) * (-688.080) [-687.588] (-685.859) (-687.727) -- 0:00:22
      628000 -- (-689.710) (-686.221) [-686.255] (-689.207) * (-689.737) (-686.589) (-687.204) [-686.221] -- 0:00:22
      628500 -- (-688.868) (-689.536) [-689.067] (-688.898) * (-686.290) (-686.556) [-686.904] (-686.582) -- 0:00:22
      629000 -- (-687.891) (-687.248) [-688.935] (-685.907) * (-691.016) (-687.536) [-685.377] (-686.439) -- 0:00:22
      629500 -- (-688.843) (-688.617) [-685.132] (-687.317) * [-685.874] (-689.955) (-686.013) (-686.039) -- 0:00:22
      630000 -- [-684.677] (-687.527) (-685.216) (-690.800) * (-687.383) (-690.362) [-687.579] (-689.641) -- 0:00:22

      Average standard deviation of split frequencies: 0.012894

      630500 -- (-686.422) (-686.024) [-685.930] (-690.209) * (-686.420) (-689.073) (-691.035) [-687.251] -- 0:00:22
      631000 -- [-686.589] (-693.768) (-686.686) (-685.949) * (-689.770) (-684.861) (-689.560) [-685.440] -- 0:00:22
      631500 -- (-685.880) (-688.109) [-684.590] (-687.881) * (-686.857) [-686.477] (-685.487) (-686.243) -- 0:00:22
      632000 -- (-685.810) [-685.361] (-685.440) (-686.430) * (-686.458) (-686.412) (-687.398) [-685.884] -- 0:00:22
      632500 -- (-684.848) (-688.023) (-689.167) [-686.006] * (-687.734) [-685.606] (-687.620) (-685.180) -- 0:00:22
      633000 -- (-687.702) [-686.118] (-687.316) (-685.915) * [-686.169] (-688.285) (-690.191) (-686.066) -- 0:00:22
      633500 -- (-688.512) (-686.175) (-691.267) [-685.851] * (-685.199) [-687.070] (-688.280) (-687.067) -- 0:00:21
      634000 -- (-685.972) (-686.488) (-685.758) [-685.885] * (-688.418) (-685.562) (-686.204) [-686.932] -- 0:00:21
      634500 -- (-687.312) [-691.710] (-689.683) (-686.478) * [-685.516] (-687.394) (-685.209) (-687.321) -- 0:00:21
      635000 -- (-686.892) [-685.626] (-687.660) (-686.970) * [-686.482] (-687.545) (-687.379) (-689.002) -- 0:00:21

      Average standard deviation of split frequencies: 0.013481

      635500 -- (-685.456) (-685.964) (-687.184) [-686.125] * [-685.375] (-687.870) (-688.778) (-685.731) -- 0:00:21
      636000 -- (-685.215) [-685.774] (-688.858) (-686.376) * (-686.475) (-686.172) [-686.146] (-687.842) -- 0:00:21
      636500 -- (-687.841) (-685.992) [-687.960] (-689.068) * (-686.049) (-684.916) [-685.490] (-688.449) -- 0:00:21
      637000 -- [-691.552] (-686.574) (-687.739) (-689.355) * (-685.927) [-686.900] (-686.221) (-685.220) -- 0:00:21
      637500 -- (-686.614) [-686.482] (-686.795) (-686.100) * (-686.323) [-687.369] (-687.352) (-687.255) -- 0:00:21
      638000 -- (-686.875) [-685.981] (-687.818) (-686.303) * (-686.959) (-688.470) [-687.606] (-687.444) -- 0:00:21
      638500 -- (-687.327) (-686.372) [-686.406] (-692.318) * (-686.180) [-689.177] (-688.471) (-686.097) -- 0:00:21
      639000 -- (-690.641) (-689.530) [-692.492] (-688.475) * (-687.928) (-689.674) (-686.599) [-685.505] -- 0:00:22
      639500 -- (-688.596) (-686.196) (-688.686) [-686.573] * [-685.754] (-687.344) (-688.311) (-685.493) -- 0:00:21
      640000 -- (-687.263) (-685.964) [-686.395] (-685.910) * (-686.616) [-685.538] (-685.554) (-685.495) -- 0:00:21

