--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:46:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplT/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -530.26 -532.95
2 -530.29 -535.08
--------------------------------------
TOTAL -530.28 -534.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897096 0.093916 0.369730 1.495452 0.861001 1501.00 1501.00 1.000
r(A<->C){all} 0.166624 0.019606 0.000028 0.444711 0.127808 175.73 207.20 1.002
r(A<->G){all} 0.176831 0.022523 0.000002 0.482408 0.138477 219.36 249.89 1.002
r(A<->T){all} 0.169030 0.020455 0.000004 0.455773 0.132443 115.23 187.71 1.001
r(C<->G){all} 0.162526 0.020404 0.000023 0.459395 0.123651 230.45 265.21 1.001
r(C<->T){all} 0.167506 0.019376 0.000036 0.444754 0.130127 202.22 255.62 1.000
r(G<->T){all} 0.157482 0.017545 0.000025 0.418547 0.122603 316.03 348.96 1.000
pi(A){all} 0.212222 0.000424 0.171364 0.251551 0.211281 1047.40 1144.15 1.000
pi(C){all} 0.278392 0.000521 0.233847 0.322837 0.278452 1266.55 1344.44 1.000
pi(G){all} 0.317333 0.000568 0.270671 0.362618 0.316695 1032.85 1208.08 1.000
pi(T){all} 0.192053 0.000389 0.151469 0.228530 0.191421 1333.15 1417.08 1.000
alpha{1,2} 0.400764 0.199982 0.000271 1.309040 0.252595 1226.20 1269.37 1.002
alpha{3} 0.460678 0.244375 0.000114 1.469624 0.302884 1097.34 1252.03 1.000
pinvar{all} 0.995945 0.000023 0.987126 0.999997 0.997444 1089.10 1178.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -511.686012
Model 2: PositiveSelection -511.685969
Model 0: one-ratio -511.685969
Model 7: beta -511.686061
Model 8: beta&w>1 -511.686146
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 8.600000001024455E-5
Model 8 vs 7 1.700000000255386E-4
>C1
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C2
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C3
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C4
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C5
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C6
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=129
C1 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C2 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C3 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C4 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C5 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C6 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
**************************************************
C1 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C2 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C3 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C4 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C5 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C6 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
**************************************************
C1 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C2 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C3 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C4 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C5 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C6 SDPAAFTALVEVARSGLPEDVNVPSGEAA
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3870]--->[3870]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.659 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C2 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C3 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C4 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C5 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
C6 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
**************************************************
C1 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C2 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C3 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C4 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C5 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
C6 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
**************************************************
C1 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C2 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C3 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C4 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C5 SDPAAFTALVEVARSGLPEDVNVPSGEAA
C6 SDPAAFTALVEVARSGLPEDVNVPSGEAA
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
C2 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
C3 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
C4 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
C5 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
C6 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
**************************************************
C1 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
C2 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
C3 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
C4 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
C5 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
C6 CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
**************************************************
C1 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
C2 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
C3 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
C4 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
C5 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
C6 AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
**************************************************
C1 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
C2 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
C3 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
C4 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
C5 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
C6 CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
**************************************************
C1 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
C2 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
C3 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
C4 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
C5 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
C6 GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
**************************************************
C1 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
C2 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
C3 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
C4 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
C5 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
C6 AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
**************************************************
C1 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
C2 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
C3 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
C4 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
C5 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
C6 AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
**************************************************
C1 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
C2 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
C3 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
C4 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
C5 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
C6 ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
*************************************
>C1
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C2
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C3
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C4
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C5
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C6
ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT
CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA
AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT
CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC
GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA
AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC
AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT
ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>C1
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C2
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C3
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C4
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C5
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
>C6
MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
SDPAAFTALVEVARSGLPEDVNVPSGEAA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 387 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790711
Setting output file names to "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1173415270
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0810766796
Seed = 728498356
Swapseed = 1579790711
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -866.124503 -- -24.965149
Chain 2 -- -866.124503 -- -24.965149
Chain 3 -- -866.124503 -- -24.965149
Chain 4 -- -866.124553 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -866.124553 -- -24.965149
Chain 2 -- -866.124553 -- -24.965149
Chain 3 -- -866.124553 -- -24.965149
Chain 4 -- -866.124553 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-866.125] (-866.125) (-866.125) (-866.125) * [-866.125] (-866.125) (-866.125) (-866.125)
500 -- (-543.639) [-541.354] (-544.091) (-545.411) * (-541.461) [-540.193] (-547.001) (-543.804) -- 0:00:00
1000 -- (-537.057) (-543.253) [-544.346] (-542.202) * [-539.148] (-540.381) (-540.622) (-542.380) -- 0:00:00
1500 -- (-540.566) (-542.496) [-540.417] (-537.706) * [-541.491] (-539.183) (-541.547) (-544.891) -- 0:00:00
2000 -- (-547.502) (-538.235) (-541.640) [-539.053] * (-543.974) [-538.576] (-538.356) (-541.534) -- 0:00:00
2500 -- (-545.959) [-535.062] (-541.300) (-534.911) * (-543.037) [-541.521] (-544.260) (-545.865) -- 0:00:00
3000 -- (-541.023) (-537.741) (-538.539) [-539.459] * (-536.681) (-541.614) [-535.859] (-538.893) -- 0:00:00
3500 -- [-543.649] (-544.334) (-538.558) (-545.056) * (-543.019) (-539.804) (-536.153) [-535.394] -- 0:00:00
4000 -- (-542.144) [-543.115] (-541.529) (-537.618) * (-542.323) [-535.788] (-546.022) (-548.735) -- 0:00:00
4500 -- (-541.217) [-537.259] (-541.129) (-543.452) * (-545.306) [-546.124] (-539.983) (-539.577) -- 0:00:00
5000 -- [-537.668] (-541.099) (-539.008) (-542.433) * (-541.353) (-546.484) [-534.821] (-544.829) -- 0:00:00
Average standard deviation of split frequencies: 0.075151
5500 -- (-547.282) (-538.691) (-536.972) [-540.020] * [-538.638] (-540.474) (-538.587) (-539.953) -- 0:00:00
6000 -- (-556.265) (-535.783) (-547.476) [-538.600] * (-544.966) [-535.580] (-540.955) (-541.140) -- 0:00:00
6500 -- (-544.791) (-542.922) [-544.630] (-539.910) * [-538.248] (-544.643) (-536.650) (-540.990) -- 0:00:00
7000 -- (-531.873) [-544.031] (-541.145) (-548.039) * (-545.567) (-541.304) (-542.150) [-539.178] -- 0:00:00
7500 -- (-530.600) [-545.062] (-540.587) (-532.360) * [-538.015] (-543.394) (-549.035) (-540.267) -- 0:00:00
8000 -- [-531.344] (-543.379) (-550.891) (-541.114) * [-536.779] (-537.806) (-550.494) (-540.110) -- 0:00:00
8500 -- (-529.708) (-537.107) [-533.623] (-541.626) * [-539.240] (-539.400) (-535.748) (-551.108) -- 0:00:00
9000 -- (-530.861) (-544.587) [-538.166] (-545.064) * [-541.200] (-539.849) (-544.312) (-541.984) -- 0:00:00
9500 -- (-531.213) (-537.585) (-546.974) [-543.369] * [-541.755] (-543.571) (-549.268) (-545.616) -- 0:00:00
10000 -- (-530.441) [-539.461] (-547.270) (-555.720) * (-542.499) [-539.441] (-542.689) (-540.949) -- 0:00:00
Average standard deviation of split frequencies: 0.083969
10500 -- [-530.813] (-548.717) (-536.975) (-539.487) * (-545.955) (-545.297) (-541.836) [-535.780] -- 0:00:00
11000 -- [-529.763] (-545.017) (-539.623) (-549.048) * (-542.506) (-546.917) (-542.083) [-538.106] -- 0:00:00
11500 -- (-531.441) (-539.520) (-535.555) [-533.877] * (-541.781) (-541.371) (-538.099) [-535.111] -- 0:00:00
12000 -- (-529.511) [-537.851] (-537.293) (-529.459) * (-538.965) [-536.044] (-537.502) (-547.257) -- 0:00:00
12500 -- [-529.297] (-542.602) (-540.050) (-530.672) * (-540.126) (-541.406) [-546.099] (-542.186) -- 0:01:19
13000 -- (-531.203) (-540.762) [-536.764] (-530.034) * [-544.861] (-538.656) (-539.157) (-543.530) -- 0:01:15
13500 -- (-532.264) [-539.397] (-540.584) (-529.515) * [-539.308] (-546.622) (-539.585) (-543.474) -- 0:01:13
14000 -- (-533.511) (-546.411) [-540.132] (-534.287) * (-543.490) (-538.125) (-544.506) [-535.135] -- 0:01:10
14500 -- (-530.890) [-539.465] (-541.071) (-533.125) * (-537.119) [-539.748] (-546.930) (-543.186) -- 0:01:07
15000 -- (-530.270) [-538.879] (-539.720) (-536.123) * [-537.427] (-532.189) (-536.508) (-538.106) -- 0:01:05
Average standard deviation of split frequencies: 0.062027
15500 -- (-531.432) (-541.385) [-537.652] (-533.785) * (-536.851) [-529.520] (-545.813) (-539.047) -- 0:01:03
16000 -- (-532.389) [-538.870] (-540.770) (-531.078) * (-533.976) [-529.580] (-543.169) (-537.001) -- 0:01:01
16500 -- (-531.222) (-537.664) [-536.612] (-529.964) * (-543.733) (-530.813) (-542.354) [-534.639] -- 0:00:59
17000 -- [-531.297] (-551.627) (-540.576) (-529.694) * (-544.768) (-531.737) (-538.368) [-539.618] -- 0:00:57
17500 -- [-531.110] (-543.905) (-534.713) (-530.316) * (-544.655) (-531.950) (-534.273) [-540.383] -- 0:00:56
18000 -- [-531.030] (-539.736) (-543.094) (-530.968) * (-539.156) [-529.475] (-538.379) (-544.143) -- 0:00:54
18500 -- [-531.905] (-542.261) (-551.632) (-532.333) * [-534.125] (-530.614) (-536.589) (-548.057) -- 0:00:53
19000 -- (-534.240) (-540.795) (-540.227) [-534.814] * (-540.813) (-531.215) [-539.625] (-538.430) -- 0:00:51
19500 -- (-530.550) (-535.216) [-536.614] (-529.927) * [-535.574] (-530.946) (-546.334) (-540.736) -- 0:00:50
20000 -- (-530.418) (-547.281) (-540.347) [-531.421] * [-539.225] (-532.743) (-542.644) (-537.658) -- 0:00:49
Average standard deviation of split frequencies: 0.050182
20500 -- (-530.224) [-538.494] (-543.550) (-531.914) * (-539.636) (-529.911) [-544.467] (-540.811) -- 0:00:47
21000 -- [-530.729] (-535.424) (-535.024) (-532.683) * (-538.083) [-531.255] (-536.811) (-540.416) -- 0:00:46
21500 -- (-533.117) (-543.522) (-541.384) [-538.164] * (-541.029) (-532.982) (-541.261) [-541.940] -- 0:00:45
22000 -- [-530.514] (-542.360) (-535.368) (-535.500) * (-541.575) (-529.279) [-536.868] (-535.445) -- 0:00:44
22500 -- (-531.570) (-542.751) [-534.690] (-532.959) * (-540.766) (-529.613) (-534.955) [-539.474] -- 0:00:43
23000 -- (-532.092) [-539.872] (-540.640) (-535.484) * (-546.899) (-530.305) (-536.465) [-540.864] -- 0:00:42
23500 -- (-531.275) (-543.270) (-551.236) [-530.389] * (-549.942) (-531.044) (-537.278) [-543.509] -- 0:00:41
24000 -- (-529.558) [-541.618] (-533.880) (-534.345) * (-541.825) (-532.165) [-537.599] (-541.296) -- 0:00:40
24500 -- (-531.160) [-541.587] (-535.536) (-532.396) * (-537.192) (-533.522) [-536.881] (-536.203) -- 0:00:39
25000 -- [-530.899] (-543.618) (-540.428) (-530.122) * [-537.942] (-534.388) (-544.251) (-537.674) -- 0:00:39
Average standard deviation of split frequencies: 0.035355
25500 -- (-529.938) [-537.688] (-539.565) (-532.223) * [-536.519] (-531.381) (-540.607) (-546.581) -- 0:00:38
26000 -- [-531.490] (-541.884) (-551.324) (-529.957) * [-540.415] (-533.062) (-553.248) (-541.435) -- 0:00:37
26500 -- [-532.319] (-537.529) (-544.339) (-529.721) * [-545.203] (-532.314) (-539.134) (-538.615) -- 0:00:36
27000 -- (-530.072) (-537.755) (-547.650) [-532.379] * (-539.828) [-530.976] (-543.902) (-544.184) -- 0:00:36
27500 -- (-533.226) [-542.937] (-550.070) (-530.305) * (-544.304) (-531.595) [-537.138] (-542.213) -- 0:00:35
28000 -- (-531.067) (-541.880) (-550.457) [-529.821] * [-542.032] (-531.150) (-538.960) (-541.282) -- 0:00:34
28500 -- (-530.510) (-547.872) [-538.387] (-530.531) * (-543.451) [-530.641] (-540.532) (-547.072) -- 0:01:08
29000 -- [-532.397] (-535.767) (-539.020) (-533.481) * (-542.161) (-533.287) (-534.735) [-540.334] -- 0:01:06
29500 -- (-532.506) [-542.556] (-550.079) (-532.386) * (-548.165) (-531.613) [-537.267] (-535.733) -- 0:01:05
30000 -- [-532.266] (-540.548) (-545.737) (-533.533) * (-548.544) (-532.390) (-537.007) [-542.104] -- 0:01:04
Average standard deviation of split frequencies: 0.030012
30500 -- (-532.050) (-537.230) [-538.991] (-531.724) * (-540.787) (-531.842) [-536.675] (-538.293) -- 0:01:03
31000 -- (-531.223) (-546.972) [-543.095] (-530.926) * (-545.246) [-533.258] (-541.181) (-540.906) -- 0:01:02
31500 -- (-532.148) [-536.710] (-545.057) (-529.887) * (-543.248) [-531.101] (-542.243) (-543.797) -- 0:01:01
32000 -- (-530.824) (-540.453) [-536.836] (-530.748) * [-532.432] (-530.653) (-542.395) (-544.991) -- 0:01:00
32500 -- (-529.966) [-544.806] (-541.146) (-531.387) * (-558.465) (-529.602) [-536.898] (-538.116) -- 0:00:59
33000 -- (-531.292) (-544.760) (-540.246) [-532.463] * (-554.949) (-530.949) [-536.141] (-544.700) -- 0:00:58
33500 -- (-531.847) (-539.996) [-541.949] (-533.934) * (-542.536) [-530.544] (-540.381) (-546.358) -- 0:00:57
34000 -- [-530.297] (-543.557) (-541.697) (-532.080) * (-530.536) (-530.385) (-538.058) [-539.189] -- 0:00:56
34500 -- [-531.512] (-541.469) (-533.264) (-531.395) * (-530.520) (-529.454) [-540.588] (-542.602) -- 0:00:55
35000 -- (-531.115) (-541.068) (-548.504) [-531.762] * (-533.584) (-531.521) (-543.511) [-539.281] -- 0:00:55