      Average standard deviation of split frequencies: 0.013980

      640500 -- [-688.154] (-684.774) (-687.167) (-687.250) * (-692.984) (-686.665) (-685.455) [-687.460] -- 0:00:21
      641000 -- (-687.739) [-686.214] (-687.427) (-689.219) * [-687.484] (-687.986) (-689.122) (-685.777) -- 0:00:21
      641500 -- (-686.142) (-685.283) (-687.453) [-687.756] * (-689.803) (-690.285) [-687.695] (-688.836) -- 0:00:21
      642000 -- (-687.492) [-687.120] (-687.589) (-686.633) * (-687.001) (-688.652) [-686.064] (-691.606) -- 0:00:21
      642500 -- (-685.988) [-688.608] (-686.164) (-687.472) * [-687.763] (-687.816) (-686.434) (-687.384) -- 0:00:21
      643000 -- [-687.072] (-685.118) (-687.450) (-687.620) * (-688.110) (-688.280) (-686.991) [-685.011] -- 0:00:21
      643500 -- [-688.771] (-685.423) (-685.734) (-687.558) * [-685.759] (-690.226) (-687.907) (-690.237) -- 0:00:21
      644000 -- (-691.694) [-685.207] (-686.003) (-687.828) * (-689.806) (-690.671) (-689.231) [-685.682] -- 0:00:21
      644500 -- (-691.569) [-687.774] (-686.995) (-688.160) * (-686.515) (-686.469) [-689.229] (-685.217) -- 0:00:21
      645000 -- (-690.088) [-687.230] (-685.768) (-687.345) * (-686.459) [-689.817] (-686.078) (-686.077) -- 0:00:21

      Average standard deviation of split frequencies: 0.013330

      645500 -- (-688.553) [-686.217] (-687.096) (-686.429) * [-686.304] (-684.625) (-688.341) (-685.726) -- 0:00:21
      646000 -- [-685.422] (-686.185) (-689.012) (-685.380) * [-685.817] (-686.927) (-689.848) (-687.789) -- 0:00:21
      646500 -- (-685.913) (-685.610) [-687.109] (-685.688) * (-689.100) [-687.690] (-688.283) (-689.690) -- 0:00:21
      647000 -- (-688.159) (-687.974) [-690.233] (-688.437) * (-692.414) (-687.454) (-685.412) [-685.708] -- 0:00:21
      647500 -- (-688.895) (-686.714) (-689.510) [-688.453] * (-689.661) [-687.472] (-688.053) (-686.409) -- 0:00:21
      648000 -- (-690.528) (-687.087) [-689.343] (-687.545) * (-686.887) (-688.521) (-686.783) [-687.060] -- 0:00:21
      648500 -- (-686.957) (-685.157) [-687.008] (-685.872) * (-684.840) (-687.273) [-685.278] (-685.252) -- 0:00:21
      649000 -- (-686.692) (-686.679) [-687.126] (-685.537) * [-684.996] (-686.293) (-687.546) (-684.775) -- 0:00:21
      649500 -- (-684.994) (-689.580) (-690.434) [-692.131] * (-684.945) [-685.695] (-688.531) (-687.419) -- 0:00:21
      650000 -- [-685.320] (-688.702) (-690.595) (-688.667) * (-687.675) [-688.533] (-689.669) (-684.874) -- 0:00:21

      Average standard deviation of split frequencies: 0.013282

      650500 -- [-685.011] (-685.927) (-688.823) (-685.723) * (-687.894) (-686.697) [-689.262] (-685.158) -- 0:00:20
      651000 -- [-685.650] (-685.128) (-688.626) (-687.599) * (-686.336) (-686.449) [-688.468] (-685.713) -- 0:00:20
      651500 -- (-691.563) [-684.996] (-688.796) (-684.909) * (-687.180) (-687.586) [-686.423] (-686.574) -- 0:00:20
      652000 -- (-689.847) (-685.885) [-692.106] (-684.917) * (-688.289) (-685.421) (-688.372) [-687.758] -- 0:00:20
      652500 -- (-688.833) [-688.371] (-689.629) (-686.789) * (-690.636) [-685.600] (-686.262) (-689.103) -- 0:00:20
      653000 -- [-685.826] (-687.122) (-688.151) (-685.878) * (-688.602) [-685.010] (-687.944) (-687.916) -- 0:00:20
      653500 -- (-685.701) (-687.677) [-686.811] (-686.682) * [-689.658] (-692.914) (-688.815) (-693.357) -- 0:00:20
      654000 -- (-687.130) (-686.668) (-685.726) [-685.605] * [-687.847] (-687.086) (-686.322) (-689.930) -- 0:00:20
      654500 -- (-686.492) (-686.603) [-685.258] (-685.324) * [-687.296] (-687.804) (-689.648) (-685.122) -- 0:00:20
      655000 -- (-686.004) (-691.127) (-690.614) [-687.672] * (-687.303) [-687.808] (-686.905) (-685.133) -- 0:00:20