Average standard deviation of split frequencies: 0.029463
35500 -- (-531.178) (-545.281) [-539.809] (-529.943) * (-534.983) [-529.156] (-540.145) (-545.547) -- 0:00:54
36000 -- (-532.956) [-538.021] (-540.694) (-531.485) * [-531.732] (-533.876) (-552.033) (-546.335) -- 0:00:53
36500 -- (-531.685) (-538.463) (-539.482) [-530.531] * (-529.308) [-531.746] (-539.853) (-540.766) -- 0:00:52
37000 -- (-530.819) [-535.334] (-538.306) (-531.689) * [-534.849] (-532.122) (-545.253) (-537.989) -- 0:00:52
37500 -- (-529.612) [-541.417] (-557.992) (-533.175) * [-530.247] (-534.201) (-544.241) (-538.973) -- 0:00:51
38000 -- (-530.243) (-537.519) (-555.708) [-532.269] * (-531.248) (-533.183) [-537.865] (-541.249) -- 0:00:50
38500 -- (-529.552) (-546.504) (-550.475) [-530.124] * (-537.482) (-532.664) [-541.712] (-536.576) -- 0:00:49
39000 -- (-531.035) (-552.012) (-538.505) [-531.032] * (-531.355) [-532.546] (-544.878) (-538.288) -- 0:00:49
39500 -- (-529.584) (-534.827) [-531.179] (-530.844) * (-530.696) [-535.011] (-544.702) (-533.336) -- 0:00:48
40000 -- [-530.846] (-529.671) (-531.473) (-533.320) * [-532.587] (-532.354) (-542.591) (-535.178) -- 0:00:48
Average standard deviation of split frequencies: 0.028400
40500 -- (-531.477) [-533.050] (-532.497) (-535.933) * [-535.499] (-530.545) (-533.561) (-536.172) -- 0:00:47
41000 -- (-530.527) (-534.319) [-532.579] (-532.622) * (-529.498) (-531.755) [-546.262] (-537.756) -- 0:00:46
41500 -- (-534.904) (-531.908) [-533.114] (-529.500) * (-530.397) (-531.992) (-543.457) [-540.152] -- 0:00:46
42000 -- (-538.548) [-532.531] (-530.861) (-535.807) * (-531.173) (-536.048) [-545.983] (-546.175) -- 0:00:45
42500 -- (-531.677) (-533.797) (-529.952) [-536.565] * (-529.265) [-533.603] (-540.755) (-540.453) -- 0:00:45
43000 -- (-531.403) [-533.015] (-531.538) (-530.638) * (-530.664) [-533.349] (-541.445) (-543.688) -- 0:00:44
43500 -- (-529.467) [-537.550] (-532.674) (-530.010) * (-529.404) (-532.876) (-544.226) [-538.714] -- 0:00:43
44000 -- (-529.505) (-529.662) [-530.034] (-531.037) * (-530.865) (-532.551) (-543.035) [-540.725] -- 0:01:05
44500 -- (-530.811) (-531.878) (-531.086) [-529.285] * (-530.104) (-539.613) (-557.373) [-538.102] -- 0:01:04
45000 -- [-528.717] (-529.323) (-532.099) (-529.190) * [-529.621] (-531.441) (-539.484) (-538.286) -- 0:01:03
Average standard deviation of split frequencies: 0.030298
45500 -- [-530.314] (-531.578) (-529.467) (-531.180) * (-528.760) (-533.114) [-541.561] (-541.966) -- 0:01:02
46000 -- (-529.940) (-536.429) [-530.315] (-533.036) * [-529.622] (-530.361) (-537.761) (-541.769) -- 0:01:02
46500 -- (-529.101) (-534.614) [-529.489] (-529.280) * [-530.957] (-530.277) (-541.944) (-543.245) -- 0:01:01
47000 -- (-529.351) (-530.468) (-529.776) [-535.756] * [-531.805] (-531.548) (-533.949) (-547.563) -- 0:01:00
47500 -- (-529.944) [-530.782] (-529.191) (-533.387) * (-537.590) [-530.580] (-536.994) (-556.078) -- 0:01:00
48000 -- (-536.039) (-533.087) (-532.293) [-529.761] * (-530.258) (-535.785) [-535.868] (-546.264) -- 0:00:59
48500 -- (-532.520) (-531.912) [-533.111] (-529.814) * (-532.208) (-542.271) [-539.779] (-542.841) -- 0:00:58
49000 -- (-532.167) (-530.078) [-529.921] (-531.298) * (-532.297) [-531.640] (-549.006) (-540.815) -- 0:00:58
49500 -- (-529.572) (-533.667) (-528.899) [-530.096] * (-531.601) (-533.429) (-551.377) [-547.720] -- 0:00:57
50000 -- [-529.686] (-533.729) (-531.041) (-530.005) * (-531.628) [-529.723] (-542.656) (-544.969) -- 0:00:57
Average standard deviation of split frequencies: 0.033980
50500 -- (-530.138) (-529.800) [-530.343] (-529.793) * (-532.339) (-529.850) [-545.042] (-531.474) -- 0:00:56
51000 -- (-530.545) (-531.216) (-530.991) [-530.621] * [-529.315] (-529.517) (-539.620) (-532.465) -- 0:00:55
51500 -- (-534.173) (-530.033) (-529.864) [-529.452] * [-530.827] (-533.253) (-542.226) (-529.934) -- 0:00:55
52000 -- (-529.816) [-531.901] (-531.057) (-531.901) * (-530.405) (-528.776) (-557.150) [-531.595] -- 0:00:54
52500 -- [-531.784] (-534.451) (-530.257) (-533.635) * (-535.025) [-531.687] (-558.865) (-531.970) -- 0:00:54
53000 -- (-530.013) (-535.289) [-532.006] (-530.602) * (-531.123) (-533.953) (-531.482) [-531.147] -- 0:00:53
53500 -- (-528.950) (-530.420) (-534.241) [-531.004] * [-535.088] (-534.667) (-532.031) (-530.032) -- 0:00:53
54000 -- [-529.355] (-534.294) (-531.843) (-529.934) * (-534.857) [-534.317] (-531.609) (-531.000) -- 0:00:52
54500 -- (-530.197) (-529.383) (-529.976) [-529.810] * (-532.474) [-530.399] (-532.949) (-531.676) -- 0:00:52
55000 -- [-529.857] (-531.896) (-529.814) (-530.400) * (-531.034) (-529.379) [-529.848] (-529.205) -- 0:00:51
Average standard deviation of split frequencies: 0.030064
55500 -- (-537.440) (-531.396) [-533.069] (-533.554) * (-529.937) (-532.329) [-530.461] (-530.708) -- 0:00:51
56000 -- (-530.989) [-531.102] (-531.330) (-532.550) * (-531.998) (-529.360) (-532.004) [-529.499] -- 0:00:50
56500 -- [-531.324] (-532.005) (-531.685) (-532.224) * (-529.259) (-529.874) (-531.947) [-530.323] -- 0:00:50
57000 -- (-529.522) [-530.831] (-531.020) (-534.216) * (-529.511) [-531.251] (-531.637) (-536.309) -- 0:00:49
57500 -- [-529.796] (-532.871) (-531.985) (-532.381) * (-529.266) (-533.944) (-532.343) [-530.980] -- 0:00:49
58000 -- [-530.148] (-530.046) (-531.371) (-532.191) * (-531.860) [-529.796] (-532.569) (-530.321) -- 0:00:48
58500 -- (-530.153) (-531.496) (-530.278) [-531.036] * (-529.273) (-534.306) [-529.444] (-532.598) -- 0:00:48
59000 -- (-531.206) (-534.758) (-532.743) [-532.145] * (-529.365) (-533.800) [-529.433] (-532.645) -- 0:00:47
59500 -- (-534.849) (-538.214) (-530.790) [-530.181] * (-529.958) (-533.129) (-529.093) [-530.794] -- 0:00:47
60000 -- [-530.521] (-532.129) (-530.093) (-536.642) * (-532.220) (-530.226) [-529.922] (-532.628) -- 0:00:47
Average standard deviation of split frequencies: 0.030693
60500 -- [-529.176] (-532.820) (-531.081) (-532.332) * (-529.550) (-531.209) [-529.881] (-530.680) -- 0:01:02
61000 -- (-532.801) (-530.210) [-529.908] (-530.152) * (-531.927) (-533.680) (-531.037) [-530.629] -- 0:01:01
61500 -- (-533.828) [-529.271] (-530.743) (-529.939) * (-531.699) [-529.246] (-535.532) (-531.609) -- 0:01:01
62000 -- (-533.247) (-529.458) [-532.043] (-529.295) * (-536.712) (-532.756) (-533.792) [-529.241] -- 0:01:00
62500 -- (-535.462) [-531.078] (-531.555) (-531.336) * (-530.272) (-530.535) [-530.804] (-529.133) -- 0:01:00
63000 -- (-533.811) (-533.009) (-532.044) [-531.092] * (-531.641) [-533.455] (-529.403) (-533.581) -- 0:00:59
63500 -- (-529.549) (-530.481) (-529.744) [-537.172] * (-530.123) [-529.576] (-532.697) (-536.715) -- 0:00:58
64000 -- (-530.211) [-531.257] (-531.831) (-530.648) * [-531.360] (-531.557) (-529.981) (-532.330) -- 0:00:58
64500 -- (-538.103) [-531.348] (-531.406) (-529.228) * [-530.055] (-530.614) (-529.208) (-530.739) -- 0:00:58
65000 -- (-532.743) (-531.828) (-535.901) [-530.419] * (-532.330) [-531.814] (-530.401) (-528.990) -- 0:00:57
Average standard deviation of split frequencies: 0.029590
65500 -- (-531.106) (-532.673) [-530.225] (-529.308) * (-532.527) (-531.045) (-531.847) [-530.349] -- 0:00:57
66000 -- (-529.680) (-533.284) [-532.623] (-531.403) * (-533.141) [-531.149] (-532.147) (-529.683) -- 0:00:56
66500 -- (-532.796) (-532.581) [-530.964] (-530.201) * (-531.914) (-534.437) (-529.346) [-529.040] -- 0:00:56
67000 -- (-535.004) (-529.337) (-531.366) [-533.590] * (-533.120) (-529.865) [-529.799] (-534.784) -- 0:00:55
67500 -- (-533.520) (-536.471) [-530.880] (-531.190) * (-531.425) (-528.671) [-530.766] (-531.066) -- 0:00:55
68000 -- (-532.897) (-532.310) [-531.013] (-531.337) * (-529.389) (-531.499) (-529.499) [-529.551] -- 0:00:54
68500 -- (-530.265) [-532.138] (-531.162) (-531.513) * (-529.685) (-530.725) (-529.636) [-529.258] -- 0:00:54
69000 -- (-531.466) [-529.013] (-530.410) (-531.678) * (-530.001) [-531.953] (-530.064) (-528.991) -- 0:00:53
69500 -- (-532.964) (-531.507) (-532.247) [-530.637] * [-530.299] (-529.663) (-534.709) (-529.047) -- 0:00:53
70000 -- (-529.403) (-531.453) [-531.441] (-531.997) * (-529.689) [-529.338] (-530.949) (-529.980) -- 0:00:53
Average standard deviation of split frequencies: 0.029685
70500 -- (-531.905) [-529.544] (-529.897) (-535.113) * [-530.394] (-530.443) (-532.662) (-531.169) -- 0:00:52
71000 -- (-529.786) (-532.728) [-530.823] (-532.833) * [-530.781] (-531.591) (-534.936) (-530.916) -- 0:00:52
71500 -- (-530.846) (-528.902) [-531.844] (-530.363) * (-533.159) (-529.920) [-529.129] (-532.999) -- 0:00:51
72000 -- (-530.499) [-530.181] (-530.293) (-530.214) * (-530.983) (-529.787) (-529.596) [-532.827] -- 0:00:51
72500 -- (-530.500) (-529.203) (-529.745) [-531.087] * [-536.426] (-532.120) (-530.759) (-529.399) -- 0:00:51
73000 -- [-533.278] (-534.421) (-530.747) (-529.588) * (-531.026) (-531.725) (-535.017) [-529.725] -- 0:00:50
73500 -- (-533.422) (-538.518) (-533.214) [-530.691] * [-531.381] (-534.501) (-532.680) (-529.672) -- 0:00:50
74000 -- (-533.387) (-539.184) [-529.645] (-530.286) * (-530.106) [-533.383] (-529.873) (-531.293) -- 0:00:50
74500 -- (-532.936) (-529.412) [-529.450] (-531.051) * [-530.676] (-533.876) (-529.561) (-530.223) -- 0:00:49
75000 -- [-531.391] (-532.432) (-535.071) (-530.452) * (-530.939) (-531.009) [-530.750] (-530.020) -- 0:00:49
Average standard deviation of split frequencies: 0.025992
75500 -- (-529.230) (-528.818) (-533.201) [-533.329] * (-536.476) (-531.130) (-530.067) [-532.514] -- 0:00:48
76000 -- (-534.863) (-532.640) (-529.118) [-531.707] * (-532.213) (-531.154) (-531.298) [-529.530] -- 0:00:48
76500 -- (-530.497) (-532.723) [-529.215] (-530.732) * [-529.451] (-534.509) (-532.559) (-531.085) -- 0:00:48
77000 -- (-532.604) (-536.122) (-529.082) [-529.868] * [-529.163] (-532.209) (-534.480) (-535.242) -- 0:00:47
77500 -- (-531.273) (-531.885) [-532.412] (-530.157) * [-529.948] (-532.091) (-530.979) (-531.040) -- 0:00:59
78000 -- (-531.628) (-532.549) (-529.266) [-530.121] * (-530.365) [-531.156] (-535.451) (-533.733) -- 0:00:59
78500 -- (-529.548) (-530.346) (-530.073) [-529.808] * [-531.394] (-534.944) (-534.437) (-530.200) -- 0:00:58
79000 -- (-529.714) [-530.665] (-529.491) (-530.150) * (-531.010) (-532.606) (-533.905) [-531.213] -- 0:00:58
79500 -- (-533.937) [-528.759] (-530.658) (-530.448) * (-532.496) (-532.554) [-532.297] (-531.421) -- 0:00:57
80000 -- (-529.700) (-531.503) [-529.432] (-532.730) * (-531.468) (-531.731) [-529.438] (-532.310) -- 0:00:57
Average standard deviation of split frequencies: 0.022760
80500 -- (-530.881) (-531.212) [-530.952] (-531.460) * (-531.961) (-530.711) [-530.563] (-531.533) -- 0:00:57
81000 -- (-529.903) (-533.231) (-532.056) [-532.880] * [-531.193] (-530.164) (-530.689) (-530.787) -- 0:00:56
81500 -- (-530.200) (-534.470) [-533.964] (-537.025) * (-530.257) (-529.328) (-535.218) [-530.961] -- 0:00:56
82000 -- [-531.300] (-531.904) (-530.781) (-532.511) * (-534.228) (-529.296) [-531.391] (-534.015) -- 0:00:55
82500 -- [-529.186] (-531.923) (-529.833) (-532.916) * [-533.028] (-529.415) (-530.537) (-531.252) -- 0:00:55
83000 -- [-530.398] (-532.483) (-529.670) (-532.555) * (-530.773) (-529.018) (-528.915) [-533.003] -- 0:00:55
83500 -- (-531.472) (-529.405) (-530.129) [-534.440] * (-531.790) (-529.925) [-532.379] (-529.268) -- 0:00:54
84000 -- (-531.618) (-530.189) (-531.503) [-530.701] * (-533.344) (-531.669) (-531.145) [-528.940] -- 0:00:54
84500 -- [-530.193] (-530.185) (-530.148) (-530.776) * [-529.797] (-532.544) (-529.627) (-528.875) -- 0:00:54
85000 -- (-530.940) [-532.790] (-533.536) (-531.204) * (-529.810) [-530.504] (-532.599) (-530.344) -- 0:00:53
Average standard deviation of split frequencies: 0.019055
85500 -- (-530.128) [-529.383] (-530.654) (-528.802) * [-529.992] (-531.509) (-529.233) (-529.965) -- 0:00:53
86000 -- (-531.528) [-531.428] (-530.179) (-529.109) * (-531.863) (-528.824) (-532.724) [-529.542] -- 0:00:53
86500 -- [-534.414] (-534.265) (-529.626) (-531.891) * [-531.193] (-529.282) (-535.400) (-528.871) -- 0:00:52
87000 -- (-530.059) (-530.972) (-530.904) [-535.053] * (-529.781) [-532.152] (-532.428) (-531.036) -- 0:00:52
87500 -- (-530.783) (-530.733) [-529.867] (-531.304) * [-530.396] (-529.968) (-531.290) (-536.149) -- 0:00:52
88000 -- [-530.445] (-530.595) (-529.545) (-531.068) * (-532.630) (-534.667) [-530.415] (-531.439) -- 0:00:51
88500 -- (-530.268) (-532.081) [-529.309] (-530.332) * (-530.996) (-533.183) [-529.894] (-532.131) -- 0:00:51
89000 -- (-530.304) [-531.553] (-536.423) (-531.280) * [-533.041] (-534.104) (-529.083) (-532.918) -- 0:00:51
89500 -- (-529.618) (-532.909) (-532.202) [-530.059] * [-532.536] (-533.591) (-533.358) (-529.888) -- 0:00:50
90000 -- (-529.861) (-531.387) (-537.902) [-529.886] * (-535.185) [-529.486] (-531.588) (-531.024) -- 0:00:50
Average standard deviation of split frequencies: 0.021788
90500 -- (-529.878) (-531.814) (-531.940) [-531.706] * (-536.603) (-529.134) [-531.004] (-531.390) -- 0:00:50
91000 -- (-531.909) (-530.641) [-531.221] (-529.559) * (-534.426) [-529.255] (-532.325) (-531.289) -- 0:00:49
91500 -- [-532.275] (-530.550) (-529.708) (-537.074) * (-529.727) (-529.258) (-529.908) [-534.886] -- 0:00:49
92000 -- (-529.848) [-530.410] (-530.478) (-529.865) * (-531.866) [-530.574] (-529.434) (-534.091) -- 0:00:49
92500 -- (-532.673) (-530.620) (-531.334) [-530.389] * (-534.150) (-533.707) (-534.422) [-530.325] -- 0:00:49
93000 -- (-529.599) (-534.872) (-533.486) [-534.320] * (-531.830) (-534.426) (-530.642) [-531.462] -- 0:00:48
93500 -- (-529.285) (-532.471) [-531.991] (-530.326) * (-531.931) (-529.721) [-530.106] (-529.569) -- 0:00:48
94000 -- (-530.383) (-533.156) [-532.137] (-531.001) * (-530.265) (-531.037) [-533.650] (-530.104) -- 0:00:48
94500 -- (-532.264) (-530.851) (-529.521) [-531.355] * (-531.772) [-530.419] (-534.738) (-532.067) -- 0:00:57
95000 -- (-533.342) (-532.740) [-529.724] (-529.879) * (-529.803) (-535.790) (-529.859) [-534.603] -- 0:00:57
Average standard deviation of split frequencies: 0.019642
95500 -- (-530.595) [-529.019] (-530.244) (-529.503) * (-528.634) (-532.013) [-530.878] (-530.360) -- 0:00:56
96000 -- (-529.851) [-529.535] (-529.306) (-533.108) * (-528.830) [-530.782] (-530.470) (-535.066) -- 0:00:56
96500 -- (-531.243) [-528.906] (-531.068) (-532.579) * (-530.290) (-530.716) [-530.015] (-533.481) -- 0:00:56
97000 -- (-533.111) (-529.520) [-533.737] (-529.583) * (-533.037) [-530.016] (-529.794) (-531.388) -- 0:00:55
97500 -- (-536.098) [-531.139] (-533.520) (-528.711) * (-530.972) (-530.097) [-530.830] (-530.139) -- 0:00:55
98000 -- (-531.827) [-532.974] (-531.582) (-528.594) * (-535.225) (-533.472) (-533.483) [-531.655] -- 0:00:55
98500 -- (-531.944) (-536.164) (-531.114) [-529.092] * (-532.367) (-531.208) [-530.465] (-532.518) -- 0:00:54
99000 -- [-535.089] (-532.045) (-529.935) (-529.661) * [-532.637] (-530.897) (-529.227) (-532.933) -- 0:00:54
99500 -- (-529.940) [-534.091] (-530.651) (-530.915) * (-531.051) (-533.673) (-531.002) [-529.151] -- 0:00:54
100000 -- (-538.993) [-530.494] (-530.466) (-529.402) * [-531.231] (-530.410) (-531.972) (-529.528) -- 0:00:54
Average standard deviation of split frequencies: 0.022243
100500 -- (-535.897) (-529.649) (-531.476) [-528.945] * (-529.790) [-530.542] (-530.696) (-529.957) -- 0:00:53
101000 -- [-531.580] (-533.648) (-533.261) (-532.037) * (-530.670) (-532.597) [-529.888] (-529.653) -- 0:00:53
101500 -- (-531.955) (-531.068) [-528.985] (-529.735) * (-531.161) (-529.191) [-534.499] (-531.641) -- 0:00:53
102000 -- (-531.342) (-529.976) [-529.276] (-532.254) * (-534.181) [-530.199] (-533.238) (-530.814) -- 0:00:52
102500 -- (-530.527) [-529.361] (-531.871) (-530.178) * (-533.998) (-529.479) [-529.727] (-533.709) -- 0:00:52
103000 -- (-529.442) (-532.141) [-532.817] (-531.420) * [-528.849] (-534.549) (-532.458) (-535.056) -- 0:00:52
103500 -- (-529.817) (-529.453) [-531.991] (-533.423) * (-530.812) (-537.141) (-530.878) [-533.948] -- 0:00:51
104000 -- [-530.069] (-529.563) (-530.527) (-530.279) * (-530.843) (-539.209) [-531.949] (-533.725) -- 0:00:51
104500 -- (-529.391) (-530.071) [-531.940] (-531.005) * (-536.192) (-537.797) [-532.860] (-536.868) -- 0:00:51
105000 -- [-531.399] (-532.753) (-530.937) (-529.412) * [-530.628] (-535.756) (-536.664) (-533.487) -- 0:00:51
Average standard deviation of split frequencies: 0.022236
105500 -- [-529.834] (-532.535) (-538.723) (-531.594) * [-531.453] (-534.536) (-531.224) (-531.370) -- 0:00:50
106000 -- [-529.518] (-534.037) (-530.692) (-534.699) * (-529.055) (-530.845) [-530.482] (-532.079) -- 0:00:50
106500 -- (-529.969) (-530.877) [-530.584] (-529.223) * (-530.217) (-532.968) (-530.990) [-529.808] -- 0:00:50
107000 -- (-530.561) (-533.058) (-529.710) [-529.771] * [-530.529] (-530.145) (-529.696) (-529.566) -- 0:00:50
107500 -- [-530.565] (-533.789) (-531.597) (-530.027) * [-530.430] (-530.087) (-529.725) (-529.393) -- 0:00:49
108000 -- (-530.929) (-532.104) (-532.736) [-532.415] * (-530.698) [-531.764] (-529.465) (-530.500) -- 0:00:49
108500 -- (-531.114) [-530.135] (-529.872) (-529.288) * (-532.567) (-529.652) (-535.488) [-529.942] -- 0:00:49
109000 -- [-531.118] (-531.394) (-530.462) (-532.953) * (-529.708) (-532.945) [-529.584] (-529.928) -- 0:00:49
109500 -- (-530.147) (-529.074) (-530.620) [-535.582] * (-533.151) (-530.520) [-530.477] (-530.014) -- 0:00:48
110000 -- (-530.157) (-530.239) (-531.093) [-532.308] * (-530.865) (-531.019) [-530.569] (-529.073) -- 0:00:48