      Average standard deviation of split frequencies: 0.013701

      655500 -- (-687.612) [-689.124] (-689.885) (-685.817) * (-686.481) (-685.967) (-684.805) [-690.271] -- 0:00:21
      656000 -- (-685.674) [-688.955] (-684.962) (-686.200) * (-687.567) (-689.039) [-684.871] (-690.280) -- 0:00:20
      656500 -- (-685.905) [-686.881] (-688.297) (-686.886) * (-690.307) [-687.331] (-686.691) (-685.762) -- 0:00:20
      657000 -- (-686.288) (-686.883) (-686.974) [-685.920] * (-688.708) (-686.991) (-686.498) [-686.893] -- 0:00:20
      657500 -- (-686.472) (-690.652) [-686.761] (-687.325) * (-690.657) (-692.239) [-689.785] (-686.787) -- 0:00:20
      658000 -- (-685.261) (-687.029) (-689.176) [-685.239] * (-688.185) (-696.061) (-685.728) [-684.866] -- 0:00:20
      658500 -- (-687.850) (-686.568) (-690.264) [-685.463] * (-687.732) [-688.255] (-686.828) (-686.428) -- 0:00:20
      659000 -- (-688.475) [-686.549] (-690.842) (-687.624) * (-688.458) (-686.811) [-686.799] (-685.430) -- 0:00:20
      659500 -- (-689.185) [-686.657] (-686.343) (-685.080) * (-686.710) (-689.242) (-687.639) [-685.922] -- 0:00:20
      660000 -- (-687.700) (-687.958) (-692.056) [-685.981] * [-686.823] (-687.175) (-687.077) (-686.103) -- 0:00:20

      Average standard deviation of split frequencies: 0.013557

      660500 -- (-685.820) [-686.162] (-688.758) (-687.997) * (-689.290) (-688.653) (-686.013) [-686.248] -- 0:00:20
      661000 -- (-686.291) (-686.738) [-685.816] (-685.067) * (-688.887) [-687.497] (-686.769) (-684.866) -- 0:00:20
      661500 -- (-687.234) (-691.426) (-686.451) [-685.180] * (-692.541) (-685.727) [-687.042] (-685.453) -- 0:00:20
      662000 -- (-687.420) (-685.512) [-687.996] (-685.133) * (-688.845) (-687.306) [-686.911] (-688.199) -- 0:00:20
      662500 -- (-688.467) (-686.970) (-686.288) [-686.640] * (-686.764) (-685.747) [-688.510] (-686.353) -- 0:00:20
      663000 -- (-686.417) (-686.991) [-685.922] (-686.643) * (-693.290) [-686.783] (-689.815) (-688.101) -- 0:00:20
      663500 -- [-685.430] (-685.092) (-686.672) (-687.296) * (-691.237) (-685.565) [-686.807] (-689.714) -- 0:00:20
      664000 -- (-690.013) [-685.944] (-687.139) (-686.376) * (-689.457) [-687.278] (-689.794) (-686.691) -- 0:00:20
      664500 -- [-686.049] (-687.139) (-687.066) (-687.969) * (-685.554) [-692.659] (-688.661) (-685.612) -- 0:00:20
      665000 -- (-686.701) (-688.107) (-685.082) [-686.142] * [-684.675] (-685.450) (-686.515) (-685.413) -- 0:00:20

      Average standard deviation of split frequencies: 0.013024

      665500 -- (-686.131) (-689.026) [-685.941] (-686.606) * [-684.654] (-686.398) (-687.142) (-687.254) -- 0:00:20
      666000 -- (-688.152) [-687.071] (-687.014) (-686.009) * (-684.891) (-693.886) (-686.734) [-688.518] -- 0:00:20
      666500 -- (-687.374) (-687.447) (-686.285) [-688.913] * (-686.733) (-686.187) [-688.923] (-686.579) -- 0:00:20
      667000 -- (-687.515) [-688.071] (-691.037) (-684.937) * (-688.041) (-686.973) [-689.402] (-690.464) -- 0:00:19
      667500 -- (-686.539) (-686.494) (-689.338) [-685.548] * (-689.015) (-688.636) (-688.003) [-685.369] -- 0:00:19
      668000 -- (-686.282) [-686.873] (-685.177) (-687.152) * [-688.136] (-689.115) (-686.942) (-686.306) -- 0:00:19
      668500 -- (-686.205) [-686.437] (-684.871) (-685.914) * (-685.934) (-686.741) (-687.583) [-685.428] -- 0:00:19
      669000 -- (-685.675) [-689.337] (-690.017) (-689.285) * (-690.248) [-686.484] (-688.808) (-686.032) -- 0:00:19
      669500 -- [-685.075] (-686.454) (-685.839) (-690.154) * [-688.454] (-685.228) (-689.881) (-686.182) -- 0:00:19
      670000 -- (-689.363) (-686.206) [-686.128] (-687.802) * (-688.434) (-686.666) [-686.120] (-685.749) -- 0:00:19

      Average standard deviation of split frequencies: 0.013589

      670500 -- [-686.520] (-690.419) (-686.255) (-686.960) * (-688.453) (-688.342) [-687.545] (-687.134) -- 0:00:19
      671000 -- [-686.533] (-693.288) (-687.037) (-684.795) * (-687.339) [-685.833] (-687.577) (-686.808) -- 0:00:19
      671500 -- (-687.573) (-687.759) [-686.415] (-686.055) * (-684.783) [-685.971] (-689.084) (-687.265) -- 0:00:19
      672000 -- (-689.063) (-688.672) [-688.047] (-686.528) * (-686.223) [-686.654] (-689.789) (-686.664) -- 0:00:20
      672500 -- (-685.862) [-689.164] (-687.516) (-687.946) * (-688.676) [-687.978] (-686.455) (-684.681) -- 0:00:19
      673000 -- (-685.458) [-688.416] (-690.010) (-686.654) * (-687.404) (-686.334) [-687.069] (-684.712) -- 0:00:19
      673500 -- [-687.137] (-686.535) (-687.924) (-691.448) * (-685.463) [-687.375] (-688.972) (-688.612) -- 0:00:19
      674000 -- (-687.620) (-686.490) (-686.478) [-690.810] * (-690.004) [-685.148] (-687.044) (-687.704) -- 0:00:19
      674500 -- (-685.787) [-686.522] (-686.851) (-687.547) * (-687.176) (-686.734) (-684.697) [-685.139] -- 0:00:19
      675000 -- (-686.606) (-686.293) (-689.225) [-689.859] * (-687.852) (-686.479) [-685.509] (-687.074) -- 0:00:19

      Average standard deviation of split frequencies: 0.013343

      675500 -- (-686.590) (-691.678) [-687.879] (-695.448) * [-685.591] (-686.078) (-688.552) (-688.736) -- 0:00:19
      676000 -- (-685.018) [-690.369] (-686.695) (-687.959) * (-687.073) (-685.658) (-685.854) [-689.883] -- 0:00:19
      676500 -- [-685.027] (-693.294) (-685.667) (-685.267) * (-686.414) (-686.743) (-685.390) [-687.996] -- 0:00:19
      677000 -- (-689.021) (-691.829) (-687.541) [-685.207] * (-687.545) (-686.013) [-690.600] (-687.295) -- 0:00:19
      677500 -- (-687.416) (-687.614) (-688.335) [-688.779] * (-685.516) (-685.826) [-687.274] (-687.630) -- 0:00:19
      678000 -- (-686.719) (-684.698) (-685.230) [-689.680] * (-686.287) [-685.164] (-686.603) (-690.537) -- 0:00:19
      678500 -- [-687.014] (-686.945) (-686.147) (-688.304) * (-689.976) (-687.854) (-686.563) [-689.976] -- 0:00:19
      679000 -- (-686.576) [-689.237] (-687.290) (-689.247) * (-692.652) (-686.955) [-687.179] (-688.584) -- 0:00:19
      679500 -- [-685.735] (-686.797) (-687.307) (-687.120) * [-687.869] (-688.561) (-687.947) (-685.671) -- 0:00:19
      680000 -- [-687.273] (-685.915) (-690.051) (-687.725) * (-689.086) (-688.687) [-687.815] (-686.844) -- 0:00:19

      Average standard deviation of split frequencies: 0.014267

      680500 -- (-690.645) (-685.271) [-689.841] (-687.081) * [-685.715] (-685.961) (-686.889) (-687.484) -- 0:00:19
      681000 -- (-686.572) (-690.640) (-686.484) [-686.485] * (-688.107) (-693.634) (-686.672) [-689.904] -- 0:00:19
      681500 -- (-687.121) (-692.658) (-688.514) [-688.927] * (-690.216) [-687.698] (-686.892) (-686.354) -- 0:00:19
      682000 -- (-686.200) [-688.409] (-687.246) (-688.454) * (-685.660) [-686.801] (-685.963) (-685.921) -- 0:00:19
      682500 -- (-686.406) (-688.527) [-686.261] (-687.043) * [-686.336] (-691.284) (-688.091) (-687.932) -- 0:00:19
      683000 -- (-688.088) (-687.479) [-685.097] (-685.700) * (-684.967) (-684.948) (-686.364) [-687.629] -- 0:00:19
      683500 -- (-686.617) (-688.583) [-687.683] (-686.959) * (-687.283) (-687.032) (-685.897) [-687.132] -- 0:00:18
      684000 -- (-686.408) [-691.786] (-686.896) (-689.975) * (-688.422) (-685.789) [-687.309] (-691.005) -- 0:00:18
      684500 -- [-685.759] (-686.487) (-684.611) (-687.218) * (-687.087) (-685.070) [-688.108] (-686.268) -- 0:00:18
      685000 -- (-685.361) (-686.214) (-686.572) [-686.702] * (-690.302) [-684.808] (-687.456) (-690.650) -- 0:00:18