Average standard deviation of split frequencies: 0.021937
110500 -- (-529.222) (-530.408) (-535.545) [-530.841] * [-531.188] (-529.480) (-532.156) (-529.680) -- 0:00:48
111000 -- (-530.049) (-532.696) [-531.203] (-529.863) * (-533.532) (-530.957) (-532.007) [-529.515] -- 0:00:48
111500 -- [-532.993] (-530.794) (-531.215) (-530.632) * [-529.638] (-529.702) (-530.363) (-531.286) -- 0:00:55
112000 -- [-530.330] (-532.009) (-530.267) (-535.219) * (-529.814) (-532.209) [-529.904] (-529.951) -- 0:00:55
112500 -- (-532.331) [-529.114] (-529.827) (-532.087) * (-532.071) (-529.750) [-530.585] (-530.495) -- 0:00:55
113000 -- (-534.146) [-530.068] (-531.627) (-533.637) * (-532.829) (-530.318) [-531.684] (-531.382) -- 0:00:54
113500 -- (-530.542) (-531.623) (-534.045) [-533.815] * (-530.386) [-530.244] (-532.699) (-531.675) -- 0:00:54
114000 -- (-529.637) (-531.994) (-534.774) [-530.020] * (-534.304) [-529.272] (-532.977) (-533.411) -- 0:00:54
114500 -- [-529.336] (-530.418) (-536.089) (-529.913) * (-534.747) (-529.696) (-532.063) [-530.944] -- 0:00:54
115000 -- (-540.303) [-530.804] (-541.990) (-530.797) * (-529.982) (-530.987) (-530.999) [-531.398] -- 0:00:53
Average standard deviation of split frequencies: 0.022961
115500 -- (-530.954) (-532.838) (-536.539) [-534.341] * (-531.781) (-529.779) [-533.113] (-533.375) -- 0:00:53
116000 -- [-530.379] (-531.700) (-531.261) (-534.632) * (-530.728) (-530.547) (-530.060) [-530.201] -- 0:00:53
116500 -- (-530.379) (-535.667) (-532.148) [-529.720] * [-530.007] (-528.893) (-529.661) (-531.114) -- 0:00:53
117000 -- (-530.853) [-531.248] (-530.353) (-529.527) * (-531.366) (-530.253) (-533.253) [-530.271] -- 0:00:52
117500 -- (-530.769) (-530.083) (-531.460) [-531.347] * [-534.315] (-529.398) (-532.244) (-533.541) -- 0:00:52
118000 -- [-530.099] (-531.594) (-534.195) (-530.189) * (-538.261) [-530.708] (-528.625) (-529.116) -- 0:00:52
118500 -- (-529.517) [-530.482] (-530.994) (-531.025) * (-530.195) [-529.837] (-529.836) (-531.707) -- 0:00:52
119000 -- (-529.787) (-531.949) (-529.688) [-530.224] * [-530.815] (-529.633) (-530.952) (-530.369) -- 0:00:51
119500 -- (-529.404) (-531.663) (-529.140) [-529.329] * (-529.749) (-532.131) [-528.921] (-532.087) -- 0:00:51
120000 -- [-529.035] (-530.502) (-529.190) (-529.680) * [-530.307] (-531.254) (-531.149) (-530.083) -- 0:00:51
Average standard deviation of split frequencies: 0.021877
120500 -- [-529.178] (-528.985) (-533.927) (-530.015) * (-530.133) (-534.623) (-532.141) [-530.136] -- 0:00:51
121000 -- [-529.549] (-529.129) (-534.666) (-530.843) * (-529.699) [-530.569] (-530.396) (-530.671) -- 0:00:50
121500 -- (-528.844) [-529.592] (-533.076) (-529.213) * (-532.450) (-529.672) [-531.735] (-530.305) -- 0:00:50
122000 -- (-532.815) [-531.250] (-529.404) (-529.094) * (-533.595) [-530.851] (-538.864) (-535.956) -- 0:00:50
122500 -- (-535.828) [-535.118] (-530.637) (-529.887) * (-533.303) [-533.219] (-531.612) (-530.945) -- 0:00:50
123000 -- (-530.770) (-534.270) (-532.276) [-529.690] * [-531.103] (-533.555) (-530.478) (-530.839) -- 0:00:49
123500 -- [-531.408] (-530.307) (-530.057) (-531.890) * (-532.005) (-532.164) (-532.649) [-530.236] -- 0:00:49
124000 -- (-532.083) (-532.462) [-530.551] (-533.732) * [-530.004] (-531.423) (-530.711) (-531.266) -- 0:00:49
124500 -- (-532.162) (-529.721) [-528.763] (-529.805) * (-530.862) (-531.101) (-532.870) [-529.928] -- 0:00:49
125000 -- (-532.597) [-535.554] (-529.260) (-532.099) * (-535.086) (-532.906) [-531.125] (-529.505) -- 0:00:49
Average standard deviation of split frequencies: 0.023695
125500 -- [-529.647] (-533.935) (-531.146) (-532.087) * (-529.848) [-531.259] (-528.969) (-530.450) -- 0:00:48
126000 -- (-529.226) (-530.833) [-529.622] (-530.964) * [-530.631] (-529.104) (-532.077) (-529.579) -- 0:00:48
126500 -- (-531.098) (-531.488) (-529.565) [-529.586] * (-528.849) [-528.834] (-528.762) (-530.163) -- 0:00:48
127000 -- [-531.952] (-531.449) (-529.684) (-535.537) * (-530.194) [-529.299] (-530.942) (-529.842) -- 0:00:48
127500 -- [-537.774] (-530.318) (-530.366) (-531.658) * (-529.607) (-529.344) [-529.764] (-531.818) -- 0:00:47
128000 -- (-532.031) [-529.282] (-530.601) (-532.519) * (-528.719) (-531.883) [-529.201] (-530.631) -- 0:00:47
128500 -- (-530.741) (-529.202) [-529.532] (-531.621) * [-529.078] (-530.165) (-535.437) (-530.443) -- 0:00:54
129000 -- (-530.946) [-530.032] (-530.361) (-533.305) * (-530.848) [-534.211] (-530.022) (-531.809) -- 0:00:54
129500 -- [-529.440] (-531.517) (-529.746) (-530.823) * (-529.558) [-530.276] (-532.311) (-532.861) -- 0:00:53
130000 -- [-531.297] (-530.006) (-529.698) (-532.025) * (-528.926) (-531.181) (-533.102) [-534.362] -- 0:00:53
Average standard deviation of split frequencies: 0.022849
130500 -- (-533.274) (-533.291) (-529.622) [-531.301] * (-532.395) [-530.718] (-532.580) (-530.056) -- 0:00:53
131000 -- (-530.084) (-537.221) (-530.393) [-529.189] * (-532.082) [-529.147] (-533.729) (-531.140) -- 0:00:53
131500 -- (-531.209) (-532.188) (-535.728) [-530.831] * (-531.286) (-529.536) (-532.291) [-530.100] -- 0:00:52
132000 -- [-531.172] (-530.578) (-532.422) (-532.009) * (-529.749) (-530.532) [-530.266] (-530.362) -- 0:00:52
132500 -- [-530.526] (-530.623) (-531.855) (-532.254) * (-528.769) [-530.667] (-533.677) (-530.142) -- 0:00:52
133000 -- (-531.032) (-529.642) [-531.309] (-529.364) * [-529.456] (-531.496) (-535.484) (-530.027) -- 0:00:52
133500 -- [-530.908] (-529.861) (-531.388) (-532.512) * (-530.842) [-530.401] (-532.696) (-532.088) -- 0:00:51
134000 -- (-534.357) (-532.051) (-530.327) [-533.587] * (-529.161) (-531.369) (-530.462) [-531.002] -- 0:00:51
134500 -- (-531.124) (-534.877) (-532.245) [-533.878] * [-534.182] (-531.931) (-530.502) (-529.808) -- 0:00:51
135000 -- (-533.223) (-530.014) (-529.965) [-530.025] * (-529.503) [-532.851] (-530.013) (-529.927) -- 0:00:51
Average standard deviation of split frequencies: 0.020797
135500 -- [-532.454] (-530.057) (-530.785) (-530.760) * [-529.652] (-529.879) (-528.889) (-532.471) -- 0:00:51
136000 -- (-535.005) (-531.611) (-531.391) [-531.270] * (-530.892) (-532.285) [-530.372] (-531.254) -- 0:00:50
136500 -- (-529.662) (-531.878) [-529.338] (-530.324) * [-531.726] (-530.640) (-534.473) (-531.305) -- 0:00:50
137000 -- (-530.651) (-530.750) (-529.684) [-529.451] * (-529.853) (-535.111) [-533.810] (-530.119) -- 0:00:50
137500 -- (-530.663) (-529.826) (-531.252) [-531.792] * (-531.634) (-533.107) (-528.936) [-529.896] -- 0:00:50
138000 -- (-532.504) [-530.807] (-529.828) (-531.629) * (-530.593) (-530.934) [-530.134] (-531.657) -- 0:00:49
138500 -- [-529.302] (-532.078) (-530.053) (-535.051) * (-531.983) (-532.420) [-530.369] (-531.098) -- 0:00:49
139000 -- (-529.732) (-533.713) (-530.532) [-533.041] * [-529.830] (-531.912) (-530.153) (-532.092) -- 0:00:49
139500 -- (-531.728) (-535.504) [-531.983] (-531.079) * (-532.513) [-532.936] (-535.323) (-537.904) -- 0:00:49
140000 -- (-531.460) (-533.150) [-530.051] (-529.215) * [-531.102] (-530.700) (-531.322) (-539.342) -- 0:00:49
Average standard deviation of split frequencies: 0.017259
140500 -- (-532.101) (-534.529) (-529.416) [-531.173] * (-530.464) [-530.978] (-534.563) (-531.343) -- 0:00:48
141000 -- (-532.300) [-530.882] (-529.746) (-530.915) * (-530.811) (-532.660) [-529.116] (-531.575) -- 0:00:48
141500 -- (-529.373) (-529.575) (-530.603) [-532.407] * (-530.400) [-530.423] (-531.905) (-531.457) -- 0:00:48
142000 -- (-530.692) (-530.136) (-531.048) [-529.440] * [-530.432] (-533.855) (-532.660) (-530.433) -- 0:00:48
142500 -- (-529.777) (-534.157) (-530.257) [-531.958] * (-534.930) (-532.826) [-529.842] (-531.842) -- 0:00:48
143000 -- (-530.871) (-529.430) (-529.400) [-530.203] * (-530.515) [-530.588] (-536.502) (-530.254) -- 0:00:47
143500 -- (-532.005) (-530.345) [-530.806] (-530.571) * (-529.795) [-529.492] (-531.409) (-532.329) -- 0:00:47
144000 -- [-529.284] (-531.417) (-529.894) (-532.800) * (-530.896) (-531.124) (-530.966) [-530.566] -- 0:00:47
144500 -- [-530.210] (-533.710) (-530.792) (-532.630) * (-530.370) (-530.209) [-530.352] (-529.735) -- 0:00:47
145000 -- [-531.033] (-534.117) (-532.437) (-530.122) * (-530.653) (-532.409) [-529.421] (-530.100) -- 0:00:47
Average standard deviation of split frequencies: 0.016305
145500 -- (-529.097) [-537.286] (-532.138) (-529.220) * [-530.390] (-531.422) (-532.593) (-529.248) -- 0:00:52
146000 -- (-529.909) (-532.324) [-532.025] (-530.839) * [-529.492] (-529.973) (-531.293) (-529.824) -- 0:00:52
146500 -- (-532.291) (-532.218) (-531.712) [-529.373] * (-529.755) [-529.278] (-529.577) (-530.953) -- 0:00:52
147000 -- (-535.166) (-533.104) [-532.704] (-534.472) * [-532.752] (-530.603) (-530.121) (-529.498) -- 0:00:52
147500 -- (-535.036) (-530.608) (-530.561) [-530.065] * (-531.569) (-528.685) (-532.997) [-532.437] -- 0:00:52
148000 -- (-533.545) (-531.956) [-529.388] (-529.524) * [-530.395] (-532.709) (-529.871) (-531.251) -- 0:00:51
148500 -- [-533.326] (-534.183) (-529.893) (-529.491) * (-531.171) (-530.736) (-533.261) [-531.781] -- 0:00:51
149000 -- (-531.359) (-532.491) [-532.482] (-533.656) * [-531.248] (-529.037) (-533.856) (-531.266) -- 0:00:51
149500 -- (-530.564) (-533.814) (-531.973) [-529.844] * (-537.368) (-534.448) [-532.675] (-530.786) -- 0:00:51
150000 -- (-530.702) (-532.935) [-531.504] (-532.070) * (-532.958) (-534.948) [-530.369] (-529.377) -- 0:00:51
Average standard deviation of split frequencies: 0.016583
150500 -- (-532.669) (-531.312) [-530.430] (-529.604) * (-531.764) [-529.524] (-531.426) (-529.606) -- 0:00:50
151000 -- (-533.204) (-531.582) [-531.285] (-529.885) * (-530.846) (-529.729) (-532.164) [-529.186] -- 0:00:50
151500 -- (-531.852) (-531.257) [-531.036] (-530.109) * (-529.774) (-534.862) [-533.097] (-531.170) -- 0:00:50
152000 -- (-532.347) [-530.172] (-533.111) (-529.031) * [-530.065] (-532.140) (-532.659) (-530.440) -- 0:00:50
152500 -- (-534.402) [-529.350] (-532.658) (-529.173) * (-529.482) (-532.304) (-532.322) [-529.807] -- 0:00:50
153000 -- (-533.109) (-533.000) (-533.118) [-531.043] * [-529.255] (-530.609) (-530.843) (-529.053) -- 0:00:49
153500 -- (-531.185) (-529.786) [-533.129] (-532.206) * (-529.317) (-528.760) [-530.284] (-529.486) -- 0:00:49
154000 -- (-531.437) (-531.958) [-533.915] (-530.357) * (-531.346) [-530.702] (-530.353) (-530.280) -- 0:00:49
154500 -- [-531.492] (-529.617) (-530.206) (-533.188) * (-532.418) (-530.505) [-530.809] (-533.636) -- 0:00:49
155000 -- (-530.283) (-529.982) [-530.997] (-530.459) * (-529.607) (-529.977) (-529.647) [-531.972] -- 0:00:49
Average standard deviation of split frequencies: 0.015277
155500 -- (-533.314) [-532.035] (-530.588) (-529.542) * (-530.437) (-531.715) [-531.538] (-532.966) -- 0:00:48
156000 -- (-535.105) (-530.535) [-531.048] (-531.492) * (-530.176) (-533.279) [-529.054] (-530.018) -- 0:00:48
156500 -- (-530.448) [-529.440] (-531.040) (-531.104) * (-531.615) (-534.817) (-532.445) [-529.818] -- 0:00:48
157000 -- (-532.069) (-530.787) (-533.825) [-530.390] * (-531.942) (-534.197) [-531.492] (-529.814) -- 0:00:48
157500 -- [-529.428] (-529.908) (-530.407) (-530.631) * (-530.308) (-532.740) (-529.189) [-530.417] -- 0:00:48
158000 -- (-530.183) [-530.150] (-528.909) (-534.179) * (-533.633) (-529.810) (-530.624) [-530.191] -- 0:00:47
158500 -- (-534.648) (-530.319) (-529.062) [-536.607] * (-529.798) (-530.410) [-530.411] (-531.369) -- 0:00:47
159000 -- (-530.209) [-530.291] (-532.365) (-532.154) * (-529.653) [-529.290] (-529.107) (-532.520) -- 0:00:47
159500 -- (-533.127) [-530.131] (-532.447) (-531.118) * (-529.550) [-529.425] (-528.790) (-530.181) -- 0:00:47
160000 -- [-530.759] (-530.242) (-534.641) (-529.380) * (-530.094) (-530.296) (-530.084) [-530.288] -- 0:00:47
Average standard deviation of split frequencies: 0.015159
160500 -- (-534.990) (-536.719) (-529.363) [-529.063] * (-528.776) (-530.715) (-530.122) [-528.968] -- 0:00:47
161000 -- (-531.016) (-534.013) [-530.026] (-533.124) * (-531.393) (-531.000) [-533.128] (-532.071) -- 0:00:46
161500 -- (-530.081) (-533.412) [-530.929] (-533.715) * (-530.185) [-530.395] (-531.866) (-530.980) -- 0:00:46
162000 -- [-529.013] (-529.448) (-531.648) (-534.143) * (-529.963) [-533.826] (-533.202) (-530.501) -- 0:00:46
162500 -- (-529.430) [-532.096] (-532.919) (-536.413) * (-529.124) (-532.674) [-532.125] (-533.539) -- 0:00:51
163000 -- (-530.566) [-535.039] (-535.692) (-529.734) * (-532.119) [-530.847] (-530.202) (-531.506) -- 0:00:51
163500 -- [-530.007] (-539.077) (-532.267) (-531.604) * [-529.715] (-530.341) (-529.498) (-532.247) -- 0:00:51
164000 -- (-533.042) [-532.106] (-530.331) (-530.276) * (-530.400) (-534.829) (-529.221) [-534.135] -- 0:00:50
164500 -- [-528.801] (-533.287) (-530.115) (-532.557) * (-535.697) (-531.549) (-533.959) [-533.138] -- 0:00:50
165000 -- (-531.797) (-532.442) (-532.659) [-530.030] * (-534.438) [-532.885] (-532.650) (-534.021) -- 0:00:50
Average standard deviation of split frequencies: 0.015245
165500 -- (-532.145) (-530.122) (-532.142) [-531.607] * (-529.402) [-529.756] (-531.884) (-531.526) -- 0:00:50
166000 -- (-531.689) (-530.633) (-530.452) [-529.282] * (-530.273) (-529.694) (-530.935) [-530.906] -- 0:00:50
166500 -- (-531.720) (-532.343) [-530.214] (-531.960) * (-531.254) [-530.531] (-534.254) (-530.539) -- 0:00:50
167000 -- (-531.769) (-533.012) (-529.813) [-529.880] * (-530.814) (-529.676) (-530.828) [-530.573] -- 0:00:49
167500 -- [-532.562] (-529.704) (-532.234) (-530.086) * (-532.520) (-534.892) [-530.958] (-532.544) -- 0:00:49
168000 -- [-531.982] (-532.113) (-528.848) (-530.459) * [-530.622] (-530.585) (-532.356) (-531.144) -- 0:00:49
168500 -- (-530.322) (-530.022) [-529.345] (-534.540) * [-531.545] (-531.221) (-531.464) (-529.472) -- 0:00:49
169000 -- (-532.721) (-531.686) [-529.533] (-531.868) * (-529.612) (-532.427) [-530.436] (-530.477) -- 0:00:49
169500 -- (-530.494) (-530.602) [-534.886] (-534.247) * (-536.687) (-532.576) [-530.507] (-529.937) -- 0:00:48
170000 -- (-532.866) (-535.090) (-537.717) [-531.225] * (-532.019) (-535.022) [-529.518] (-531.411) -- 0:00:48
Average standard deviation of split frequencies: 0.014777
170500 -- [-531.642] (-531.816) (-532.524) (-533.089) * (-529.769) (-532.851) [-529.834] (-531.349) -- 0:00:48
171000 -- (-536.507) [-531.000] (-534.162) (-532.707) * (-534.734) [-531.933] (-529.728) (-531.371) -- 0:00:48
171500 -- (-533.311) [-532.615] (-535.289) (-530.450) * [-529.983] (-533.387) (-532.445) (-532.685) -- 0:00:48
172000 -- (-531.271) [-534.138] (-529.288) (-530.585) * (-530.950) (-529.974) [-531.213] (-529.283) -- 0:00:48
172500 -- (-531.052) [-530.127] (-530.705) (-529.571) * (-532.879) (-530.413) [-530.437] (-530.407) -- 0:00:47
173000 -- (-533.133) (-531.050) [-538.580] (-533.567) * (-528.758) (-530.495) [-530.944] (-533.577) -- 0:00:47
173500 -- (-529.630) (-529.328) [-531.468] (-531.303) * (-529.909) [-529.810] (-533.439) (-532.551) -- 0:00:47
174000 -- [-536.013] (-531.191) (-532.481) (-530.047) * [-531.759] (-533.020) (-529.583) (-534.989) -- 0:00:47
174500 -- (-537.374) (-531.619) (-534.880) [-530.991] * (-542.311) [-531.052] (-531.015) (-533.290) -- 0:00:47
175000 -- (-529.055) (-529.634) [-537.576] (-534.903) * (-539.201) [-531.601] (-535.920) (-530.622) -- 0:00:47
Average standard deviation of split frequencies: 0.016606
175500 -- (-531.970) [-530.588] (-533.833) (-532.008) * (-530.356) (-535.103) [-529.905] (-532.275) -- 0:00:46
176000 -- [-530.858] (-534.744) (-529.511) (-531.088) * (-534.175) (-535.681) [-530.283] (-532.028) -- 0:00:46
176500 -- (-531.586) (-534.806) (-530.356) [-529.488] * (-529.660) [-530.973] (-530.643) (-533.111) -- 0:00:46
177000 -- (-530.412) (-535.470) [-529.374] (-530.708) * (-529.905) [-531.284] (-530.031) (-534.089) -- 0:00:46
177500 -- (-529.076) (-531.897) [-530.106] (-531.071) * (-534.302) [-533.777] (-530.412) (-533.870) -- 0:00:46
178000 -- (-529.762) [-531.994] (-535.062) (-533.191) * (-531.054) (-533.721) [-533.990] (-529.373) -- 0:00:46
178500 -- (-533.766) (-533.276) (-533.639) [-534.061] * (-530.790) [-531.106] (-533.665) (-536.030) -- 0:00:46
179000 -- (-529.398) [-533.134] (-532.199) (-532.367) * (-533.590) (-532.055) (-529.878) [-530.914] -- 0:00:45
179500 -- (-529.598) (-530.974) (-532.185) [-535.100] * (-531.310) (-530.605) (-530.457) [-530.105] -- 0:00:50
180000 -- [-532.013] (-530.099) (-529.766) (-538.625) * [-530.262] (-532.568) (-532.243) (-530.810) -- 0:00:50
Average standard deviation of split frequencies: 0.015366
180500 -- (-532.071) [-531.194] (-528.946) (-535.306) * [-531.512] (-532.532) (-533.499) (-531.357) -- 0:00:49
181000 -- (-531.384) [-530.637] (-529.886) (-531.381) * [-531.503] (-529.279) (-537.658) (-529.993) -- 0:00:49
181500 -- (-531.009) (-530.841) [-529.324] (-532.423) * [-531.721] (-531.723) (-533.861) (-530.713) -- 0:00:49
182000 -- (-530.454) [-530.556] (-529.183) (-530.658) * (-534.083) (-530.669) (-533.013) [-530.007] -- 0:00:49
182500 -- (-531.707) [-531.247] (-530.931) (-530.863) * (-532.167) (-530.203) [-529.303] (-530.131) -- 0:00:49
183000 -- [-529.368] (-530.521) (-531.345) (-530.152) * [-530.629] (-531.689) (-531.287) (-529.338) -- 0:00:49
183500 -- (-529.252) (-530.881) (-531.752) [-530.484] * [-530.048] (-531.802) (-530.665) (-533.031) -- 0:00:48
184000 -- [-530.743] (-532.382) (-531.385) (-530.026) * [-528.833] (-531.064) (-535.625) (-535.026) -- 0:00:48
184500 -- (-530.000) (-530.340) [-529.120] (-531.165) * (-533.645) (-534.381) [-531.684] (-531.204) -- 0:00:48