      Average standard deviation of split frequencies: 0.014731

      685500 -- (-686.408) (-685.465) (-685.714) [-688.388] * [-684.834] (-686.533) (-690.048) (-692.562) -- 0:00:18
      686000 -- [-687.724] (-690.698) (-686.189) (-687.460) * [-685.949] (-688.853) (-687.838) (-689.327) -- 0:00:18
      686500 -- (-688.045) (-686.415) [-685.970] (-685.888) * (-685.951) (-691.407) (-685.136) [-687.387] -- 0:00:18
      687000 -- [-687.687] (-686.972) (-687.394) (-685.273) * (-686.166) (-686.020) (-685.692) [-687.439] -- 0:00:18
      687500 -- (-690.025) (-687.998) [-685.206] (-686.851) * [-687.894] (-688.665) (-690.891) (-688.294) -- 0:00:18
      688000 -- [-688.151] (-688.566) (-685.980) (-687.400) * (-685.420) (-687.639) (-691.327) [-687.779] -- 0:00:18
      688500 -- [-690.492] (-687.468) (-687.655) (-688.766) * (-685.667) [-685.533] (-686.264) (-692.123) -- 0:00:18
      689000 -- [-685.946] (-687.234) (-691.927) (-689.182) * (-687.347) (-685.551) [-686.509] (-689.851) -- 0:00:18
      689500 -- (-684.721) (-685.556) [-686.369] (-685.926) * (-686.980) (-693.302) (-688.048) [-685.692] -- 0:00:18
      690000 -- (-685.106) [-687.206] (-688.085) (-687.235) * (-686.697) (-685.618) [-685.280] (-687.848) -- 0:00:18

      Average standard deviation of split frequencies: 0.014547

      690500 -- (-686.220) [-688.339] (-686.318) (-686.842) * (-686.527) (-687.472) [-685.499] (-686.041) -- 0:00:18
      691000 -- (-686.776) (-687.948) (-685.800) [-685.962] * (-686.103) [-687.625] (-690.529) (-687.665) -- 0:00:18
      691500 -- (-685.587) (-688.124) [-687.535] (-686.245) * (-685.492) (-685.785) [-690.793] (-685.192) -- 0:00:18
      692000 -- [-685.452] (-685.799) (-686.763) (-686.852) * (-687.082) [-686.135] (-692.089) (-687.738) -- 0:00:18
      692500 -- (-686.048) (-687.805) (-688.579) [-686.510] * (-687.260) (-688.142) [-685.876] (-689.279) -- 0:00:18
      693000 -- (-686.129) [-689.836] (-685.976) (-690.641) * (-686.055) [-690.016] (-685.895) (-687.606) -- 0:00:18
      693500 -- [-685.280] (-690.467) (-688.485) (-686.450) * [-684.715] (-689.635) (-686.471) (-687.560) -- 0:00:18
      694000 -- (-689.930) [-688.464] (-686.304) (-686.449) * (-684.899) [-687.163] (-688.365) (-687.413) -- 0:00:18
      694500 -- (-688.549) (-693.429) [-686.078] (-685.269) * (-692.222) (-690.985) (-691.126) [-687.549] -- 0:00:18
      695000 -- (-688.136) (-696.128) (-684.820) [-686.551] * (-691.132) (-692.023) (-687.314) [-687.526] -- 0:00:18

      Average standard deviation of split frequencies: 0.014585

      695500 -- (-694.100) (-687.336) (-685.033) [-685.626] * (-688.527) (-692.144) [-685.318] (-687.730) -- 0:00:18
      696000 -- (-689.892) (-688.176) (-687.039) [-685.372] * (-688.787) [-686.007] (-686.447) (-685.396) -- 0:00:18
      696500 -- [-688.058] (-686.972) (-685.324) (-688.197) * [-689.386] (-684.629) (-686.109) (-686.458) -- 0:00:18
      697000 -- (-685.794) (-687.551) [-687.914] (-687.107) * (-686.564) (-684.552) (-685.015) [-691.433] -- 0:00:18
      697500 -- [-686.535] (-685.777) (-687.136) (-684.902) * (-686.080) (-688.466) (-688.499) [-690.335] -- 0:00:18
      698000 -- (-689.256) (-687.542) [-692.006] (-685.076) * (-686.081) (-685.235) [-686.246] (-688.017) -- 0:00:18
      698500 -- (-687.116) (-685.787) [-687.152] (-685.139) * (-693.203) (-685.951) (-684.750) [-691.002] -- 0:00:18
      699000 -- [-685.420] (-685.004) (-687.061) (-686.014) * (-691.382) (-690.410) [-688.321] (-689.398) -- 0:00:18
      699500 -- (-686.760) [-685.743] (-685.733) (-685.549) * [-685.488] (-686.275) (-690.107) (-685.566) -- 0:00:18
      700000 -- (-685.913) [-686.162] (-686.332) (-687.801) * (-687.218) [-685.575] (-687.921) (-690.346) -- 0:00:18