185000 -- [-530.893] (-529.491) (-528.986) (-533.679) * [-532.533] (-533.533) (-533.710) (-531.487) -- 0:00:48
Average standard deviation of split frequencies: 0.016981
185500 -- (-529.844) [-530.393] (-532.728) (-532.308) * (-530.042) [-530.212] (-533.504) (-532.861) -- 0:00:48
186000 -- (-531.029) (-530.879) (-531.868) [-535.702] * [-529.659] (-529.978) (-532.124) (-529.207) -- 0:00:48
186500 -- (-531.835) (-530.741) (-531.752) [-528.912] * (-532.854) [-530.940] (-531.479) (-529.921) -- 0:00:47
187000 -- (-534.995) [-533.039] (-530.168) (-531.218) * (-532.050) [-529.782] (-530.689) (-530.079) -- 0:00:47
187500 -- (-533.170) [-535.093] (-530.132) (-532.036) * (-534.153) (-531.137) [-530.078] (-530.449) -- 0:00:47
188000 -- (-533.587) (-531.927) (-529.077) [-531.976] * (-531.632) (-530.011) (-531.294) [-530.163] -- 0:00:47
188500 -- (-530.613) (-532.417) [-529.266] (-533.470) * (-532.789) [-532.650] (-529.981) (-529.833) -- 0:00:47
189000 -- (-531.377) (-530.542) [-529.596] (-530.311) * [-529.826] (-531.348) (-531.569) (-531.849) -- 0:00:47
189500 -- (-534.388) (-530.201) [-530.064] (-529.987) * (-532.735) (-535.565) [-533.756] (-533.712) -- 0:00:47
190000 -- (-531.251) (-530.341) [-530.267] (-529.648) * [-531.424] (-537.242) (-530.574) (-534.531) -- 0:00:46
Average standard deviation of split frequencies: 0.015875
190500 -- (-536.197) [-530.015] (-532.128) (-529.279) * (-534.568) (-536.566) [-529.458] (-532.417) -- 0:00:46
191000 -- (-530.089) [-531.840] (-532.581) (-529.818) * (-530.964) (-531.235) (-530.280) [-531.395] -- 0:00:46
191500 -- (-529.959) [-529.994] (-531.050) (-530.581) * (-531.302) (-531.282) [-528.976] (-530.905) -- 0:00:46
192000 -- (-530.619) [-532.462] (-530.305) (-532.054) * [-529.876] (-533.939) (-529.626) (-532.622) -- 0:00:46
192500 -- (-529.884) (-531.743) [-530.082] (-531.981) * (-530.164) (-532.097) [-530.784] (-530.377) -- 0:00:46
193000 -- (-533.214) (-529.487) (-532.319) [-533.709] * [-531.327] (-530.647) (-531.549) (-530.960) -- 0:00:45
193500 -- (-535.169) (-529.825) [-531.552] (-530.916) * (-529.715) (-530.831) (-529.738) [-532.949] -- 0:00:45
194000 -- [-532.064] (-530.245) (-533.918) (-538.245) * (-529.924) [-530.944] (-530.681) (-530.897) -- 0:00:45
194500 -- (-534.427) [-531.333] (-532.219) (-531.449) * (-535.082) (-531.609) (-533.593) [-530.926] -- 0:00:45
195000 -- (-530.159) [-530.514] (-532.309) (-536.760) * [-529.605] (-533.664) (-529.799) (-530.111) -- 0:00:45
Average standard deviation of split frequencies: 0.017089
195500 -- (-530.761) [-530.674] (-532.054) (-530.159) * (-529.435) (-531.783) [-530.085] (-533.955) -- 0:00:45
196000 -- (-533.069) [-530.543] (-532.834) (-533.299) * (-530.846) [-531.574] (-531.267) (-532.566) -- 0:00:49
196500 -- [-529.800] (-529.185) (-533.998) (-532.089) * (-531.983) [-530.730] (-533.351) (-531.807) -- 0:00:49
197000 -- [-530.541] (-532.167) (-529.743) (-533.142) * (-532.053) (-531.826) (-530.492) [-529.914] -- 0:00:48
197500 -- [-530.688] (-529.343) (-531.713) (-533.987) * [-529.675] (-530.577) (-532.121) (-530.275) -- 0:00:48
198000 -- [-530.387] (-530.759) (-529.015) (-533.822) * [-530.048] (-532.932) (-533.943) (-531.182) -- 0:00:48
198500 -- [-531.344] (-529.041) (-530.598) (-530.167) * (-530.608) (-531.709) (-531.552) [-533.671] -- 0:00:48
199000 -- (-531.664) (-529.685) (-529.616) [-530.648] * [-531.430] (-529.843) (-530.051) (-532.500) -- 0:00:48
199500 -- [-529.575] (-530.430) (-528.947) (-539.287) * (-530.514) (-529.904) (-531.467) [-533.052] -- 0:00:48
200000 -- (-530.833) [-531.646] (-529.080) (-530.123) * [-529.562] (-529.113) (-530.316) (-532.521) -- 0:00:48
Average standard deviation of split frequencies: 0.017358
200500 -- (-531.524) (-529.991) [-528.679] (-530.921) * (-529.631) (-533.886) [-530.977] (-534.228) -- 0:00:47
201000 -- [-529.016] (-529.547) (-533.147) (-530.009) * (-530.079) (-532.138) (-533.380) [-530.944] -- 0:00:47
201500 -- (-531.345) [-530.237] (-531.819) (-532.246) * (-532.690) (-529.083) [-530.623] (-530.469) -- 0:00:47
202000 -- [-532.959] (-532.939) (-531.997) (-530.716) * (-536.011) [-530.853] (-530.497) (-531.872) -- 0:00:47
202500 -- (-529.816) [-533.258] (-529.887) (-532.241) * [-532.314] (-529.811) (-529.850) (-535.978) -- 0:00:47
203000 -- (-528.870) (-529.865) [-531.942] (-531.772) * (-529.723) [-532.358] (-531.272) (-534.461) -- 0:00:47
203500 -- (-531.694) [-529.279] (-531.437) (-533.165) * (-530.264) (-533.932) (-531.174) [-531.825] -- 0:00:46
204000 -- (-530.331) (-529.676) [-532.487] (-533.304) * (-529.620) (-533.576) [-529.101] (-532.257) -- 0:00:46
204500 -- (-532.847) (-538.941) (-534.899) [-532.308] * (-529.485) (-530.109) [-528.597] (-530.291) -- 0:00:46
205000 -- (-529.869) (-532.025) [-532.927] (-531.546) * (-534.084) (-529.798) (-529.857) [-530.242] -- 0:00:46
Average standard deviation of split frequencies: 0.017584
205500 -- [-530.421] (-534.368) (-530.062) (-530.684) * (-529.726) (-530.596) (-529.654) [-532.369] -- 0:00:46
206000 -- (-530.859) (-530.904) (-532.605) [-530.340] * (-530.822) [-531.437] (-529.346) (-529.387) -- 0:00:46
206500 -- (-531.520) (-529.079) [-533.691] (-537.382) * (-528.993) (-532.035) (-529.397) [-529.945] -- 0:00:46
207000 -- (-532.600) (-528.920) [-531.778] (-532.585) * (-529.520) (-530.535) [-531.302] (-533.686) -- 0:00:45
207500 -- [-532.327] (-531.592) (-530.987) (-529.523) * [-529.476] (-529.996) (-533.328) (-531.620) -- 0:00:45
208000 -- (-530.035) [-530.001] (-529.796) (-530.883) * (-529.704) (-531.172) [-536.901] (-530.578) -- 0:00:45
208500 -- [-531.257] (-529.666) (-530.479) (-530.926) * [-529.541] (-530.480) (-530.986) (-535.068) -- 0:00:45
209000 -- [-530.433] (-531.024) (-529.781) (-531.765) * [-531.269] (-533.288) (-530.383) (-533.935) -- 0:00:45
209500 -- (-533.813) [-531.723] (-534.338) (-531.915) * (-529.654) [-529.360] (-530.695) (-533.356) -- 0:00:45
210000 -- [-529.924] (-531.291) (-529.598) (-530.033) * (-531.548) [-530.429] (-530.095) (-535.285) -- 0:00:45
Average standard deviation of split frequencies: 0.015664
210500 -- [-530.851] (-534.718) (-530.539) (-529.369) * [-533.242] (-530.908) (-531.015) (-530.743) -- 0:00:45
211000 -- (-530.183) (-533.585) (-530.149) [-532.109] * (-531.098) [-531.459] (-531.188) (-529.928) -- 0:00:44
211500 -- (-535.991) (-533.544) [-529.417] (-530.250) * (-532.137) [-530.540] (-530.237) (-530.930) -- 0:00:44
212000 -- (-533.587) (-533.134) [-531.449] (-530.149) * (-530.804) (-531.288) [-530.551] (-530.819) -- 0:00:44
212500 -- [-530.296] (-530.861) (-535.426) (-528.933) * [-529.913] (-538.984) (-532.028) (-531.837) -- 0:00:48
213000 -- (-531.246) [-530.844] (-530.953) (-529.024) * (-528.899) (-532.587) (-532.051) [-531.879] -- 0:00:48
213500 -- (-530.134) (-528.673) [-529.732] (-528.860) * (-532.458) [-528.825] (-530.088) (-538.521) -- 0:00:47
214000 -- (-528.929) (-531.372) [-530.595] (-530.976) * [-530.297] (-530.632) (-534.864) (-531.540) -- 0:00:47
214500 -- (-530.287) [-530.560] (-532.220) (-535.217) * (-529.963) [-530.533] (-532.306) (-531.174) -- 0:00:47
215000 -- (-531.573) (-531.895) (-529.967) [-530.214] * (-530.425) (-530.123) (-530.986) [-533.942] -- 0:00:47
Average standard deviation of split frequencies: 0.015736
215500 -- (-529.675) (-534.274) (-533.576) [-532.866] * [-528.744] (-528.893) (-530.453) (-535.967) -- 0:00:47
216000 -- [-528.940] (-529.266) (-531.818) (-533.334) * (-531.345) [-534.451] (-531.133) (-536.158) -- 0:00:47
216500 -- [-531.255] (-531.587) (-530.416) (-531.077) * (-531.647) [-529.708] (-532.031) (-531.000) -- 0:00:47
217000 -- [-532.414] (-531.754) (-530.335) (-532.426) * (-530.332) [-532.347] (-532.328) (-530.746) -- 0:00:46
217500 -- (-530.784) [-532.439] (-530.740) (-528.926) * (-529.401) (-532.297) [-531.780] (-531.824) -- 0:00:46
218000 -- (-533.092) (-529.088) (-531.211) [-529.391] * (-529.489) (-532.098) (-531.189) [-529.797] -- 0:00:46
218500 -- (-533.234) [-530.822] (-531.762) (-529.553) * (-534.578) (-531.996) (-529.504) [-530.759] -- 0:00:46
219000 -- (-530.462) (-531.456) (-530.486) [-528.897] * (-537.485) (-531.285) (-530.088) [-529.609] -- 0:00:46
219500 -- [-532.071] (-531.603) (-529.109) (-529.481) * (-534.935) (-532.236) [-529.374] (-529.167) -- 0:00:46
220000 -- (-532.445) (-530.585) [-528.947] (-530.926) * (-532.096) (-534.151) [-529.707] (-529.208) -- 0:00:46
Average standard deviation of split frequencies: 0.015073
220500 -- (-532.799) (-532.012) (-531.057) [-529.762] * (-532.642) (-531.341) (-530.194) [-530.402] -- 0:00:45
221000 -- [-532.540] (-536.795) (-530.880) (-530.479) * [-529.861] (-532.823) (-532.130) (-529.682) -- 0:00:45
221500 -- (-533.227) [-533.196] (-529.356) (-530.666) * [-530.861] (-530.192) (-535.142) (-532.503) -- 0:00:45
222000 -- (-529.578) (-532.370) [-529.071] (-530.696) * (-529.652) (-530.509) (-530.031) [-530.495] -- 0:00:45
222500 -- (-529.939) [-535.377] (-531.517) (-529.217) * [-530.129] (-529.629) (-531.474) (-530.508) -- 0:00:45
223000 -- [-530.001] (-530.910) (-532.508) (-533.037) * (-530.501) (-531.979) (-530.195) [-530.959] -- 0:00:45
223500 -- (-536.907) (-529.931) [-529.827] (-531.930) * (-529.981) (-530.573) (-533.488) [-531.154] -- 0:00:45
224000 -- (-535.027) (-531.161) (-528.656) [-530.330] * [-529.296] (-529.966) (-535.923) (-530.284) -- 0:00:45
224500 -- [-529.352] (-529.204) (-530.107) (-530.856) * (-530.873) (-531.364) [-534.011] (-531.597) -- 0:00:44
225000 -- (-532.234) [-529.325] (-534.310) (-532.450) * (-532.925) (-530.753) [-533.497] (-530.470) -- 0:00:44
Average standard deviation of split frequencies: 0.014930
225500 -- (-532.955) (-529.791) [-531.341] (-530.222) * (-530.238) (-530.044) [-529.241] (-532.928) -- 0:00:44
226000 -- (-534.329) [-529.913] (-529.784) (-530.505) * [-533.292] (-530.423) (-534.256) (-533.741) -- 0:00:44
226500 -- (-532.811) [-530.561] (-530.843) (-529.879) * (-533.359) [-531.286] (-531.747) (-530.754) -- 0:00:44
227000 -- [-530.090] (-531.875) (-529.069) (-529.678) * [-536.883] (-532.038) (-531.966) (-530.176) -- 0:00:44
227500 -- (-530.548) (-532.999) (-529.050) [-530.230] * (-533.754) (-532.610) (-530.303) [-528.639] -- 0:00:44
228000 -- (-530.488) (-531.629) [-531.984] (-530.069) * (-533.482) (-536.632) [-530.761] (-529.694) -- 0:00:44
228500 -- (-530.600) [-529.624] (-532.059) (-530.030) * [-532.893] (-531.423) (-529.526) (-530.782) -- 0:00:43
229000 -- (-532.263) (-532.654) [-530.435] (-532.912) * (-532.090) (-530.945) (-530.467) [-528.677] -- 0:00:43
229500 -- (-532.806) [-530.397] (-529.217) (-532.424) * (-535.756) [-529.602] (-530.856) (-532.191) -- 0:00:47
230000 -- (-533.033) [-533.586] (-528.909) (-530.182) * (-529.745) [-529.229] (-530.835) (-531.682) -- 0:00:46
Average standard deviation of split frequencies: 0.015782
230500 -- [-532.412] (-532.295) (-533.088) (-535.553) * [-529.478] (-530.346) (-531.447) (-532.813) -- 0:00:46
231000 -- [-531.859] (-529.705) (-530.971) (-531.470) * (-530.802) (-529.785) [-530.202] (-528.733) -- 0:00:46
231500 -- (-532.410) (-530.769) (-531.178) [-529.301] * (-532.682) [-534.069] (-529.970) (-529.434) -- 0:00:46
232000 -- (-531.796) (-530.864) [-530.086] (-530.080) * (-532.726) [-531.594] (-529.540) (-529.048) -- 0:00:46
232500 -- (-530.681) (-530.257) [-532.086] (-529.756) * [-532.912] (-530.065) (-530.633) (-530.962) -- 0:00:46
233000 -- (-531.535) (-529.617) [-530.564] (-529.867) * [-532.500] (-533.028) (-530.267) (-531.489) -- 0:00:46
233500 -- (-530.696) [-529.651] (-533.006) (-530.137) * (-529.777) (-532.001) (-530.246) [-529.863] -- 0:00:45
234000 -- [-529.123] (-530.325) (-530.119) (-532.975) * (-530.562) (-531.580) (-531.635) [-531.126] -- 0:00:45
234500 -- [-530.327] (-532.890) (-534.564) (-530.987) * [-533.795] (-531.384) (-529.261) (-532.065) -- 0:00:45
235000 -- (-530.111) (-530.928) (-534.115) [-530.728] * (-530.993) [-530.385] (-529.740) (-530.543) -- 0:00:45
Average standard deviation of split frequencies: 0.015203
235500 -- [-532.960] (-532.995) (-532.903) (-528.768) * [-530.452] (-529.683) (-533.185) (-530.273) -- 0:00:45
236000 -- (-530.873) (-533.563) [-535.339] (-532.427) * [-528.661] (-530.428) (-532.062) (-530.079) -- 0:00:45
236500 -- [-530.014] (-529.918) (-529.772) (-530.366) * (-530.158) (-530.436) [-531.892] (-529.830) -- 0:00:45
237000 -- (-530.939) (-532.933) [-532.221] (-530.705) * (-531.348) [-530.483] (-534.459) (-532.291) -- 0:00:45
237500 -- [-528.988] (-529.408) (-530.249) (-531.102) * (-529.926) [-531.716] (-529.177) (-530.874) -- 0:00:44
238000 -- (-530.732) [-531.375] (-534.029) (-531.619) * (-530.148) (-531.680) [-532.408] (-533.371) -- 0:00:44
238500 -- (-535.659) [-531.505] (-531.902) (-534.895) * [-529.928] (-530.393) (-532.674) (-532.995) -- 0:00:44
239000 -- (-528.807) (-532.129) [-532.298] (-529.191) * (-531.793) (-533.247) (-529.095) [-532.599] -- 0:00:44
239500 -- (-532.611) [-531.832] (-538.013) (-529.319) * [-530.972] (-535.047) (-530.274) (-528.818) -- 0:00:44
240000 -- (-532.446) [-536.582] (-531.751) (-532.806) * (-531.047) (-532.400) (-531.704) [-531.072] -- 0:00:44
Average standard deviation of split frequencies: 0.015235
240500 -- [-531.928] (-539.221) (-536.191) (-534.662) * [-529.558] (-532.653) (-531.018) (-531.718) -- 0:00:44
241000 -- [-535.763] (-542.370) (-530.582) (-533.267) * (-531.610) [-529.608] (-529.137) (-534.117) -- 0:00:44
241500 -- (-531.543) (-544.230) [-534.377] (-530.790) * (-531.180) (-533.387) [-529.430] (-529.119) -- 0:00:43
242000 -- (-534.375) (-542.583) [-530.329] (-535.264) * [-531.365] (-534.265) (-531.341) (-532.431) -- 0:00:43
242500 -- [-530.688] (-532.627) (-532.437) (-531.060) * (-532.593) [-529.677] (-529.565) (-533.091) -- 0:00:43
243000 -- (-529.365) [-530.256] (-529.419) (-529.909) * (-529.510) (-531.315) [-532.092] (-532.423) -- 0:00:43
243500 -- (-530.416) (-535.463) [-529.904] (-534.663) * [-529.523] (-530.292) (-532.148) (-532.602) -- 0:00:43
244000 -- (-529.997) [-530.516] (-530.864) (-530.524) * (-531.891) (-531.124) (-532.470) [-529.826] -- 0:00:43
244500 -- [-529.736] (-534.697) (-529.799) (-530.972) * (-531.731) [-530.916] (-534.331) (-530.292) -- 0:00:43
245000 -- (-534.170) [-531.554] (-531.155) (-529.646) * [-535.061] (-531.909) (-529.889) (-531.820) -- 0:00:43
Average standard deviation of split frequencies: 0.014927
245500 -- [-530.110] (-535.157) (-529.582) (-529.126) * (-532.277) [-531.221] (-531.317) (-532.252) -- 0:00:43
246000 -- [-533.740] (-534.426) (-529.170) (-530.883) * [-531.709] (-530.626) (-533.146) (-531.204) -- 0:00:42
246500 -- (-532.379) (-529.878) [-530.294] (-530.306) * (-530.411) [-528.799] (-531.989) (-534.502) -- 0:00:45
247000 -- [-530.048] (-529.446) (-530.370) (-529.396) * [-529.756] (-529.497) (-536.345) (-530.896) -- 0:00:45
247500 -- (-533.962) (-529.184) [-530.623] (-531.629) * (-530.857) (-533.598) [-531.307] (-540.842) -- 0:00:45
248000 -- (-528.947) (-530.094) [-529.275] (-530.528) * [-532.400] (-533.488) (-533.277) (-530.729) -- 0:00:45
248500 -- (-529.989) [-530.748] (-531.410) (-533.120) * (-539.805) [-530.687] (-533.384) (-530.159) -- 0:00:45
249000 -- (-531.045) (-532.345) [-529.174] (-531.536) * (-530.613) [-530.879] (-530.296) (-530.485) -- 0:00:45
249500 -- [-530.080] (-529.555) (-530.677) (-531.553) * (-533.576) (-529.618) (-529.844) [-530.921] -- 0:00:45
250000 -- (-534.112) (-530.400) [-531.407] (-531.138) * [-535.307] (-534.666) (-533.344) (-532.141) -- 0:00:45
Average standard deviation of split frequencies: 0.015155
250500 -- (-531.829) (-532.917) (-535.387) [-531.525] * [-534.492] (-536.032) (-531.962) (-531.620) -- 0:00:44
251000 -- (-530.442) [-531.651] (-529.918) (-531.180) * (-531.960) [-529.464] (-537.914) (-533.414) -- 0:00:44
251500 -- (-534.375) (-529.409) (-532.325) [-530.393] * (-530.126) (-530.328) (-531.870) [-529.323] -- 0:00:44
252000 -- [-531.840] (-536.290) (-529.427) (-531.620) * (-531.675) (-534.267) (-532.683) [-530.996] -- 0:00:44
252500 -- (-530.872) (-531.182) [-532.144] (-531.677) * [-529.081] (-530.633) (-530.419) (-529.108) -- 0:00:44
253000 -- (-530.413) (-532.712) [-530.717] (-533.571) * (-529.673) [-533.635] (-533.403) (-529.846) -- 0:00:44
253500 -- (-531.846) (-529.836) [-529.951] (-531.643) * [-533.916] (-530.465) (-532.628) (-531.454) -- 0:00:44
254000 -- (-531.623) (-532.796) [-534.539] (-529.576) * (-530.377) (-529.922) [-529.279] (-529.736) -- 0:00:44
254500 -- (-533.050) [-535.395] (-529.589) (-531.703) * (-529.509) (-529.448) (-530.159) [-530.095] -- 0:00:43
255000 -- [-530.119] (-537.459) (-533.064) (-532.199) * (-531.972) (-532.179) [-530.224] (-530.246) -- 0:00:43
Average standard deviation of split frequencies: 0.015056
255500 -- (-529.867) (-532.675) (-530.859) [-531.597] * [-533.145] (-530.514) (-530.976) (-530.035) -- 0:00:43
256000 -- (-531.224) (-534.579) [-532.621] (-531.225) * (-532.915) (-532.191) [-530.241] (-530.923) -- 0:00:43
256500 -- [-530.054] (-532.494) (-532.815) (-534.588) * [-531.711] (-531.834) (-530.167) (-535.040) -- 0:00:43
257000 -- (-530.333) (-531.760) [-531.414] (-531.707) * [-531.518] (-533.797) (-531.765) (-531.102) -- 0:00:43
257500 -- (-534.307) (-531.177) (-530.601) [-530.905] * (-530.961) (-529.687) (-532.356) [-532.918] -- 0:00:43
258000 -- (-532.143) (-530.986) [-529.755] (-529.300) * [-530.612] (-531.671) (-530.330) (-529.631) -- 0:00:43
258500 -- (-533.968) (-530.699) [-534.335] (-529.315) * [-531.344] (-533.025) (-529.746) (-533.923) -- 0:00:43
259000 -- (-532.506) [-531.394] (-530.480) (-529.773) * (-531.326) (-530.465) (-532.300) [-530.868] -- 0:00:42
259500 -- [-529.189] (-528.723) (-530.938) (-531.124) * (-534.112) [-529.320] (-534.158) (-529.841) -- 0:00:42
260000 -- (-530.487) [-530.180] (-532.889) (-531.059) * (-530.909) (-529.628) (-531.552) [-534.815] -- 0:00:42
Average standard deviation of split frequencies: 0.014149
260500 -- [-529.994] (-529.501) (-530.210) (-531.428) * (-529.928) [-528.882] (-529.436) (-530.451) -- 0:00:42
261000 -- (-531.969) (-529.384) (-529.410) [-529.286] * (-530.223) (-529.521) (-528.817) [-531.767] -- 0:00:42
261500 -- [-534.647] (-531.010) (-529.448) (-529.162) * [-529.010] (-530.428) (-529.636) (-530.925) -- 0:00:42
262000 -- [-529.311] (-530.118) (-530.864) (-529.027) * (-530.520) [-530.387] (-532.018) (-528.908) -- 0:00:42
262500 -- [-534.580] (-530.168) (-533.013) (-529.799) * [-530.099] (-531.794) (-531.342) (-538.414) -- 0:00:42
263000 -- (-531.365) [-531.858] (-531.478) (-529.505) * [-530.980] (-530.105) (-531.970) (-535.242) -- 0:00:42
263500 -- (-529.247) (-531.738) [-531.796] (-529.382) * (-530.047) [-529.855] (-531.518) (-529.363) -- 0:00:44
264000 -- (-530.485) [-529.474] (-531.029) (-531.304) * (-530.842) (-530.601) [-529.694] (-532.161) -- 0:00:44
264500 -- (-530.661) (-529.272) (-531.119) [-530.478] * [-531.862] (-530.134) (-530.657) (-530.360) -- 0:00:44
265000 -- [-529.534] (-530.646) (-532.014) (-532.160) * (-534.409) (-529.695) [-530.570] (-532.063) -- 0:00:44
Average standard deviation of split frequencies: 0.014768
265500 -- [-529.367] (-531.191) (-530.868) (-529.245) * (-532.278) [-530.992] (-529.360) (-531.345) -- 0:00:44
266000 -- (-531.775) (-529.093) [-529.613] (-529.634) * (-531.931) (-529.474) (-530.789) [-531.207] -- 0:00:44
266500 -- [-531.233] (-535.999) (-532.817) (-531.941) * (-531.562) (-530.122) [-531.504] (-533.243) -- 0:00:44
267000 -- (-529.553) (-532.747) (-532.264) [-529.683] * (-533.686) [-533.094] (-531.146) (-531.265) -- 0:00:43
267500 -- (-533.867) (-532.330) (-531.372) [-531.640] * (-531.094) (-529.061) [-530.949] (-533.434) -- 0:00:43
268000 -- (-534.159) [-529.057] (-532.691) (-529.908) * (-530.088) (-529.013) (-534.347) [-530.477] -- 0:00:43
268500 -- [-534.434] (-530.829) (-530.402) (-531.904) * (-529.724) [-530.610] (-532.457) (-529.192) -- 0:00:43
269000 -- (-530.398) [-529.814] (-531.838) (-529.898) * (-530.845) (-529.803) [-531.754] (-532.645) -- 0:00:43
269500 -- (-532.676) (-530.790) (-529.984) [-533.352] * [-530.986] (-529.388) (-530.591) (-529.116) -- 0:00:43
270000 -- (-530.075) [-537.430] (-531.826) (-532.857) * (-531.815) (-529.706) [-529.606] (-531.291) -- 0:00:43
Average standard deviation of split frequencies: 0.013546
270500 -- (-530.340) [-532.036] (-531.530) (-529.539) * [-531.691] (-530.443) (-531.170) (-529.535) -- 0:00:43
271000 -- (-529.654) [-533.651] (-529.992) (-530.534) * [-529.624] (-530.578) (-535.407) (-529.816) -- 0:00:43
271500 -- (-529.832) [-531.242] (-533.006) (-533.454) * (-529.780) [-532.239] (-530.813) (-530.926) -- 0:00:42
272000 -- (-531.255) [-530.489] (-533.170) (-531.340) * (-530.123) [-530.674] (-529.383) (-529.332) -- 0:00:42
272500 -- [-530.413] (-530.979) (-531.993) (-531.632) * [-529.589] (-531.632) (-529.261) (-529.684) -- 0:00:42
273000 -- (-532.730) [-529.058] (-532.466) (-529.850) * (-532.213) (-533.393) [-529.719] (-531.821) -- 0:00:42
273500 -- (-533.443) [-532.709] (-530.621) (-529.821) * [-529.039] (-529.747) (-530.961) (-530.217) -- 0:00:42
274000 -- (-530.889) (-531.424) [-530.820] (-531.216) * (-535.122) [-531.398] (-531.812) (-532.716) -- 0:00:42
274500 -- (-532.164) (-532.263) [-530.710] (-529.858) * (-530.975) (-529.227) (-529.672) [-529.454] -- 0:00:42
275000 -- (-532.674) [-528.591] (-529.340) (-530.620) * (-532.523) (-530.510) [-529.862] (-529.625) -- 0:00:42
Average standard deviation of split frequencies: 0.013189
275500 -- (-535.615) (-530.353) (-532.452) [-530.351] * [-532.346] (-532.811) (-530.006) (-532.093) -- 0:00:42
276000 -- (-532.786) (-529.841) (-530.814) [-529.796] * (-531.692) (-536.288) [-532.108] (-532.547) -- 0:00:41
276500 -- (-530.137) [-535.749] (-531.297) (-530.755) * (-529.792) [-530.730] (-530.187) (-531.084) -- 0:00:41
277000 -- (-533.199) (-532.964) [-529.169] (-534.352) * (-530.461) (-532.617) (-533.226) [-531.333] -- 0:00:41
277500 -- (-530.645) (-535.947) [-530.716] (-533.707) * (-533.116) [-530.353] (-531.323) (-534.411) -- 0:00:41
278000 -- (-533.331) (-532.215) (-529.181) [-532.510] * (-530.556) (-531.345) (-530.350) [-535.489] -- 0:00:41
278500 -- (-531.196) (-531.877) (-530.320) [-532.113] * [-530.483] (-528.868) (-530.464) (-538.041) -- 0:00:41
279000 -- (-530.083) (-528.916) [-530.491] (-529.519) * [-528.743] (-532.510) (-530.292) (-550.367) -- 0:00:41
279500 -- (-529.389) (-529.880) (-529.957) [-532.079] * (-533.035) (-529.553) [-533.676] (-531.931) -- 0:00:41
280000 -- (-529.532) (-530.324) (-531.874) [-532.305] * [-533.290] (-530.212) (-532.981) (-530.280) -- 0:00:41
Average standard deviation of split frequencies: 0.012130
280500 -- (-532.706) (-531.529) (-531.030) [-532.467] * (-529.140) (-529.747) [-532.256] (-529.239) -- 0:00:43
281000 -- [-529.480] (-531.838) (-529.870) (-535.853) * (-534.042) (-528.720) (-529.317) [-529.704] -- 0:00:43
281500 -- (-533.560) [-533.760] (-530.812) (-531.990) * (-537.204) (-531.314) (-530.567) [-529.869] -- 0:00:43
282000 -- (-530.252) (-531.286) [-530.390] (-529.525) * (-534.639) (-531.980) (-530.613) [-529.640] -- 0:00:43
282500 -- (-530.505) (-531.184) [-529.360] (-530.491) * [-529.506] (-528.858) (-534.018) (-531.877) -- 0:00:43
283000 -- (-529.395) [-529.049] (-531.387) (-531.242) * [-532.855] (-532.881) (-532.502) (-531.560) -- 0:00:43
283500 -- (-532.004) (-532.346) (-532.266) [-532.561] * [-530.359] (-530.027) (-532.415) (-529.066) -- 0:00:42
284000 -- (-532.939) [-532.489] (-530.904) (-532.911) * (-533.745) (-530.740) [-532.137] (-529.029) -- 0:00:42
284500 -- (-531.569) [-531.047] (-532.309) (-532.384) * (-531.547) (-530.530) (-531.546) [-529.354] -- 0:00:42
285000 -- [-531.321] (-532.489) (-530.078) (-533.054) * [-531.273] (-530.087) (-529.532) (-530.597) -- 0:00:42
Average standard deviation of split frequencies: 0.011538
285500 -- (-531.018) (-529.036) [-530.760] (-531.686) * (-533.305) (-530.053) (-533.739) [-535.887] -- 0:00:42
286000 -- (-532.136) [-529.460] (-529.698) (-531.389) * (-533.971) (-529.519) (-534.514) [-530.494] -- 0:00:42
286500 -- [-530.081] (-532.381) (-529.507) (-530.580) * (-532.191) [-530.055] (-530.824) (-530.448) -- 0:00:42
287000 -- [-532.206] (-530.992) (-529.718) (-532.437) * [-529.774] (-530.050) (-531.857) (-532.934) -- 0:00:42
287500 -- (-531.705) [-532.306] (-531.943) (-532.741) * [-530.822] (-529.565) (-529.451) (-530.096) -- 0:00:42
288000 -- [-530.703] (-532.924) (-532.824) (-532.099) * [-529.133] (-529.472) (-529.993) (-533.347) -- 0:00:42
288500 -- (-530.224) (-530.860) [-529.377] (-530.584) * (-529.780) [-529.067] (-530.096) (-530.935) -- 0:00:41
289000 -- (-531.904) (-534.872) (-528.728) [-530.610] * (-531.021) (-530.456) (-531.176) [-531.357] -- 0:00:41
289500 -- [-529.928] (-533.418) (-529.465) (-535.564) * [-529.819] (-530.974) (-531.231) (-533.090) -- 0:00:41
290000 -- (-528.860) (-532.092) [-532.327] (-531.237) * (-534.599) [-532.899] (-531.116) (-531.447) -- 0:00:41
Average standard deviation of split frequencies: 0.011657
290500 -- (-533.077) (-532.804) (-532.274) [-530.026] * (-529.813) [-532.202] (-530.348) (-530.410) -- 0:00:41
291000 -- [-529.314] (-529.198) (-534.074) (-532.172) * (-532.140) (-528.896) (-531.001) [-529.629] -- 0:00:41
291500 -- (-531.332) (-529.227) [-531.072] (-531.035) * (-531.443) (-531.422) [-530.657] (-529.693) -- 0:00:41
292000 -- (-528.885) (-529.128) (-530.157) [-530.204] * (-529.591) [-529.667] (-529.976) (-529.998) -- 0:00:41
292500 -- [-530.956] (-531.164) (-533.808) (-530.954) * [-531.920] (-531.032) (-530.322) (-530.292) -- 0:00:41
293000 -- (-537.592) [-530.980] (-533.250) (-531.576) * (-531.263) (-529.508) (-534.895) [-533.263] -- 0:00:41
293500 -- (-532.592) (-532.558) [-530.252] (-530.077) * (-529.404) (-535.645) [-528.748] (-531.328) -- 0:00:40
294000 -- (-530.665) [-528.993] (-529.971) (-531.404) * [-530.964] (-540.269) (-529.902) (-534.918) -- 0:00:40
294500 -- [-531.542] (-529.425) (-529.908) (-529.248) * [-529.945] (-533.411) (-533.635) (-530.447) -- 0:00:40
295000 -- (-529.744) [-530.352] (-531.668) (-529.411) * (-535.611) (-533.093) (-532.495) [-531.288] -- 0:00:40
Average standard deviation of split frequencies: 0.011447
295500 -- (-530.217) [-530.712] (-529.516) (-533.474) * (-528.786) (-532.465) (-531.269) [-534.439] -- 0:00:40
296000 -- (-530.190) (-537.153) [-529.118] (-529.621) * (-529.274) [-531.582] (-532.681) (-530.142) -- 0:00:40
296500 -- [-529.835] (-531.460) (-530.572) (-528.752) * (-530.132) (-534.025) (-534.173) [-531.652] -- 0:00:40
297000 -- [-534.740] (-528.921) (-533.340) (-530.493) * [-529.572] (-534.377) (-530.288) (-533.137) -- 0:00:40
297500 -- (-529.241) (-529.118) (-531.885) [-529.762] * (-529.091) (-532.311) (-534.276) [-531.111] -- 0:00:42
298000 -- (-529.525) (-532.024) (-529.889) [-531.794] * (-535.439) (-531.625) (-532.952) [-532.094] -- 0:00:42
298500 -- (-531.649) [-530.557] (-528.971) (-530.453) * (-535.705) (-532.858) (-529.846) [-531.253] -- 0:00:42
299000 -- [-530.831] (-534.342) (-529.772) (-532.737) * [-531.306] (-530.908) (-530.718) (-531.609) -- 0:00:42
299500 -- [-530.247] (-533.759) (-531.780) (-535.719) * [-531.964] (-532.852) (-530.704) (-534.390) -- 0:00:42
300000 -- (-532.742) (-532.634) [-530.279] (-533.813) * [-530.089] (-530.685) (-531.667) (-535.275) -- 0:00:42
Average standard deviation of split frequencies: 0.011811
300500 -- [-532.336] (-530.999) (-529.972) (-533.003) * [-529.877] (-533.187) (-530.503) (-534.642) -- 0:00:41
301000 -- (-532.432) (-529.767) [-529.107] (-532.243) * (-531.005) (-532.731) [-530.651] (-530.608) -- 0:00:41
301500 -- (-532.930) (-529.918) [-530.491] (-529.692) * [-530.026] (-531.207) (-535.533) (-530.832) -- 0:00:41
302000 -- (-529.241) (-529.175) (-533.858) [-533.923] * (-530.962) (-530.067) [-529.690] (-529.944) -- 0:00:41
302500 -- (-534.444) (-530.929) [-530.043] (-529.328) * (-530.031) (-530.252) (-530.579) [-530.304] -- 0:00:41
303000 -- (-531.195) (-529.339) [-530.034] (-530.908) * (-529.628) (-531.880) (-533.515) [-530.467] -- 0:00:41
303500 -- [-532.493] (-531.177) (-532.357) (-532.545) * (-530.056) (-530.991) (-531.098) [-531.546] -- 0:00:41
304000 -- (-532.763) (-531.630) (-530.001) [-531.192] * (-529.796) [-529.594] (-534.531) (-529.327) -- 0:00:41
304500 -- (-533.656) (-531.638) [-530.111] (-532.541) * (-531.646) (-530.156) (-529.997) [-530.842] -- 0:00:41
305000 -- [-531.208] (-532.087) (-533.544) (-530.336) * [-530.381] (-532.906) (-529.618) (-530.136) -- 0:00:41
Average standard deviation of split frequencies: 0.012143
305500 -- (-529.864) [-530.657] (-534.650) (-530.393) * (-533.873) (-534.482) (-529.546) [-530.750] -- 0:00:40
306000 -- (-530.756) (-531.225) (-534.064) [-531.789] * (-533.484) [-530.123] (-531.304) (-529.568) -- 0:00:40
306500 -- (-534.114) (-531.993) (-533.774) [-532.146] * (-530.787) [-529.300] (-535.640) (-532.857) -- 0:00:40
307000 -- (-533.207) [-530.959] (-534.106) (-530.805) * (-531.259) (-529.650) [-533.223] (-534.622) -- 0:00:40
307500 -- [-530.731] (-530.830) (-530.952) (-531.471) * [-529.358] (-529.997) (-530.227) (-532.045) -- 0:00:40
308000 -- (-529.893) [-531.641] (-531.210) (-530.475) * [-532.507] (-533.062) (-531.323) (-530.340) -- 0:00:40
308500 -- (-529.620) (-529.531) (-532.969) [-531.471] * (-532.447) [-529.265] (-532.570) (-533.657) -- 0:00:40
309000 -- [-532.087] (-533.951) (-531.381) (-531.186) * (-530.315) [-530.551] (-531.992) (-530.632) -- 0:00:40
309500 -- [-529.716] (-532.758) (-534.158) (-531.788) * [-530.887] (-530.484) (-533.637) (-531.443) -- 0:00:40
310000 -- [-530.845] (-530.675) (-529.758) (-532.470) * (-531.161) (-532.733) (-530.335) [-530.988] -- 0:00:40
Average standard deviation of split frequencies: 0.013372
310500 -- (-529.182) (-531.134) [-530.967] (-530.011) * [-531.324] (-530.173) (-529.456) (-531.279) -- 0:00:39
311000 -- [-529.867] (-530.266) (-531.582) (-529.549) * (-531.204) [-530.762] (-529.697) (-531.438) -- 0:00:39
311500 -- (-531.500) (-530.841) (-531.928) [-533.584] * (-532.811) [-531.658] (-532.785) (-529.631) -- 0:00:39
312000 -- [-531.951] (-530.655) (-542.246) (-531.371) * (-533.252) [-534.936] (-530.676) (-534.097) -- 0:00:39
312500 -- [-529.989] (-530.757) (-531.082) (-530.146) * (-532.152) [-531.009] (-529.942) (-532.001) -- 0:00:39
313000 -- (-530.157) (-531.454) [-529.697] (-530.314) * (-529.809) [-530.341] (-529.821) (-532.490) -- 0:00:41
313500 -- (-531.311) (-530.069) [-532.558] (-530.283) * (-533.477) (-530.269) (-531.564) [-532.691] -- 0:00:41
314000 -- [-532.056] (-532.018) (-530.904) (-529.007) * (-533.437) (-531.096) (-532.509) [-531.169] -- 0:00:41
314500 -- (-530.589) (-530.192) [-531.276] (-530.034) * (-531.121) (-531.529) [-530.181] (-529.028) -- 0:00:41
315000 -- (-530.394) (-534.095) (-529.365) [-529.704] * (-530.518) [-536.855] (-528.970) (-532.624) -- 0:00:41
Average standard deviation of split frequencies: 0.013625
315500 -- [-532.769] (-532.580) (-531.111) (-530.810) * (-530.416) (-533.416) (-529.525) [-530.741] -- 0:00:41
316000 -- (-535.352) (-531.360) [-530.263] (-533.407) * (-531.423) [-532.327] (-530.995) (-532.188) -- 0:00:41
316500 -- [-530.254] (-531.386) (-531.717) (-530.384) * (-531.850) [-529.963] (-533.778) (-531.259) -- 0:00:41
317000 -- [-532.382] (-531.932) (-531.526) (-532.231) * (-532.016) (-532.615) (-528.783) [-534.027] -- 0:00:40
317500 -- [-529.839] (-529.767) (-530.532) (-529.322) * (-529.772) (-529.012) [-529.730] (-532.022) -- 0:00:40
318000 -- (-529.872) [-532.362] (-532.383) (-528.787) * (-529.437) [-530.078] (-532.214) (-529.535) -- 0:00:40
318500 -- (-529.152) [-532.631] (-529.666) (-530.667) * (-529.198) (-534.398) (-530.522) [-530.681] -- 0:00:40
319000 -- [-530.643] (-530.922) (-530.726) (-532.341) * (-529.611) (-533.862) (-530.789) [-531.536] -- 0:00:40
319500 -- [-531.042] (-530.806) (-531.823) (-529.700) * (-529.849) (-530.017) (-530.079) [-530.220] -- 0:00:40
320000 -- [-531.325] (-531.074) (-528.895) (-531.675) * [-531.781] (-532.847) (-532.018) (-532.592) -- 0:00:40
Average standard deviation of split frequencies: 0.014113
320500 -- (-531.548) (-528.902) [-530.525] (-529.908) * (-531.513) (-530.593) (-531.102) [-531.746] -- 0:00:40
321000 -- (-529.828) (-529.386) [-530.078] (-534.447) * [-530.017] (-532.171) (-529.879) (-531.050) -- 0:00:40
321500 -- (-530.044) (-528.794) [-529.171] (-530.671) * (-532.266) (-531.843) [-531.469] (-529.323) -- 0:00:40
322000 -- (-530.831) [-531.405] (-530.872) (-533.586) * (-528.751) [-529.456] (-531.183) (-530.811) -- 0:00:40
322500 -- (-532.217) (-530.780) [-530.912] (-529.967) * [-535.928] (-532.558) (-530.399) (-532.142) -- 0:00:39
323000 -- (-536.395) (-529.140) (-529.797) [-530.064] * (-534.866) (-532.437) (-530.737) [-530.282] -- 0:00:39
323500 -- [-536.497] (-531.489) (-529.208) (-536.853) * (-531.964) (-536.692) (-530.544) [-531.223] -- 0:00:39
324000 -- (-529.256) (-530.589) (-531.498) [-530.898] * (-535.078) (-530.559) [-531.399] (-531.945) -- 0:00:39
324500 -- (-530.256) (-530.561) [-532.518] (-528.847) * (-529.763) (-529.490) (-529.835) [-529.276] -- 0:00:39
325000 -- (-532.251) [-532.145] (-531.214) (-530.872) * (-532.604) (-530.109) (-530.728) [-531.201] -- 0:00:39
Average standard deviation of split frequencies: 0.013014
325500 -- (-533.157) [-529.022] (-529.388) (-530.609) * (-529.747) (-533.045) [-532.932] (-532.004) -- 0:00:39
326000 -- (-529.952) [-531.330] (-530.007) (-530.224) * (-529.544) [-530.437] (-532.746) (-530.004) -- 0:00:39
326500 -- [-530.828] (-532.013) (-533.950) (-532.984) * (-533.106) (-535.535) (-532.086) [-531.422] -- 0:00:39
327000 -- (-532.348) (-530.823) (-533.945) [-530.631] * (-530.822) [-529.629] (-529.783) (-530.693) -- 0:00:39
327500 -- (-532.994) [-529.798] (-530.538) (-529.486) * (-530.823) (-533.241) (-530.428) [-530.089] -- 0:00:39
328000 -- [-529.655] (-529.618) (-530.814) (-530.061) * [-530.624] (-532.051) (-529.595) (-531.094) -- 0:00:38
328500 -- (-530.806) [-529.246] (-530.526) (-530.339) * (-532.139) (-530.542) [-530.056] (-530.557) -- 0:00:38
329000 -- (-532.152) [-529.718] (-532.211) (-529.743) * [-529.246] (-529.971) (-529.435) (-532.085) -- 0:00:40
329500 -- (-530.588) [-531.302] (-534.412) (-531.761) * (-528.989) [-533.907] (-529.641) (-530.237) -- 0:00:40
330000 -- (-531.485) [-534.445] (-531.501) (-529.099) * [-529.754] (-530.465) (-530.115) (-530.406) -- 0:00:40
Average standard deviation of split frequencies: 0.013021
330500 -- (-532.103) (-532.791) [-530.573] (-532.131) * [-530.102] (-528.914) (-529.597) (-530.939) -- 0:00:40
331000 -- (-534.085) (-531.532) (-532.274) [-529.356] * (-534.348) (-533.757) (-531.599) [-535.094] -- 0:00:40
331500 -- (-530.646) (-530.466) (-533.196) [-529.958] * (-529.015) (-530.565) [-530.000] (-533.000) -- 0:00:40
332000 -- [-529.719] (-529.675) (-534.051) (-529.738) * (-529.140) (-530.674) (-530.920) [-532.199] -- 0:00:40
332500 -- (-530.364) (-530.929) (-532.221) [-529.499] * (-530.278) (-532.084) [-532.226] (-529.961) -- 0:00:40
333000 -- (-530.742) (-530.227) [-530.032] (-529.948) * (-532.332) (-532.790) (-536.211) [-529.084] -- 0:00:40
333500 -- (-531.299) (-528.916) [-529.370] (-530.552) * (-530.399) (-531.812) [-534.339] (-529.544) -- 0:00:39