      Average standard deviation of split frequencies: 0.014353

      700500 -- (-688.147) [-687.493] (-688.133) (-686.681) * [-685.599] (-686.128) (-686.742) (-685.096) -- 0:00:17
      701000 -- (-684.501) [-686.654] (-685.312) (-687.220) * (-688.395) (-685.564) (-688.274) [-686.423] -- 0:00:17
      701500 -- [-685.876] (-692.131) (-689.077) (-685.049) * (-686.630) (-686.537) [-685.143] (-687.508) -- 0:00:17
      702000 -- (-687.026) (-686.774) [-686.277] (-690.117) * (-687.602) [-686.658] (-686.249) (-686.593) -- 0:00:17
      702500 -- [-685.078] (-685.728) (-687.397) (-687.352) * [-687.459] (-686.806) (-688.281) (-686.888) -- 0:00:17
      703000 -- [-691.096] (-686.357) (-685.209) (-685.568) * (-691.002) [-686.135] (-690.209) (-686.103) -- 0:00:17
      703500 -- (-689.360) (-687.345) [-686.438] (-689.514) * (-690.411) (-686.411) (-686.820) [-687.145] -- 0:00:17
      704000 -- (-689.504) (-686.872) [-685.868] (-691.394) * (-684.667) (-687.888) [-687.108] (-692.255) -- 0:00:17
      704500 -- (-686.878) (-685.997) (-688.447) [-687.605] * [-685.097] (-686.216) (-687.364) (-692.833) -- 0:00:17
      705000 -- (-687.998) (-688.896) [-685.369] (-685.951) * (-688.096) (-686.288) [-686.728] (-690.482) -- 0:00:17

      Average standard deviation of split frequencies: 0.014066

      705500 -- (-688.045) (-690.798) (-690.680) [-684.932] * [-687.744] (-689.300) (-688.438) (-686.068) -- 0:00:17
      706000 -- (-686.118) [-686.736] (-685.857) (-685.223) * [-686.219] (-689.934) (-686.305) (-685.769) -- 0:00:17
      706500 -- (-686.377) (-686.981) (-686.951) [-687.455] * (-685.406) [-689.760] (-686.003) (-686.611) -- 0:00:17
      707000 -- [-686.999] (-686.812) (-687.647) (-687.899) * [-684.883] (-686.839) (-686.771) (-689.061) -- 0:00:17
      707500 -- (-687.980) [-685.131] (-687.194) (-686.376) * (-688.112) (-686.758) [-685.647] (-688.365) -- 0:00:17
      708000 -- (-685.940) [-686.010] (-686.800) (-684.816) * [-686.134] (-687.651) (-685.224) (-687.236) -- 0:00:17
      708500 -- (-685.423) [-687.300] (-686.321) (-686.440) * [-686.901] (-690.609) (-686.231) (-685.929) -- 0:00:17
      709000 -- (-686.485) [-687.026] (-685.681) (-691.131) * (-685.752) [-686.052] (-687.234) (-684.636) -- 0:00:17
      709500 -- (-686.964) (-686.692) (-684.860) [-686.791] * (-687.687) [-687.768] (-687.132) (-688.788) -- 0:00:17
      710000 -- (-687.640) (-686.511) [-685.766] (-685.227) * (-687.863) (-686.823) [-690.539] (-686.248) -- 0:00:17