334000 -- (-532.288) (-529.571) (-532.653) [-529.065] * [-532.112] (-531.068) (-529.084) (-531.163) -- 0:00:39
334500 -- (-531.163) [-532.917] (-529.779) (-534.039) * (-531.249) (-536.213) [-530.336] (-533.168) -- 0:00:39
335000 -- (-530.285) (-531.150) [-529.335] (-531.642) * (-530.692) (-530.550) (-530.657) [-529.872] -- 0:00:39
Average standard deviation of split frequencies: 0.012720
335500 -- (-529.696) (-532.308) [-529.368] (-529.614) * (-532.712) (-531.348) (-531.209) [-530.975] -- 0:00:39
336000 -- (-531.004) [-529.537] (-530.771) (-532.435) * (-532.596) (-531.502) [-531.392] (-542.839) -- 0:00:39
336500 -- (-529.330) [-532.633] (-531.855) (-533.248) * (-530.346) [-529.740] (-529.952) (-536.722) -- 0:00:39
337000 -- [-530.147] (-531.323) (-530.020) (-530.629) * (-529.655) (-531.908) [-529.423] (-531.937) -- 0:00:39
337500 -- (-532.507) (-530.649) [-533.000] (-529.505) * (-535.498) (-534.457) [-528.972] (-533.314) -- 0:00:39
338000 -- (-530.937) [-530.802] (-529.908) (-530.851) * (-531.266) (-529.805) [-530.231] (-532.262) -- 0:00:39
338500 -- (-530.284) (-530.356) [-531.080] (-530.812) * (-529.740) (-528.939) (-533.020) [-529.316] -- 0:00:39
339000 -- [-532.264] (-532.011) (-531.569) (-536.383) * (-532.074) (-529.281) [-529.127] (-532.281) -- 0:00:38
339500 -- (-534.347) [-528.936] (-534.027) (-530.466) * (-529.377) [-529.900] (-530.043) (-531.827) -- 0:00:38
340000 -- (-532.693) (-533.151) (-532.411) [-531.855] * (-531.688) (-530.467) (-531.180) [-533.392] -- 0:00:38
Average standard deviation of split frequencies: 0.012085
340500 -- (-530.925) (-530.846) (-531.780) [-532.605] * (-530.825) (-529.814) (-528.933) [-530.042] -- 0:00:38
341000 -- (-532.907) [-532.958] (-533.086) (-530.599) * (-530.923) [-530.937] (-532.554) (-529.872) -- 0:00:38
341500 -- (-531.705) (-532.164) [-536.458] (-530.520) * [-530.880] (-531.971) (-531.093) (-531.111) -- 0:00:38
342000 -- [-531.059] (-529.812) (-533.842) (-530.913) * (-532.303) [-529.749] (-529.884) (-530.989) -- 0:00:38
342500 -- (-531.470) [-531.096] (-535.143) (-531.241) * (-532.291) (-529.051) [-530.643] (-530.840) -- 0:00:38
343000 -- (-530.370) (-530.256) [-530.227] (-530.336) * (-534.866) [-529.105] (-531.589) (-529.935) -- 0:00:38
343500 -- [-532.581] (-529.503) (-532.776) (-534.462) * (-532.563) (-533.156) (-529.972) [-531.113] -- 0:00:38
344000 -- (-531.733) [-530.042] (-531.165) (-532.026) * (-532.577) (-530.794) (-531.076) [-531.233] -- 0:00:38
344500 -- (-531.226) (-530.652) [-533.075] (-530.205) * [-529.978] (-531.178) (-530.208) (-529.156) -- 0:00:38
345000 -- [-529.248] (-531.031) (-528.856) (-530.637) * [-531.785] (-530.142) (-530.162) (-530.647) -- 0:00:37
Average standard deviation of split frequencies: 0.011899
345500 -- (-531.095) (-535.271) (-529.667) [-529.938] * (-531.250) [-529.648] (-532.710) (-529.855) -- 0:00:39
346000 -- [-529.772] (-535.393) (-530.997) (-531.038) * (-530.982) [-531.133] (-534.990) (-529.286) -- 0:00:39
346500 -- (-531.224) (-531.478) (-531.260) [-532.072] * (-530.996) (-529.923) (-529.480) [-529.992] -- 0:00:39
347000 -- (-538.042) (-529.464) (-529.600) [-530.144] * [-530.273] (-529.415) (-530.475) (-529.618) -- 0:00:39
347500 -- [-530.974] (-531.855) (-535.468) (-530.359) * (-528.936) (-530.632) [-530.649] (-530.176) -- 0:00:39
348000 -- (-532.362) [-533.448] (-531.822) (-530.316) * [-529.609] (-529.848) (-531.891) (-529.798) -- 0:00:39
348500 -- [-531.086] (-531.235) (-533.371) (-529.518) * (-531.134) (-530.227) (-530.040) [-530.904] -- 0:00:39
349000 -- (-532.027) (-536.730) (-533.946) [-532.982] * (-531.365) (-531.636) (-533.186) [-533.066] -- 0:00:39
349500 -- (-530.709) (-529.142) [-533.145] (-531.499) * (-535.019) (-538.005) [-529.276] (-533.512) -- 0:00:39
350000 -- (-532.155) (-529.995) (-534.320) [-534.565] * (-535.505) [-532.478] (-532.166) (-532.988) -- 0:00:39
Average standard deviation of split frequencies: 0.011203
350500 -- [-530.498] (-531.944) (-531.692) (-537.566) * (-529.365) [-530.708] (-533.540) (-536.598) -- 0:00:38
351000 -- [-530.660] (-534.042) (-534.761) (-530.872) * (-530.810) (-532.761) (-532.180) [-533.762] -- 0:00:38
351500 -- [-530.951] (-532.746) (-534.295) (-530.320) * (-530.674) (-534.732) (-535.814) [-533.003] -- 0:00:38
352000 -- (-532.217) (-530.649) (-529.980) [-532.024] * [-530.796] (-530.738) (-530.208) (-535.031) -- 0:00:38
352500 -- (-532.647) (-532.907) (-529.359) [-531.609] * (-530.507) [-529.456] (-529.352) (-536.687) -- 0:00:38
353000 -- (-535.875) (-532.197) (-529.977) [-529.576] * [-531.945] (-530.758) (-530.002) (-529.710) -- 0:00:38
353500 -- (-532.245) (-531.934) [-534.016] (-531.632) * (-530.802) (-532.130) (-532.087) [-531.294] -- 0:00:38
354000 -- [-528.848] (-530.974) (-530.448) (-533.541) * (-529.600) (-532.913) (-530.270) [-529.254] -- 0:00:38
354500 -- (-531.346) [-531.114] (-531.495) (-530.208) * (-531.409) (-534.811) (-532.623) [-530.403] -- 0:00:38
355000 -- (-529.747) [-530.761] (-529.327) (-530.723) * (-529.343) (-530.443) (-533.109) [-531.185] -- 0:00:38
Average standard deviation of split frequencies: 0.010329
355500 -- (-530.393) (-533.076) (-530.252) [-529.495] * (-530.378) [-530.353] (-536.389) (-530.503) -- 0:00:38
356000 -- (-533.950) (-531.253) (-530.176) [-531.123] * (-529.593) (-530.479) [-536.071] (-531.513) -- 0:00:37
356500 -- [-536.771] (-530.368) (-532.280) (-533.415) * [-533.519] (-533.120) (-530.433) (-531.752) -- 0:00:37
357000 -- (-528.951) (-530.114) (-530.688) [-531.264] * [-529.544] (-529.918) (-531.105) (-529.402) -- 0:00:37
357500 -- (-531.346) (-531.402) (-532.784) [-529.122] * (-531.657) (-530.449) [-537.077] (-530.405) -- 0:00:37
358000 -- (-533.609) (-530.083) (-530.253) [-532.292] * (-529.693) [-529.629] (-530.093) (-535.099) -- 0:00:37
358500 -- (-530.699) (-531.414) (-529.602) [-532.772] * (-533.570) (-532.502) (-529.772) [-531.205] -- 0:00:37
359000 -- (-532.524) (-534.993) (-529.660) [-529.688] * (-534.419) (-532.302) [-529.064] (-529.984) -- 0:00:37
359500 -- (-534.407) [-529.934] (-536.374) (-531.720) * [-529.023] (-530.957) (-530.035) (-530.515) -- 0:00:37
360000 -- (-530.047) (-533.370) (-531.727) [-531.140] * [-531.969] (-529.680) (-528.828) (-532.274) -- 0:00:37
Average standard deviation of split frequencies: 0.010631
360500 -- (-531.811) (-532.019) (-532.483) [-529.871] * [-531.973] (-530.233) (-529.627) (-534.916) -- 0:00:37
361000 -- [-530.563] (-532.091) (-534.375) (-530.809) * [-534.345] (-531.171) (-532.419) (-534.596) -- 0:00:37
361500 -- (-531.934) (-531.013) (-529.360) [-529.999] * (-532.528) (-533.357) (-529.043) [-530.692] -- 0:00:37
362000 -- (-529.951) (-534.211) [-529.332] (-530.813) * (-534.508) [-532.981] (-534.191) (-532.239) -- 0:00:38
362500 -- (-529.681) [-530.960] (-530.580) (-530.181) * (-530.616) (-533.152) (-531.964) [-530.931] -- 0:00:38
363000 -- (-531.143) (-533.221) [-534.465] (-532.030) * [-529.884] (-533.153) (-531.850) (-530.592) -- 0:00:38
363500 -- [-530.809] (-535.230) (-531.200) (-529.019) * (-532.201) (-530.888) [-530.614] (-531.634) -- 0:00:38
364000 -- (-533.437) (-534.452) (-533.960) [-530.969] * [-529.743] (-533.420) (-530.363) (-531.021) -- 0:00:38
364500 -- (-529.531) (-531.160) (-531.810) [-531.334] * [-533.767] (-532.416) (-531.425) (-530.504) -- 0:00:38
365000 -- (-536.017) (-531.309) [-530.852] (-531.085) * (-530.608) (-528.997) (-529.109) [-530.109] -- 0:00:38
Average standard deviation of split frequencies: 0.011077
365500 -- [-529.950] (-529.253) (-534.412) (-528.741) * (-531.152) (-531.126) [-529.511] (-530.986) -- 0:00:38
366000 -- (-529.406) (-531.721) [-532.236] (-529.478) * (-530.925) [-531.011] (-532.234) (-535.798) -- 0:00:38
366500 -- (-529.821) (-530.389) (-536.353) [-531.138] * (-531.914) (-530.121) (-529.660) [-534.192] -- 0:00:38
367000 -- (-530.856) (-530.649) (-530.040) [-529.516] * [-531.751] (-529.125) (-529.977) (-533.327) -- 0:00:37
367500 -- (-531.623) (-530.953) [-529.937] (-530.990) * (-533.424) [-532.021] (-531.535) (-532.238) -- 0:00:37
368000 -- (-535.163) [-530.766] (-530.307) (-533.346) * [-529.444] (-533.271) (-530.729) (-530.260) -- 0:00:37
368500 -- (-533.648) [-531.718] (-531.980) (-529.372) * [-529.911] (-530.985) (-534.615) (-530.150) -- 0:00:37
369000 -- (-530.174) [-530.309] (-530.300) (-531.534) * (-533.208) [-531.423] (-537.122) (-531.357) -- 0:00:37
369500 -- [-529.725] (-532.620) (-529.388) (-529.687) * (-530.201) (-531.957) [-530.687] (-531.143) -- 0:00:37
370000 -- (-529.528) [-529.613] (-529.642) (-530.735) * (-532.646) [-529.729] (-530.314) (-530.072) -- 0:00:37
Average standard deviation of split frequencies: 0.010259
370500 -- [-530.520] (-530.195) (-531.249) (-530.926) * (-530.196) [-530.884] (-534.857) (-530.249) -- 0:00:37
371000 -- [-529.376] (-536.479) (-531.743) (-531.389) * (-534.498) [-532.373] (-530.637) (-530.151) -- 0:00:37
371500 -- (-529.493) (-530.218) (-532.135) [-529.647] * (-534.538) (-532.877) [-533.069] (-532.695) -- 0:00:37
372000 -- (-529.522) [-530.789] (-530.545) (-531.317) * (-531.458) (-530.114) [-531.768] (-529.933) -- 0:00:37
372500 -- (-534.125) [-529.346] (-535.501) (-536.773) * (-529.602) (-529.528) (-531.261) [-532.263] -- 0:00:37
373000 -- [-531.287] (-533.502) (-530.991) (-531.746) * [-530.136] (-530.945) (-535.322) (-532.240) -- 0:00:36
373500 -- [-533.706] (-534.069) (-536.627) (-531.966) * (-529.466) [-531.942] (-534.298) (-530.825) -- 0:00:36
374000 -- (-530.637) [-531.352] (-531.490) (-529.666) * (-532.848) (-530.782) (-529.655) [-531.667] -- 0:00:36
374500 -- [-529.854] (-531.491) (-532.471) (-532.739) * (-531.344) [-531.239] (-530.321) (-538.593) -- 0:00:36
375000 -- (-533.355) [-529.292] (-529.628) (-531.016) * (-531.577) [-531.125] (-529.939) (-531.969) -- 0:00:36
Average standard deviation of split frequencies: 0.009863
375500 -- [-529.780] (-535.553) (-529.729) (-529.814) * (-529.537) [-529.495] (-531.211) (-530.930) -- 0:00:36
376000 -- (-534.537) [-529.947] (-533.357) (-532.321) * [-529.585] (-532.865) (-531.878) (-529.255) -- 0:00:36
376500 -- [-529.968] (-529.866) (-531.750) (-534.769) * (-530.995) (-530.447) [-531.108] (-531.920) -- 0:00:36
377000 -- (-528.928) (-532.002) (-530.456) [-530.567] * (-529.471) (-535.081) (-529.977) [-530.164] -- 0:00:36
377500 -- (-531.657) (-532.026) (-531.503) [-531.397] * [-530.795] (-534.480) (-529.999) (-533.132) -- 0:00:36
378000 -- (-535.266) [-534.941] (-531.249) (-530.145) * (-534.470) [-530.102] (-529.742) (-534.974) -- 0:00:36
378500 -- (-537.485) (-540.849) (-535.502) [-530.012] * (-531.955) (-533.559) (-529.377) [-531.988] -- 0:00:36
379000 -- (-531.474) (-533.359) (-531.587) [-528.710] * [-530.672] (-531.431) (-531.110) (-530.520) -- 0:00:37
379500 -- (-530.192) [-529.155] (-531.644) (-528.670) * [-530.255] (-530.263) (-530.655) (-530.539) -- 0:00:37
380000 -- (-530.736) [-530.330] (-533.902) (-532.134) * (-531.025) [-530.419] (-531.108) (-531.153) -- 0:00:37
Average standard deviation of split frequencies: 0.009164
380500 -- (-535.650) (-529.394) [-531.507] (-529.585) * [-530.613] (-531.416) (-530.962) (-533.122) -- 0:00:37
381000 -- (-533.440) (-530.647) [-530.116] (-532.272) * (-530.147) (-529.042) (-530.202) [-530.751] -- 0:00:37
381500 -- (-530.276) (-533.343) [-530.410] (-530.715) * (-530.157) (-529.226) (-531.746) [-531.011] -- 0:00:37
382000 -- (-531.658) (-529.661) (-535.960) [-528.684] * (-531.256) (-531.593) [-529.308] (-530.784) -- 0:00:37
382500 -- (-531.659) (-531.652) (-530.610) [-530.261] * (-531.224) (-531.914) (-530.431) [-531.329] -- 0:00:37
383000 -- (-530.960) (-532.466) (-529.970) [-533.890] * (-530.262) (-529.393) (-530.224) [-530.765] -- 0:00:37
383500 -- [-530.725] (-531.831) (-533.943) (-531.228) * (-529.401) (-530.444) [-532.736] (-531.744) -- 0:00:36
384000 -- (-530.217) (-532.901) (-534.675) [-531.251] * (-534.640) [-532.456] (-532.735) (-529.306) -- 0:00:36
384500 -- (-532.150) (-528.772) [-531.688] (-529.673) * (-533.846) (-533.890) [-530.733] (-530.110) -- 0:00:36
385000 -- (-529.901) (-530.802) (-532.030) [-531.001] * (-533.413) (-532.400) (-529.100) [-529.821] -- 0:00:36
Average standard deviation of split frequencies: 0.008223
385500 -- (-530.502) (-534.403) (-528.702) [-530.190] * (-533.413) (-529.840) [-532.299] (-530.396) -- 0:00:36
386000 -- (-530.890) [-532.290] (-529.428) (-532.814) * [-532.100] (-533.287) (-529.612) (-529.723) -- 0:00:36
386500 -- [-531.312] (-533.605) (-530.387) (-531.724) * (-531.902) (-530.505) [-531.871] (-532.217) -- 0:00:36
387000 -- (-533.372) (-532.394) (-530.333) [-531.004] * [-531.842] (-534.493) (-530.375) (-529.915) -- 0:00:36
387500 -- (-531.511) [-532.302] (-531.183) (-532.257) * (-530.884) (-533.874) [-531.292] (-530.498) -- 0:00:36
388000 -- (-537.024) (-532.452) (-529.695) [-529.859] * (-530.961) [-531.040] (-532.797) (-531.205) -- 0:00:36
388500 -- (-531.127) [-529.498] (-529.547) (-535.190) * (-530.997) (-528.888) [-532.309] (-530.224) -- 0:00:36
389000 -- (-529.785) (-528.540) [-530.184] (-538.620) * (-529.745) [-529.699] (-531.770) (-530.890) -- 0:00:36
389500 -- (-530.322) (-530.676) [-530.567] (-535.853) * (-530.341) (-529.673) (-533.967) [-532.196] -- 0:00:36
390000 -- (-532.739) (-529.153) (-529.818) [-535.066] * (-530.465) [-528.625] (-530.083) (-535.470) -- 0:00:35
Average standard deviation of split frequencies: 0.008447
390500 -- (-530.292) (-529.375) [-530.474] (-531.031) * [-531.200] (-532.802) (-531.639) (-531.941) -- 0:00:35
391000 -- (-529.948) (-530.152) [-531.445] (-531.369) * (-530.038) (-531.430) [-530.752] (-535.472) -- 0:00:35
391500 -- (-531.214) [-531.907] (-530.495) (-537.186) * (-529.650) (-531.363) (-536.580) [-533.975] -- 0:00:35
392000 -- (-532.137) [-533.591] (-530.053) (-531.705) * (-530.660) (-531.271) [-530.612] (-536.737) -- 0:00:35
392500 -- (-530.911) (-528.933) (-536.877) [-529.019] * (-530.630) [-531.575] (-529.699) (-537.800) -- 0:00:35
393000 -- [-533.029] (-530.192) (-531.270) (-529.220) * (-532.201) (-532.960) [-531.963] (-530.904) -- 0:00:35
393500 -- (-532.223) (-530.110) (-532.205) [-530.263] * (-529.307) [-530.833] (-529.487) (-532.227) -- 0:00:35
394000 -- (-530.447) (-530.359) [-529.502] (-531.886) * (-530.423) (-529.328) [-529.380] (-531.081) -- 0:00:35
394500 -- [-530.294] (-531.291) (-531.052) (-531.352) * (-535.625) [-531.156] (-529.816) (-530.874) -- 0:00:35
395000 -- (-529.586) (-529.348) (-530.126) [-533.092] * (-537.019) (-530.863) [-529.010] (-530.883) -- 0:00:35
Average standard deviation of split frequencies: 0.008650
395500 -- (-529.101) [-529.353] (-532.945) (-530.125) * (-530.583) (-529.567) (-529.702) [-535.952] -- 0:00:36
396000 -- [-529.460] (-531.935) (-530.623) (-529.300) * (-530.737) (-530.781) (-534.775) [-531.641] -- 0:00:36
396500 -- [-530.442] (-533.848) (-531.824) (-531.861) * (-531.513) (-532.230) [-533.657] (-533.639) -- 0:00:36
397000 -- (-535.089) (-530.117) [-530.771] (-530.664) * (-533.431) (-532.328) [-529.153] (-532.860) -- 0:00:36
397500 -- (-532.851) (-537.765) [-528.893] (-530.549) * (-531.831) (-530.741) [-530.013] (-534.499) -- 0:00:36
398000 -- (-530.417) (-531.074) (-529.384) [-530.928] * [-530.557] (-529.239) (-538.815) (-532.026) -- 0:00:36
398500 -- (-534.031) [-529.252] (-529.353) (-536.498) * (-531.401) (-532.482) [-534.141] (-528.997) -- 0:00:36
399000 -- (-529.642) (-531.205) [-530.114] (-537.673) * [-533.095] (-530.309) (-533.676) (-528.670) -- 0:00:36
399500 -- (-531.669) [-529.269] (-533.505) (-531.424) * (-535.257) [-531.129] (-531.800) (-530.933) -- 0:00:36
400000 -- (-530.313) [-530.063] (-532.141) (-528.804) * (-532.774) (-529.790) [-530.105] (-531.861) -- 0:00:36
Average standard deviation of split frequencies: 0.008863
400500 -- (-531.123) (-532.659) (-529.684) [-531.111] * [-534.097] (-534.096) (-536.603) (-531.763) -- 0:00:35
401000 -- [-529.777] (-529.132) (-529.846) (-533.404) * [-532.189] (-530.249) (-529.676) (-531.254) -- 0:00:35
401500 -- (-529.967) (-529.263) (-530.312) [-532.350] * (-532.106) (-530.200) (-529.647) [-531.332] -- 0:00:35
402000 -- (-529.716) [-528.604] (-533.737) (-532.921) * (-530.244) (-530.718) [-533.534] (-535.134) -- 0:00:35
402500 -- (-534.300) [-531.497] (-531.051) (-532.912) * [-529.295] (-533.213) (-529.675) (-538.814) -- 0:00:35
403000 -- (-529.763) (-533.178) (-534.735) [-532.106] * (-529.973) [-530.159] (-529.760) (-532.947) -- 0:00:35
403500 -- (-530.421) [-529.212] (-529.879) (-531.633) * (-531.429) (-533.056) [-534.352] (-532.682) -- 0:00:35
404000 -- (-529.192) [-531.337] (-532.059) (-528.782) * [-531.545] (-530.792) (-533.787) (-530.666) -- 0:00:35
404500 -- [-530.865] (-530.891) (-531.477) (-530.180) * (-532.984) (-529.648) (-531.009) [-530.594] -- 0:00:35
405000 -- (-533.403) [-532.613] (-530.603) (-530.705) * (-532.916) (-529.111) (-529.522) [-530.798] -- 0:00:35
Average standard deviation of split frequencies: 0.009366
405500 -- (-533.056) (-533.127) (-529.729) [-529.593] * [-530.594] (-535.533) (-532.857) (-532.738) -- 0:00:35
406000 -- (-534.736) (-531.381) (-530.407) [-530.925] * (-530.472) [-530.549] (-532.003) (-530.648) -- 0:00:35
406500 -- (-532.964) (-531.273) (-531.144) [-531.079] * [-529.205] (-534.166) (-530.728) (-530.358) -- 0:00:35
407000 -- (-533.774) [-531.031] (-530.220) (-531.268) * (-528.657) [-534.748] (-530.469) (-529.950) -- 0:00:34
407500 -- (-531.615) (-529.153) [-530.201] (-530.680) * (-532.771) (-533.259) [-530.497] (-530.751) -- 0:00:34
408000 -- [-533.028] (-529.662) (-531.210) (-529.642) * (-531.977) (-531.030) (-530.933) [-529.338] -- 0:00:34
408500 -- (-530.700) (-535.066) (-531.945) [-529.342] * (-529.166) (-532.358) [-530.011] (-536.223) -- 0:00:34
409000 -- (-531.384) (-530.356) [-532.616] (-529.624) * (-530.026) [-531.941] (-530.212) (-530.901) -- 0:00:34
409500 -- (-532.110) (-533.524) [-532.219] (-532.121) * (-530.744) [-532.842] (-532.803) (-531.967) -- 0:00:34
410000 -- (-535.521) (-532.575) (-536.122) [-532.256] * [-529.357] (-533.942) (-532.263) (-529.740) -- 0:00:34
Average standard deviation of split frequencies: 0.009901
410500 -- [-532.073] (-529.440) (-535.628) (-530.242) * (-532.594) (-531.849) (-538.569) [-531.644] -- 0:00:34
411000 -- (-532.018) (-533.814) [-529.958] (-530.440) * (-532.737) (-530.753) (-529.275) [-529.973] -- 0:00:34
411500 -- (-530.131) (-531.086) (-530.076) [-530.166] * (-532.278) (-532.012) (-530.835) [-528.924] -- 0:00:34
412000 -- (-531.015) [-529.474] (-530.360) (-530.919) * (-531.680) (-534.197) (-531.740) [-529.907] -- 0:00:34
412500 -- (-531.576) [-529.235] (-534.201) (-534.188) * (-530.587) (-530.449) (-531.225) [-529.424] -- 0:00:35
413000 -- [-530.850] (-529.822) (-533.637) (-531.238) * (-530.552) (-535.243) (-531.780) [-531.462] -- 0:00:35
413500 -- (-530.351) (-530.742) (-530.239) [-532.207] * (-538.976) (-535.137) [-531.058] (-531.616) -- 0:00:35
414000 -- (-532.251) [-532.125] (-532.179) (-533.660) * (-531.866) (-530.721) (-531.087) [-529.535] -- 0:00:35
414500 -- (-537.219) [-530.090] (-529.062) (-530.207) * [-533.144] (-533.140) (-531.246) (-532.888) -- 0:00:35
415000 -- (-536.700) (-529.784) (-529.002) [-528.666] * (-529.397) [-529.874] (-531.396) (-528.727) -- 0:00:35
Average standard deviation of split frequencies: 0.009821
415500 -- (-538.158) [-529.240] (-528.816) (-531.975) * [-532.299] (-533.433) (-530.151) (-529.286) -- 0:00:35
416000 -- (-529.947) (-529.700) (-532.361) [-530.881] * (-529.244) (-535.404) (-528.903) [-531.695] -- 0:00:35
416500 -- (-532.785) (-529.635) (-533.949) [-530.098] * (-530.803) (-533.391) [-529.786] (-533.085) -- 0:00:35
417000 -- (-530.755) [-531.501] (-533.125) (-531.084) * (-531.839) (-530.089) [-529.845] (-530.818) -- 0:00:34
417500 -- (-533.376) (-530.372) (-533.444) [-530.630] * (-530.193) (-530.218) [-533.949] (-535.549) -- 0:00:34
418000 -- (-531.060) (-531.799) (-534.323) [-530.057] * (-533.684) [-528.643] (-535.411) (-532.452) -- 0:00:34
418500 -- [-531.565] (-529.779) (-535.616) (-530.887) * (-530.100) (-532.680) (-530.730) [-531.727] -- 0:00:34
419000 -- [-529.286] (-532.635) (-531.663) (-531.477) * (-530.358) [-529.763] (-533.623) (-531.294) -- 0:00:34
419500 -- (-529.129) (-530.400) (-533.074) [-530.793] * (-530.242) [-533.158] (-531.392) (-529.873) -- 0:00:34
420000 -- [-529.448] (-531.473) (-537.035) (-529.868) * (-529.687) [-534.014] (-531.320) (-532.120) -- 0:00:34
Average standard deviation of split frequencies: 0.010011
420500 -- (-531.150) (-530.227) (-530.271) [-530.003] * (-529.684) [-531.415] (-530.575) (-529.924) -- 0:00:34
421000 -- (-531.747) (-529.798) (-530.815) [-531.340] * (-538.518) [-530.300] (-531.599) (-532.992) -- 0:00:34
421500 -- (-533.668) [-534.120] (-530.540) (-530.631) * (-530.773) (-531.067) [-532.346] (-532.136) -- 0:00:34
422000 -- [-531.734] (-530.943) (-531.712) (-531.059) * (-528.964) (-530.802) (-532.919) [-531.701] -- 0:00:34
422500 -- (-531.026) [-533.715] (-531.762) (-530.043) * (-530.352) [-535.990] (-530.206) (-530.752) -- 0:00:34
423000 -- (-534.621) [-532.937] (-531.441) (-534.254) * [-529.866] (-533.537) (-531.310) (-535.024) -- 0:00:34
423500 -- (-529.878) (-530.563) (-530.463) [-529.867] * (-536.783) [-531.437] (-530.306) (-530.373) -- 0:00:34
424000 -- [-530.778] (-528.873) (-534.524) (-532.563) * (-534.083) (-529.677) [-532.102] (-531.832) -- 0:00:33
424500 -- (-531.484) (-531.027) [-530.343] (-532.248) * (-532.200) [-530.567] (-536.192) (-531.147) -- 0:00:33
425000 -- (-530.762) [-529.544] (-529.627) (-531.030) * [-531.473] (-531.545) (-535.787) (-533.039) -- 0:00:33
Average standard deviation of split frequencies: 0.009590
425500 -- (-530.000) (-531.862) [-530.096] (-531.372) * (-529.557) (-534.366) [-535.490] (-530.676) -- 0:00:33
426000 -- (-529.132) (-531.666) [-530.219] (-535.057) * [-530.302] (-529.254) (-532.708) (-529.393) -- 0:00:33
426500 -- (-529.319) [-530.243] (-529.285) (-532.910) * (-531.290) (-531.597) (-534.507) [-529.395] -- 0:00:33
427000 -- (-531.844) (-531.353) (-530.675) [-529.263] * [-530.046] (-530.901) (-530.705) (-529.383) -- 0:00:33
427500 -- [-531.951] (-529.676) (-534.121) (-530.001) * [-533.415] (-532.640) (-530.297) (-529.153) -- 0:00:33
428000 -- [-532.265] (-529.672) (-529.543) (-530.529) * (-529.858) (-531.576) [-531.576] (-529.122) -- 0:00:33
428500 -- (-531.459) (-530.558) (-529.718) [-531.644] * (-530.433) (-530.962) [-532.114] (-530.544) -- 0:00:33
429000 -- (-530.138) [-531.432] (-529.761) (-531.914) * (-529.154) (-532.016) (-530.470) [-529.798] -- 0:00:33
429500 -- (-532.358) (-535.482) (-533.749) [-529.694] * [-529.329] (-532.063) (-531.913) (-529.832) -- 0:00:34
430000 -- (-531.711) (-530.541) [-532.475] (-531.274) * (-530.786) (-531.975) [-530.072] (-529.030) -- 0:00:34
Average standard deviation of split frequencies: 0.009049
430500 -- (-529.324) (-529.461) [-532.680] (-533.077) * (-530.200) [-531.147] (-530.985) (-529.806) -- 0:00:34
431000 -- (-529.573) (-529.805) (-531.930) [-530.440] * (-533.540) [-533.767] (-529.444) (-530.508) -- 0:00:34
431500 -- (-531.208) (-532.263) [-530.437] (-529.963) * (-530.430) (-537.050) (-531.103) [-529.924] -- 0:00:34
432000 -- (-529.410) (-530.825) [-529.486] (-531.130) * [-530.443] (-533.551) (-533.154) (-530.998) -- 0:00:34
432500 -- (-530.772) (-532.703) (-530.024) [-529.349] * [-530.922] (-531.559) (-530.383) (-529.448) -- 0:00:34
433000 -- (-534.667) (-534.402) [-528.569] (-529.266) * (-531.178) [-532.103] (-529.018) (-529.729) -- 0:00:34
433500 -- (-530.980) (-530.409) (-530.471) [-531.765] * (-529.832) (-531.082) (-528.909) [-534.249] -- 0:00:33
434000 -- (-529.531) (-530.061) (-530.583) [-532.182] * (-531.989) [-529.923] (-533.490) (-533.897) -- 0:00:33
434500 -- (-529.080) (-529.510) [-532.479] (-530.992) * (-530.453) (-532.105) (-533.168) [-533.408] -- 0:00:33
435000 -- (-531.758) (-530.192) [-532.440] (-531.571) * [-529.587] (-535.355) (-536.334) (-531.378) -- 0:00:33
Average standard deviation of split frequencies: 0.009443
435500 -- [-531.060] (-530.371) (-532.799) (-529.677) * (-530.650) (-529.263) [-529.573] (-530.340) -- 0:00:33
436000 -- (-532.025) (-529.329) (-535.597) [-532.717] * (-529.237) [-529.582] (-530.051) (-530.396) -- 0:00:33
436500 -- (-529.603) (-529.520) (-529.519) [-536.258] * (-529.797) (-529.488) (-529.998) [-530.737] -- 0:00:33
437000 -- (-529.776) [-529.716] (-531.944) (-533.984) * (-529.806) [-530.640] (-530.909) (-530.125) -- 0:00:33
437500 -- (-529.408) (-529.880) (-532.890) [-532.919] * (-530.567) (-531.959) [-530.048] (-529.839) -- 0:00:33
438000 -- (-530.225) (-532.424) (-530.540) [-531.552] * (-534.151) (-530.843) (-534.105) [-530.365] -- 0:00:33
438500 -- [-529.878] (-532.317) (-532.466) (-529.537) * (-529.099) [-530.264] (-531.003) (-531.543) -- 0:00:33
439000 -- (-533.061) (-531.621) [-532.562] (-532.673) * (-531.737) (-531.049) [-532.058] (-531.385) -- 0:00:33
439500 -- (-534.118) [-531.625] (-531.085) (-537.289) * [-530.191] (-539.446) (-534.190) (-532.840) -- 0:00:33
440000 -- [-530.224] (-533.076) (-531.093) (-532.748) * (-533.076) (-531.843) [-529.604] (-530.463) -- 0:00:33
Average standard deviation of split frequencies: 0.008843
440500 -- [-530.651] (-533.472) (-533.335) (-531.345) * (-530.721) (-533.054) [-530.614] (-530.455) -- 0:00:33
441000 -- [-529.776] (-529.983) (-529.581) (-531.847) * (-530.499) (-531.323) [-529.054] (-532.654) -- 0:00:32
441500 -- [-530.728] (-528.805) (-529.785) (-530.620) * (-530.088) (-531.661) [-531.287] (-530.068) -- 0:00:32
442000 -- (-529.917) [-529.148] (-531.071) (-529.751) * [-531.911] (-529.723) (-530.814) (-529.868) -- 0:00:32
442500 -- (-532.819) (-530.289) [-530.450] (-529.347) * (-535.557) (-532.413) [-529.306] (-530.639) -- 0:00:32
443000 -- (-531.461) (-530.991) (-529.185) [-528.883] * (-529.965) (-533.019) (-533.120) [-531.603] -- 0:00:32
443500 -- [-532.307] (-530.905) (-530.431) (-533.184) * (-529.974) (-530.357) [-533.178] (-530.241) -- 0:00:32
444000 -- (-530.552) [-533.189] (-531.308) (-531.077) * (-529.497) (-530.706) (-529.449) [-531.050] -- 0:00:32
444500 -- (-532.827) (-530.423) [-535.546] (-533.202) * [-529.464] (-532.942) (-530.013) (-532.704) -- 0:00:32
445000 -- (-531.015) (-532.087) (-531.116) [-531.662] * (-529.107) (-529.928) (-534.260) [-528.834] -- 0:00:32
Average standard deviation of split frequencies: 0.008949
445500 -- (-530.009) (-530.580) [-535.411] (-531.636) * (-530.800) (-533.460) [-534.435] (-529.830) -- 0:00:32
446000 -- (-530.325) (-531.080) (-529.064) [-530.276] * [-532.357] (-533.303) (-531.820) (-530.049) -- 0:00:33
446500 -- (-530.859) [-530.523] (-529.250) (-530.305) * (-535.178) (-531.047) (-530.493) [-530.993] -- 0:00:33
447000 -- (-531.163) (-532.574) [-530.684] (-531.074) * (-535.695) (-530.486) [-530.106] (-531.613) -- 0:00:33
447500 -- (-533.210) (-536.745) [-529.866] (-530.704) * [-531.928] (-528.776) (-532.547) (-530.060) -- 0:00:33
448000 -- (-530.993) (-530.777) [-531.928] (-532.195) * (-530.262) (-530.712) (-530.014) [-530.704] -- 0:00:33
448500 -- (-530.679) (-530.762) (-530.029) [-532.166] * (-528.861) [-531.522] (-531.789) (-536.131) -- 0:00:33
449000 -- (-528.897) [-532.590] (-530.817) (-530.870) * (-532.075) (-532.767) [-532.404] (-531.805) -- 0:00:33
449500 -- (-529.442) (-528.840) [-531.924] (-530.318) * (-531.474) (-531.962) (-534.792) [-532.979] -- 0:00:33
450000 -- [-529.710] (-529.719) (-529.949) (-529.993) * (-529.247) [-531.406] (-530.613) (-531.658) -- 0:00:33
Average standard deviation of split frequencies: 0.009414
450500 -- [-532.110] (-529.520) (-529.075) (-529.692) * (-531.068) [-531.343] (-533.151) (-529.348) -- 0:00:32
451000 -- (-529.696) [-530.863] (-534.370) (-532.969) * (-528.643) (-530.733) (-532.389) [-529.905] -- 0:00:32
451500 -- [-529.285] (-533.025) (-533.145) (-534.879) * (-529.804) (-534.242) (-533.537) [-532.566] -- 0:00:32
452000 -- (-531.585) (-531.148) [-532.052] (-532.195) * [-529.626] (-531.940) (-529.917) (-532.865) -- 0:00:32
452500 -- [-530.642] (-530.435) (-532.641) (-529.584) * (-530.451) [-531.713] (-531.084) (-529.963) -- 0:00:32
453000 -- (-530.689) [-530.509] (-532.359) (-531.831) * (-529.935) (-536.346) [-530.370] (-531.902) -- 0:00:32
453500 -- (-529.598) (-529.478) (-531.248) [-530.079] * (-533.342) (-529.358) [-532.223] (-532.714) -- 0:00:32
454000 -- (-529.967) [-529.951] (-531.619) (-532.091) * (-532.971) (-530.228) (-532.808) [-530.126] -- 0:00:32
454500 -- (-529.497) (-532.548) (-533.662) [-530.636] * (-534.729) (-529.127) (-529.062) [-530.435] -- 0:00:32
455000 -- (-531.518) [-530.946] (-528.860) (-532.216) * (-533.310) (-529.263) [-532.905] (-531.260) -- 0:00:32
Average standard deviation of split frequencies: 0.010269
455500 -- (-531.638) [-530.061] (-530.142) (-530.666) * (-531.098) (-529.129) (-532.995) [-529.473] -- 0:00:32
456000 -- (-532.005) [-528.627] (-529.796) (-535.840) * (-535.165) (-533.530) (-534.344) [-529.051] -- 0:00:32
456500 -- (-529.927) [-529.250] (-530.521) (-530.533) * [-531.917] (-533.008) (-532.547) (-530.214) -- 0:00:32
457000 -- [-530.615] (-529.773) (-531.585) (-531.717) * (-533.456) [-529.562] (-531.989) (-530.761) -- 0:00:32
457500 -- (-530.274) [-530.799] (-532.852) (-532.645) * (-534.851) [-531.259] (-530.652) (-529.211) -- 0:00:32
458000 -- (-530.060) (-529.348) (-529.188) [-531.002] * (-533.490) (-533.363) [-530.907] (-529.824) -- 0:00:31
458500 -- [-530.669] (-530.231) (-530.872) (-529.799) * [-532.112] (-537.092) (-531.893) (-529.790) -- 0:00:31
459000 -- (-531.619) (-531.051) (-530.234) [-529.409] * (-529.467) (-529.878) [-529.339] (-529.334) -- 0:00:31
459500 -- [-531.625] (-530.025) (-533.028) (-531.810) * (-530.885) [-531.781] (-533.011) (-534.206) -- 0:00:31
460000 -- [-530.796] (-529.817) (-530.203) (-530.926) * (-530.724) (-531.771) (-530.556) [-530.206] -- 0:00:31
Average standard deviation of split frequencies: 0.010165
460500 -- (-530.755) (-530.454) [-530.315] (-531.244) * (-531.140) [-530.267] (-531.729) (-531.826) -- 0:00:31
461000 -- (-531.349) [-530.122] (-529.819) (-530.680) * (-529.213) [-531.350] (-537.400) (-531.821) -- 0:00:31
461500 -- [-534.564] (-529.923) (-534.650) (-534.047) * (-533.320) (-532.509) (-530.762) [-530.775] -- 0:00:31
462000 -- (-530.327) (-531.429) [-529.439] (-533.875) * [-530.132] (-530.494) (-529.253) (-530.939) -- 0:00:31
462500 -- [-529.931] (-531.638) (-530.341) (-534.229) * (-530.347) (-531.957) [-535.072] (-531.083) -- 0:00:31
463000 -- (-530.050) (-534.096) (-530.668) [-530.392] * (-530.694) [-530.281] (-535.620) (-531.037) -- 0:00:32
463500 -- (-532.201) [-530.461] (-533.122) (-534.927) * (-529.766) (-531.120) (-534.023) [-531.639] -- 0:00:32
464000 -- [-532.287] (-532.293) (-530.452) (-529.664) * (-530.105) (-529.984) [-531.899] (-530.768) -- 0:00:32
464500 -- (-530.818) (-535.736) [-530.569] (-531.253) * (-534.391) (-531.267) [-535.123] (-530.095) -- 0:00:32
465000 -- [-529.542] (-529.328) (-529.762) (-532.709) * (-531.515) (-530.435) [-530.620] (-532.936) -- 0:00:32
Average standard deviation of split frequencies: 0.010858
465500 -- [-530.721] (-531.279) (-529.290) (-537.515) * (-539.213) (-530.556) [-531.310] (-530.265) -- 0:00:32
466000 -- (-530.417) [-528.937] (-530.591) (-534.233) * (-532.421) (-529.904) (-531.369) [-533.818] -- 0:00:32
466500 -- (-531.891) [-532.317] (-533.393) (-530.646) * (-531.646) (-532.773) [-531.987] (-530.083) -- 0:00:32
467000 -- [-532.676] (-531.091) (-530.790) (-530.579) * (-532.575) (-531.370) [-531.346] (-529.150) -- 0:00:31
467500 -- [-530.154] (-531.518) (-530.390) (-529.839) * (-532.326) [-534.309] (-529.653) (-531.109) -- 0:00:31
468000 -- (-531.337) (-531.968) (-530.542) [-530.100] * (-531.845) (-532.306) (-529.676) [-530.663] -- 0:00:31
468500 -- (-533.920) (-531.885) (-530.479) [-528.818] * (-531.584) (-531.125) (-530.647) [-531.936] -- 0:00:31
469000 -- (-533.303) (-531.954) (-532.449) [-529.219] * (-534.581) (-535.914) (-531.517) [-529.955] -- 0:00:31
469500 -- [-532.528] (-534.317) (-531.192) (-530.460) * (-537.987) (-532.840) (-530.331) [-530.016] -- 0:00:31
470000 -- (-532.166) (-530.456) [-532.585] (-533.090) * (-529.622) [-532.228] (-529.976) (-530.357) -- 0:00:31
Average standard deviation of split frequencies: 0.010216
470500 -- (-530.205) [-533.459] (-532.116) (-529.777) * (-532.496) (-529.657) [-530.991] (-529.338) -- 0:00:31
471000 -- (-530.053) (-532.745) [-532.335] (-530.757) * (-530.752) (-530.446) (-530.796) [-530.854] -- 0:00:31
471500 -- [-531.771] (-530.261) (-532.044) (-531.216) * (-532.000) [-531.179] (-530.112) (-531.686) -- 0:00:31
472000 -- (-531.192) (-537.662) (-533.052) [-532.139] * (-531.554) [-531.288] (-530.065) (-533.678) -- 0:00:31
472500 -- (-532.294) [-531.151] (-531.366) (-530.845) * (-533.518) (-531.819) (-529.958) [-531.167] -- 0:00:31
473000 -- (-536.435) (-530.453) (-535.323) [-530.899] * (-530.549) (-531.972) [-529.218] (-533.225) -- 0:00:31
473500 -- (-541.445) [-530.441] (-533.129) (-531.567) * (-531.085) [-529.293] (-531.010) (-533.451) -- 0:00:31
474000 -- (-531.098) (-530.165) [-531.638] (-530.884) * [-530.870] (-531.161) (-531.107) (-536.277) -- 0:00:31
474500 -- (-531.963) (-530.514) [-531.821] (-530.816) * (-529.383) (-529.829) (-530.283) [-533.308] -- 0:00:31
475000 -- [-529.445] (-531.584) (-530.096) (-532.670) * (-532.769) [-529.675] (-530.185) (-529.826) -- 0:00:30
Average standard deviation of split frequencies: 0.011224
475500 -- [-532.247] (-531.655) (-530.102) (-531.885) * (-535.170) [-530.995] (-530.733) (-530.717) -- 0:00:30
476000 -- (-532.943) (-531.863) [-530.476] (-531.542) * (-530.097) (-531.659) (-529.810) [-530.632] -- 0:00:30
476500 -- [-534.025] (-530.168) (-531.208) (-530.165) * (-529.559) (-533.140) [-530.517] (-531.187) -- 0:00:30
477000 -- (-534.538) [-528.846] (-530.186) (-528.697) * [-530.424] (-535.016) (-530.530) (-532.944) -- 0:00:30
477500 -- [-532.607] (-530.312) (-530.743) (-530.131) * (-529.718) (-535.017) [-529.541] (-532.721) -- 0:00:30
478000 -- [-531.656] (-531.919) (-530.196) (-530.526) * (-530.922) [-529.434] (-532.873) (-531.139) -- 0:00:30
478500 -- (-532.894) [-533.278] (-531.334) (-530.303) * (-530.871) (-530.145) [-530.065] (-529.985) -- 0:00:30
479000 -- (-532.915) [-529.926] (-534.740) (-530.535) * (-532.669) [-533.215] (-534.539) (-529.159) -- 0:00:30
479500 -- (-534.273) [-532.145] (-530.696) (-534.067) * (-532.735) (-530.614) [-529.304] (-531.506) -- 0:00:31
480000 -- [-529.454] (-530.420) (-529.306) (-532.751) * [-530.152] (-529.327) (-531.685) (-532.455) -- 0:00:31
Average standard deviation of split frequencies: 0.011703
480500 -- [-531.249] (-533.123) (-531.976) (-533.880) * (-533.262) (-529.951) [-530.542] (-532.417) -- 0:00:31
481000 -- (-531.877) [-533.534] (-531.275) (-531.436) * (-532.532) [-529.227] (-529.656) (-530.839) -- 0:00:31
481500 -- (-530.537) (-537.611) [-533.174] (-529.413) * (-529.356) (-529.575) (-529.758) [-532.625] -- 0:00:31
482000 -- (-530.153) (-535.974) (-531.086) [-529.584] * (-529.559) (-529.597) (-529.847) [-531.946] -- 0:00:31