      Average standard deviation of split frequencies: 0.013753

      710500 -- [-687.465] (-688.671) (-686.008) (-687.810) * (-689.742) (-688.381) (-687.599) [-687.237] -- 0:00:17
      711000 -- (-688.178) (-687.602) (-685.754) [-687.090] * (-689.967) (-688.984) [-687.135] (-688.196) -- 0:00:17
      711500 -- (-684.854) [-685.989] (-685.533) (-687.821) * [-687.702] (-686.419) (-686.922) (-685.417) -- 0:00:17
      712000 -- (-686.339) (-688.430) (-686.206) [-686.471] * (-690.094) [-688.925] (-688.047) (-686.365) -- 0:00:17
      712500 -- [-686.198] (-689.594) (-686.137) (-685.731) * (-688.377) [-685.735] (-687.435) (-688.902) -- 0:00:17
      713000 -- [-688.198] (-684.628) (-685.860) (-686.915) * (-685.252) [-685.894] (-690.892) (-689.371) -- 0:00:17
      713500 -- [-685.970] (-686.466) (-686.990) (-686.589) * [-687.743] (-688.830) (-686.924) (-686.272) -- 0:00:17
      714000 -- (-687.164) (-685.196) (-687.633) [-688.730] * (-688.740) (-691.327) (-685.557) [-685.289] -- 0:00:17
      714500 -- [-685.994] (-685.348) (-686.017) (-688.242) * (-689.389) [-688.438] (-686.768) (-685.523) -- 0:00:17
      715000 -- (-688.847) [-684.949] (-693.934) (-685.398) * (-686.014) (-686.282) (-689.307) [-687.969] -- 0:00:17

      Average standard deviation of split frequencies: 0.013519

      715500 -- [-685.883] (-684.542) (-689.176) (-685.908) * (-686.736) (-686.640) (-689.504) [-690.322] -- 0:00:17
      716000 -- (-686.662) (-687.234) (-687.227) [-686.306] * (-685.767) [-686.351] (-686.743) (-685.851) -- 0:00:17
      716500 -- (-686.389) [-686.728] (-685.956) (-686.647) * (-685.361) [-686.492] (-686.524) (-685.318) -- 0:00:17
      717000 -- (-685.292) (-688.504) [-690.924] (-685.235) * (-687.431) [-684.625] (-685.028) (-687.136) -- 0:00:16
      717500 -- (-685.066) (-685.759) [-687.213] (-685.741) * [-690.768] (-687.358) (-685.849) (-687.635) -- 0:00:16
      718000 -- (-687.089) (-686.404) (-689.336) [-690.294] * (-687.336) [-685.336] (-688.961) (-687.749) -- 0:00:16
      718500 -- (-685.443) [-689.651] (-687.261) (-689.526) * (-689.405) [-685.612] (-692.335) (-686.126) -- 0:00:16
      719000 -- (-685.797) (-691.817) (-687.974) [-686.795] * [-689.008] (-687.036) (-687.362) (-685.906) -- 0:00:16
      719500 -- (-688.806) (-688.343) [-689.547] (-685.664) * (-692.038) (-687.210) [-689.899] (-688.911) -- 0:00:16
      720000 -- (-686.990) (-688.011) [-691.474] (-691.695) * (-690.285) (-688.415) [-691.088] (-686.146) -- 0:00:16

      Average standard deviation of split frequencies: 0.013431

      720500 -- [-687.464] (-692.820) (-692.518) (-689.009) * [-689.435] (-686.047) (-684.733) (-687.671) -- 0:00:16
      721000 -- [-686.170] (-686.585) (-689.192) (-686.836) * (-685.381) (-684.978) (-685.960) [-689.809] -- 0:00:16
      721500 -- (-688.520) (-686.569) [-686.188] (-688.075) * (-685.160) (-690.417) (-686.383) [-687.457] -- 0:00:16
      722000 -- (-689.974) (-686.807) [-688.506] (-689.707) * [-685.088] (-687.040) (-688.379) (-686.735) -- 0:00:16
      722500 -- (-687.655) (-685.254) [-685.396] (-685.516) * [-685.150] (-686.461) (-686.362) (-685.866) -- 0:00:16
      723000 -- [-686.522] (-686.698) (-686.695) (-685.935) * (-685.987) (-689.799) (-686.500) [-684.605] -- 0:00:16
      723500 -- (-685.767) (-692.274) (-689.330) [-689.074] * [-687.443] (-686.898) (-686.745) (-684.507) -- 0:00:16
      724000 -- (-685.090) (-689.745) (-687.137) [-685.715] * (-689.137) [-686.884] (-686.487) (-685.824) -- 0:00:16
      724500 -- [-686.395] (-687.188) (-686.499) (-686.668) * (-685.532) [-687.966] (-684.761) (-688.687) -- 0:00:16
      725000 -- [-688.556] (-687.844) (-685.491) (-687.542) * [-684.742] (-687.579) (-686.001) (-686.629) -- 0:00:16

      Average standard deviation of split frequencies: 0.013068

      725500 -- (-688.280) (-688.879) [-686.244] (-688.128) * (-684.809) [-687.998] (-686.964) (-689.530) -- 0:00:16
      726000 -- (-687.287) (-687.595) (-686.229) [-687.036] * (-687.081) (-690.174) (-684.478) [-691.342] -- 0:00:16
      726500 -- [-686.419] (-685.812) (-686.981) (-689.944) * (-687.178) (-689.675) [-686.210] (-686.935) -- 0:00:16
      727000 -- [-685.407] (-688.281) (-687.390) (-685.305) * (-688.062) (-689.540) [-687.079] (-689.403) -- 0:00:16
      727500 -- [-685.431] (-685.874) (-685.641) (-687.149) * (-687.493) (-689.046) (-688.269) [-686.309] -- 0:00:16
      728000 -- [-685.175] (-685.251) (-690.374) (-690.615) * (-686.284) (-686.032) (-689.583) [-686.320] -- 0:00:16
      728500 -- [-687.656] (-688.205) (-688.314) (-689.289) * (-686.059) (-688.483) [-685.261] (-686.111) -- 0:00:16
      729000 -- (-688.501) [-687.448] (-687.967) (-690.770) * [-686.296] (-687.052) (-687.139) (-688.914) -- 0:00:16
      729500 -- (-685.999) (-686.864) [-685.642] (-689.157) * (-687.722) [-686.274] (-690.957) (-688.704) -- 0:00:16
      730000 -- (-687.552) (-687.069) [-685.256] (-689.152) * [-687.651] (-685.587) (-688.113) (-688.287) -- 0:00:16

      Average standard deviation of split frequencies: 0.012559

      730500 -- (-688.432) (-687.757) [-686.960] (-686.065) * (-685.401) [-687.245] (-686.640) (-691.441) -- 0:00:16
      731000 -- (-690.135) (-686.623) (-690.327) [-686.506] * [-687.752] (-688.573) (-685.414) (-685.615) -- 0:00:16
      731500 -- (-687.579) [-693.385] (-686.006) (-690.735) * (-686.066) (-687.840) (-685.263) [-685.558] -- 0:00:16
      732000 -- (-687.335) (-693.603) [-687.979] (-690.502) * (-686.083) (-687.869) [-684.713] (-686.913) -- 0:00:16
      732500 -- (-688.078) (-688.676) [-685.292] (-687.904) * (-690.708) (-688.206) (-686.201) [-686.507] -- 0:00:16
      733000 -- [-686.251] (-688.440) (-685.919) (-685.355) * (-687.883) (-688.830) [-686.542] (-689.520) -- 0:00:16
      733500 -- [-686.804] (-692.345) (-686.156) (-686.016) * (-685.310) [-686.621] (-685.482) (-686.981) -- 0:00:15
      734000 -- (-688.470) (-690.103) (-685.363) [-687.803] * (-688.349) (-687.578) [-685.689] (-686.354) -- 0:00:15
      734500 -- (-687.704) [-687.971] (-685.955) (-686.587) * (-684.898) (-688.819) [-684.669] (-690.893) -- 0:00:15
      735000 -- (-686.352) [-685.473] (-686.299) (-687.087) * (-684.898) (-690.307) [-686.898] (-688.739) -- 0:00:15

      Average standard deviation of split frequencies: 0.012981

      735500 -- (-687.778) [-689.245] (-685.203) (-690.435) * (-687.836) (-689.749) (-687.666) [-689.417] -- 0:00:15
      736000 -- (-688.921) (-688.509) (-685.372) [-692.475] * (-688.270) (-689.324) [-686.884] (-690.947) -- 0:00:15
      736500 -- (-685.152) [-686.283] (-687.083) (-687.291) * [-685.160] (-687.450) (-686.608) (-686.584) -- 0:00:15
      737000 -- (-685.220) (-686.651) (-689.473) [-686.834] * [-685.812] (-688.935) (-687.016) (-685.854) -- 0:00:15
      737500 -- (-685.283) [-686.392] (-691.476) (-688.889) * (-685.613) (-684.878) (-685.346) [-689.364] -- 0:00:15
      738000 -- [-687.587] (-686.187) (-687.757) (-687.163) * [-685.293] (-685.725) (-687.210) (-687.921) -- 0:00:15
      738500 -- (-686.633) (-689.520) [-686.206] (-685.765) * (-684.801) (-686.763) [-689.600] (-687.741) -- 0:00:15
      739000 -- (-688.724) (-689.615) [-692.595] (-688.860) * (-685.876) (-689.636) [-689.052] (-686.753) -- 0:00:15
      739500 -- [-685.409] (-686.236) (-689.664) (-686.060) * (-684.803) (-690.791) (-689.102) [-689.390] -- 0:00:15
      740000 -- (-685.389) [-685.655] (-686.405) (-688.699) * (-687.915) (-689.570) (-688.930) [-684.907] -- 0:00:15

      Average standard deviation of split frequencies: 0.012814

      740500 -- (-693.259) (-689.675) [-685.252] (-689.913) * [-686.729] (-690.720) (-686.779) (-685.073) -- 0:00:15
      741000 -- [-687.244] (-690.116) (-689.236) (-685.341) * (-689.957) (