482500 -- [-530.422] (-532.737) (-530.285) (-534.075) * [-529.888] (-532.019) (-532.930) (-533.035) -- 0:00:31
483000 -- [-534.854] (-529.141) (-531.827) (-536.070) * (-530.638) (-531.079) [-529.530] (-533.596) -- 0:00:31
483500 -- [-532.908] (-529.795) (-533.657) (-531.338) * (-529.294) [-530.129] (-530.430) (-532.788) -- 0:00:30
484000 -- (-532.277) [-530.035] (-535.684) (-529.614) * (-530.293) (-530.826) (-533.650) [-530.278] -- 0:00:30
484500 -- (-532.160) [-529.788] (-528.976) (-528.818) * [-530.529] (-534.403) (-531.210) (-532.314) -- 0:00:30
485000 -- (-531.136) [-531.053] (-531.986) (-530.853) * (-531.189) [-530.719] (-532.737) (-531.681) -- 0:00:30
Average standard deviation of split frequencies: 0.011575
485500 -- (-531.227) (-530.858) (-531.110) [-530.692] * (-531.637) (-529.289) (-531.567) [-533.214] -- 0:00:30
486000 -- [-534.477] (-528.963) (-530.347) (-529.934) * [-531.977] (-530.952) (-530.955) (-530.573) -- 0:00:30
486500 -- (-532.645) [-530.601] (-528.824) (-532.361) * (-531.436) (-532.799) [-532.694] (-533.798) -- 0:00:30
487000 -- (-531.229) (-529.555) (-529.708) [-535.114] * (-529.380) [-529.547] (-533.748) (-528.914) -- 0:00:30
487500 -- [-531.450] (-529.498) (-529.306) (-534.406) * [-532.055] (-530.690) (-530.636) (-529.643) -- 0:00:30
488000 -- [-530.051] (-531.777) (-530.326) (-528.837) * (-529.945) (-531.919) (-529.140) [-530.089] -- 0:00:30
488500 -- [-530.072] (-532.083) (-534.473) (-528.996) * (-530.796) [-531.105] (-530.012) (-532.310) -- 0:00:30
489000 -- (-530.044) (-534.937) [-529.590] (-528.955) * (-529.994) (-531.048) (-531.677) [-533.514] -- 0:00:30
489500 -- [-529.888] (-529.935) (-530.757) (-528.955) * (-532.627) (-533.446) [-535.464] (-533.172) -- 0:00:30
490000 -- (-530.416) [-533.488] (-529.064) (-529.418) * [-531.038] (-531.907) (-530.120) (-532.469) -- 0:00:30
Average standard deviation of split frequencies: 0.011913
490500 -- [-534.522] (-530.371) (-531.619) (-533.490) * (-530.747) (-529.444) [-529.061] (-530.620) -- 0:00:30
491000 -- (-532.283) (-530.000) (-530.800) [-531.704] * (-532.950) [-528.924] (-531.474) (-528.999) -- 0:00:30
491500 -- (-529.618) (-530.702) [-531.177] (-533.352) * (-529.980) [-531.603] (-530.448) (-528.999) -- 0:00:30
492000 -- (-531.579) (-531.397) (-529.738) [-529.134] * (-537.374) (-529.937) [-530.717] (-529.519) -- 0:00:29
492500 -- (-530.690) (-531.696) (-529.803) [-533.054] * (-529.007) (-529.586) (-530.594) [-529.237] -- 0:00:29
493000 -- (-530.764) (-531.807) [-533.107] (-533.138) * (-533.042) [-529.297] (-529.853) (-530.793) -- 0:00:29
493500 -- [-529.516] (-531.599) (-534.080) (-533.570) * (-529.801) (-530.290) [-528.796] (-529.496) -- 0:00:29
494000 -- (-530.106) (-529.153) (-532.837) [-529.540] * (-529.462) [-529.372] (-532.791) (-529.914) -- 0:00:29
494500 -- (-530.077) (-533.220) [-530.995] (-529.430) * (-532.705) (-530.977) (-531.570) [-532.230] -- 0:00:29
495000 -- [-529.355] (-530.921) (-529.843) (-533.608) * (-530.964) (-529.469) (-531.647) [-531.597] -- 0:00:29
Average standard deviation of split frequencies: 0.011848
495500 -- (-529.447) [-529.949] (-529.671) (-530.420) * (-534.508) (-530.031) (-532.810) [-530.272] -- 0:00:29
496000 -- (-529.747) (-534.520) (-534.469) [-530.300] * (-529.199) (-529.522) [-530.384] (-532.875) -- 0:00:30
496500 -- (-530.409) (-530.410) [-531.140] (-530.308) * (-533.094) (-532.173) [-529.387] (-529.244) -- 0:00:30
497000 -- (-528.904) [-528.811] (-529.397) (-529.624) * (-533.316) (-532.761) [-534.176] (-529.530) -- 0:00:30
497500 -- [-530.134] (-532.158) (-530.337) (-534.091) * [-532.092] (-529.770) (-533.167) (-530.119) -- 0:00:30
498000 -- [-530.354] (-530.075) (-534.793) (-533.958) * (-530.931) (-530.364) [-531.394] (-530.942) -- 0:00:30
498500 -- (-529.646) [-531.825] (-531.129) (-537.086) * (-532.487) [-530.245] (-530.018) (-530.355) -- 0:00:30
499000 -- (-534.078) (-529.485) [-534.627] (-530.099) * [-532.501] (-530.823) (-529.703) (-535.537) -- 0:00:30
499500 -- (-535.788) (-529.803) [-530.782] (-530.131) * (-533.858) [-529.358] (-531.375) (-530.452) -- 0:00:30
500000 -- (-531.434) (-531.651) (-529.173) [-530.881] * (-529.330) (-529.854) [-530.509] (-531.837) -- 0:00:30
Average standard deviation of split frequencies: 0.011110
500500 -- (-533.837) (-533.165) [-530.063] (-534.425) * (-530.584) (-531.190) [-528.831] (-530.479) -- 0:00:29
501000 -- (-535.167) [-530.107] (-530.364) (-531.739) * [-529.505] (-530.361) (-529.914) (-537.416) -- 0:00:29
501500 -- [-532.550] (-530.560) (-530.602) (-530.507) * (-530.606) (-529.464) [-532.129] (-533.075) -- 0:00:29
502000 -- [-533.661] (-530.262) (-529.669) (-534.267) * [-530.005] (-531.561) (-531.961) (-533.295) -- 0:00:29
502500 -- (-533.314) (-531.221) (-530.116) [-531.114] * [-529.086] (-537.758) (-531.829) (-531.536) -- 0:00:29
503000 -- (-531.185) [-531.741] (-530.381) (-534.349) * [-529.482] (-533.272) (-530.603) (-529.547) -- 0:00:29
503500 -- (-532.218) (-531.327) (-533.072) [-532.609] * (-533.411) [-529.911] (-537.665) (-531.479) -- 0:00:29
504000 -- (-530.304) [-529.322] (-534.070) (-531.013) * (-531.398) (-530.121) (-532.665) [-533.488] -- 0:00:29
504500 -- (-531.409) (-530.684) (-530.530) [-530.785] * (-530.261) (-529.882) [-531.732] (-531.275) -- 0:00:29
505000 -- (-538.859) (-528.824) (-535.987) [-530.842] * (-530.908) (-530.825) [-533.142] (-529.050) -- 0:00:29
Average standard deviation of split frequencies: 0.010496
505500 -- [-537.837] (-530.189) (-534.204) (-531.368) * (-531.655) (-530.590) [-532.913] (-528.887) -- 0:00:29
506000 -- (-530.908) (-530.073) (-537.630) [-531.940] * (-536.612) [-531.892] (-535.040) (-528.657) -- 0:00:29
506500 -- (-531.092) (-534.119) (-533.182) [-533.552] * (-539.236) [-532.609] (-529.478) (-528.908) -- 0:00:29
507000 -- (-534.506) (-530.902) [-532.227] (-532.141) * (-530.456) (-531.725) (-532.073) [-529.806] -- 0:00:29
507500 -- (-534.670) [-530.590] (-531.511) (-530.631) * (-530.079) (-529.279) (-531.634) [-532.061] -- 0:00:29
508000 -- (-533.025) [-530.464] (-533.060) (-530.281) * (-530.017) (-531.904) (-530.213) [-534.301] -- 0:00:29
508500 -- (-533.525) (-532.367) [-529.899] (-534.644) * (-532.120) (-531.217) [-532.568] (-530.267) -- 0:00:28
509000 -- (-532.791) (-532.609) [-529.616] (-530.747) * (-530.364) (-530.140) (-529.253) [-530.268] -- 0:00:28
509500 -- (-530.112) (-534.746) [-528.918] (-535.178) * (-530.482) (-531.512) (-530.867) [-530.475] -- 0:00:28
510000 -- (-529.593) [-532.178] (-529.001) (-535.107) * [-529.837] (-532.352) (-530.723) (-529.799) -- 0:00:28
Average standard deviation of split frequencies: 0.010216
510500 -- [-529.373] (-530.394) (-533.956) (-529.556) * (-533.262) (-531.228) [-530.126] (-530.848) -- 0:00:28
511000 -- [-529.978] (-531.116) (-531.374) (-535.077) * (-536.415) (-532.029) (-529.835) [-536.260] -- 0:00:28
511500 -- (-529.133) [-530.468] (-530.405) (-533.012) * (-536.662) [-530.953] (-529.713) (-532.216) -- 0:00:28
512000 -- (-530.834) [-530.901] (-531.378) (-531.727) * (-531.978) (-531.148) (-529.510) [-530.712] -- 0:00:28
512500 -- (-531.879) (-533.209) (-530.489) [-529.642] * (-533.702) (-531.086) (-528.884) [-530.144] -- 0:00:28
513000 -- (-528.969) (-529.833) (-532.565) [-533.056] * (-534.467) [-531.447] (-533.461) (-528.921) -- 0:00:29
513500 -- (-531.359) [-530.887] (-534.569) (-530.443) * (-529.382) [-529.521] (-532.204) (-531.945) -- 0:00:29
514000 -- (-533.687) [-529.427] (-531.026) (-531.866) * [-530.656] (-529.854) (-529.020) (-530.182) -- 0:00:29
514500 -- [-530.999] (-530.952) (-533.263) (-533.664) * [-530.906] (-530.438) (-531.255) (-531.448) -- 0:00:29
515000 -- (-534.150) [-529.361] (-531.369) (-529.316) * (-531.944) (-532.960) (-530.999) [-530.830] -- 0:00:29
Average standard deviation of split frequencies: 0.009745
515500 -- (-534.239) (-530.945) [-530.471] (-530.242) * [-529.060] (-531.984) (-530.044) (-529.122) -- 0:00:29
516000 -- (-530.033) (-529.896) [-529.827] (-532.260) * [-530.338] (-532.764) (-531.258) (-531.956) -- 0:00:29
516500 -- [-530.387] (-530.921) (-530.859) (-534.117) * (-529.588) (-531.257) (-531.862) [-530.447] -- 0:00:29
517000 -- (-529.386) (-532.906) (-529.579) [-530.396] * (-529.870) (-531.114) (-530.893) [-529.445] -- 0:00:28
517500 -- [-530.730] (-529.602) (-530.396) (-531.468) * (-531.522) (-528.836) [-530.000] (-531.282) -- 0:00:28
518000 -- [-532.189] (-532.736) (-528.967) (-530.742) * (-529.441) [-529.444] (-531.592) (-533.906) -- 0:00:28
518500 -- (-532.235) (-531.211) (-530.209) [-532.071] * (-535.337) (-534.328) (-531.226) [-533.965] -- 0:00:28
519000 -- [-531.291] (-529.846) (-533.892) (-532.525) * (-532.056) [-531.628] (-529.931) (-533.570) -- 0:00:28
519500 -- (-531.971) (-530.946) [-529.818] (-529.383) * (-529.845) [-528.722] (-530.113) (-536.526) -- 0:00:28
520000 -- (-530.184) (-531.110) (-529.357) [-529.223] * [-528.888] (-528.733) (-532.167) (-538.976) -- 0:00:28
Average standard deviation of split frequencies: 0.009175
520500 -- (-532.652) [-530.308] (-530.882) (-530.710) * (-531.909) (-528.839) (-531.279) [-535.993] -- 0:00:28
521000 -- (-529.576) [-530.844] (-531.144) (-529.405) * (-530.014) (-528.732) (-529.072) [-529.303] -- 0:00:28
521500 -- (-531.162) (-530.363) (-532.146) [-529.225] * [-531.876] (-530.762) (-534.225) (-530.852) -- 0:00:28
522000 -- [-530.838] (-529.405) (-533.499) (-530.205) * (-530.765) (-530.944) [-533.537] (-530.636) -- 0:00:28
522500 -- [-529.790] (-531.142) (-530.832) (-530.451) * [-531.064] (-530.767) (-531.923) (-532.936) -- 0:00:28
523000 -- (-531.205) [-531.963] (-530.725) (-530.550) * (-532.836) (-530.604) [-530.184] (-529.071) -- 0:00:28
523500 -- (-532.546) (-530.738) (-530.787) [-530.192] * (-530.519) [-530.119] (-531.556) (-530.676) -- 0:00:28
524000 -- (-531.117) (-533.226) (-529.531) [-530.193] * (-529.718) (-529.966) (-532.728) [-529.823] -- 0:00:28
524500 -- (-530.239) [-530.670] (-534.114) (-531.107) * (-534.179) (-531.626) [-530.181] (-530.549) -- 0:00:28
525000 -- (-531.434) (-532.511) [-529.093] (-531.391) * (-529.627) (-532.983) [-531.925] (-529.935) -- 0:00:28
Average standard deviation of split frequencies: 0.009201
525500 -- (-532.123) (-536.095) (-529.625) [-531.870] * (-531.954) [-531.255] (-531.563) (-535.702) -- 0:00:27
526000 -- (-534.838) [-530.891] (-532.216) (-530.131) * [-532.742] (-534.002) (-530.751) (-530.229) -- 0:00:27
526500 -- (-533.138) [-530.876] (-534.284) (-535.464) * (-533.063) (-531.549) [-529.861] (-538.114) -- 0:00:27
527000 -- (-532.467) (-533.411) [-534.393] (-532.841) * (-530.351) (-530.062) [-530.525] (-531.155) -- 0:00:27
527500 -- (-531.435) (-531.193) (-532.178) [-530.036] * (-531.836) (-531.429) (-531.684) [-529.985] -- 0:00:27
528000 -- [-529.428] (-530.847) (-532.087) (-530.633) * (-529.929) (-529.216) [-530.173] (-529.941) -- 0:00:27
528500 -- (-529.547) (-530.616) [-530.463] (-533.384) * [-529.743] (-529.645) (-530.023) (-533.775) -- 0:00:27
529000 -- (-530.599) [-530.413] (-533.041) (-535.186) * (-529.568) (-534.205) [-528.635] (-530.706) -- 0:00:27
529500 -- (-534.149) [-531.543] (-532.954) (-533.824) * (-531.036) (-532.836) [-528.698] (-530.482) -- 0:00:27
530000 -- (-532.307) [-529.475] (-531.378) (-530.902) * [-529.570] (-530.826) (-528.833) (-529.123) -- 0:00:28
Average standard deviation of split frequencies: 0.009535
530500 -- (-531.580) (-531.964) [-531.109] (-532.505) * (-531.474) (-530.800) [-532.148] (-530.481) -- 0:00:28
531000 -- (-530.489) (-531.280) [-530.986] (-530.937) * (-531.025) [-529.926] (-531.238) (-535.128) -- 0:00:28
531500 -- (-530.015) (-532.962) (-530.962) [-529.592] * (-531.193) (-529.939) (-529.979) [-532.074] -- 0:00:28
532000 -- (-530.977) [-534.100] (-530.466) (-529.745) * (-532.563) (-530.824) [-529.039] (-532.395) -- 0:00:28
532500 -- (-529.972) (-536.544) (-531.186) [-529.279] * (-532.387) (-531.769) [-529.626] (-531.984) -- 0:00:28
533000 -- (-534.924) (-532.962) (-530.250) [-529.528] * (-533.744) [-530.590] (-530.378) (-530.006) -- 0:00:28
533500 -- [-530.991] (-531.884) (-530.292) (-529.656) * (-531.527) (-529.577) (-530.047) [-533.913] -- 0:00:27
534000 -- (-534.208) [-530.458] (-529.348) (-533.159) * (-532.247) (-532.043) (-529.126) [-531.813] -- 0:00:27
534500 -- (-530.698) (-531.991) [-529.854] (-533.110) * (-532.232) (-529.642) [-528.773] (-532.257) -- 0:00:27
535000 -- (-533.801) (-532.708) [-531.664] (-534.818) * [-530.821] (-528.856) (-531.893) (-531.484) -- 0:00:27
Average standard deviation of split frequencies: 0.009147
535500 -- (-532.757) (-530.532) [-531.999] (-538.899) * (-530.208) (-530.102) (-532.328) [-529.542] -- 0:00:27
536000 -- (-534.502) [-530.410] (-530.018) (-532.069) * (-530.057) [-529.950] (-529.605) (-531.303) -- 0:00:27
536500 -- (-532.737) (-529.134) (-531.669) [-532.212] * (-531.777) (-530.630) (-529.745) [-529.734] -- 0:00:27
537000 -- (-530.582) (-533.870) [-530.336] (-530.765) * (-531.401) (-528.928) [-531.384] (-529.834) -- 0:00:27
537500 -- [-529.177] (-531.872) (-530.286) (-533.135) * [-530.962] (-533.513) (-533.208) (-530.055) -- 0:00:27
538000 -- (-529.382) [-530.336] (-536.238) (-530.584) * (-531.326) (-531.992) (-532.244) [-531.829] -- 0:00:27
538500 -- (-531.169) [-533.302] (-529.306) (-533.534) * (-531.418) (-531.043) (-530.214) [-532.293] -- 0:00:27
539000 -- [-534.403] (-529.861) (-531.372) (-535.201) * (-530.348) (-534.502) (-529.820) [-532.181] -- 0:00:27
539500 -- (-535.951) [-531.108] (-530.144) (-529.174) * (-530.451) (-529.953) [-529.810] (-530.257) -- 0:00:27
540000 -- (-534.808) (-529.947) [-532.942] (-531.658) * [-534.780] (-530.663) (-532.835) (-530.567) -- 0:00:27
Average standard deviation of split frequencies: 0.008893
540500 -- (-531.868) [-530.561] (-531.280) (-530.768) * [-530.444] (-531.159) (-529.728) (-531.524) -- 0:00:27
541000 -- (-531.297) [-531.949] (-533.667) (-530.063) * [-529.252] (-532.162) (-530.497) (-531.890) -- 0:00:27
541500 -- (-531.527) (-531.441) (-534.168) [-532.694] * [-529.434] (-529.318) (-532.522) (-531.729) -- 0:00:27
542000 -- (-529.904) (-531.498) [-534.455] (-533.607) * (-531.038) [-530.570] (-532.957) (-529.021) -- 0:00:27
542500 -- [-532.742] (-531.180) (-530.820) (-530.272) * (-530.595) (-531.196) [-530.378] (-530.179) -- 0:00:26
543000 -- (-529.975) (-533.015) (-531.260) [-532.241] * (-532.714) [-529.948] (-529.999) (-530.907) -- 0:00:26
543500 -- (-533.659) [-529.088] (-534.368) (-533.734) * [-530.278] (-530.177) (-533.275) (-531.154) -- 0:00:26
544000 -- (-533.444) [-532.585] (-532.869) (-530.234) * [-530.547] (-530.009) (-533.325) (-531.180) -- 0:00:26
544500 -- (-531.623) [-529.419] (-531.018) (-531.717) * [-533.836] (-530.863) (-532.663) (-535.652) -- 0:00:26
545000 -- (-530.620) (-532.700) (-530.402) [-530.393] * (-533.734) (-531.315) (-534.890) [-535.337] -- 0:00:26
Average standard deviation of split frequencies: 0.008231
545500 -- [-530.142] (-528.993) (-529.500) (-530.767) * [-530.727] (-529.536) (-532.678) (-533.316) -- 0:00:26
546000 -- (-532.105) [-529.755] (-535.178) (-529.193) * (-531.848) [-528.974] (-531.186) (-529.647) -- 0:00:26
546500 -- (-533.405) [-530.730] (-531.102) (-534.311) * [-531.662] (-531.650) (-532.051) (-531.281) -- 0:00:26
547000 -- (-533.859) (-532.593) [-529.571] (-532.920) * (-531.707) [-530.743] (-531.604) (-529.268) -- 0:00:27
547500 -- (-531.787) (-531.459) [-531.407] (-531.991) * (-531.314) [-530.719] (-530.718) (-531.225) -- 0:00:27
548000 -- (-533.195) [-534.396] (-534.038) (-529.942) * (-530.926) (-531.207) (-530.175) [-534.943] -- 0:00:27
548500 -- (-530.273) (-536.194) [-531.933] (-529.622) * (-528.904) [-529.788] (-532.067) (-531.302) -- 0:00:27
549000 -- (-534.239) (-534.660) [-531.480] (-532.236) * (-530.025) (-533.362) [-532.028] (-533.819) -- 0:00:27
549500 -- (-531.698) (-535.228) (-530.163) [-531.271] * (-532.118) (-536.352) (-532.800) [-529.947] -- 0:00:27
550000 -- (-531.621) (-529.225) [-530.889] (-530.308) * (-530.928) (-532.121) (-534.484) [-530.836] -- 0:00:27
Average standard deviation of split frequencies: 0.008675
550500 -- (-531.860) (-533.330) [-529.922] (-529.338) * (-530.200) [-533.177] (-530.875) (-530.743) -- 0:00:26
551000 -- (-531.517) (-531.283) [-530.276] (-532.388) * (-529.401) [-531.459] (-530.617) (-530.988) -- 0:00:26
551500 -- (-529.279) (-530.837) [-530.223] (-533.255) * [-531.900] (-531.470) (-530.164) (-532.860) -- 0:00:26
552000 -- [-534.668] (-530.733) (-535.949) (-534.415) * (-534.809) [-532.468] (-532.726) (-532.575) -- 0:00:26
552500 -- (-530.546) (-530.992) (-531.903) [-529.568] * (-530.456) (-529.394) [-530.675] (-531.498) -- 0:00:26
553000 -- (-530.762) [-534.679] (-530.697) (-530.631) * (-529.874) (-530.108) [-530.324] (-532.454) -- 0:00:26
553500 -- (-530.443) (-534.096) [-533.971] (-530.745) * (-533.192) (-534.005) (-529.466) [-530.985] -- 0:00:26
554000 -- (-536.117) [-531.169] (-532.567) (-531.701) * [-530.572] (-531.778) (-529.496) (-529.363) -- 0:00:26
554500 -- (-536.112) (-532.415) [-532.757] (-531.036) * (-531.338) (-531.582) [-532.072] (-529.679) -- 0:00:26
555000 -- (-529.536) [-530.322] (-531.583) (-533.728) * (-530.892) [-530.495] (-532.874) (-529.860) -- 0:00:26
Average standard deviation of split frequencies: 0.008252
555500 -- (-529.943) (-536.754) (-532.817) [-531.047] * (-530.440) (-530.160) [-530.312] (-530.066) -- 0:00:26
556000 -- [-531.660] (-534.820) (-532.038) (-530.278) * (-529.923) (-529.549) (-531.630) [-530.104] -- 0:00:26
556500 -- [-531.065] (-530.183) (-531.132) (-530.337) * (-530.303) [-529.571] (-529.613) (-536.870) -- 0:00:26
557000 -- [-530.483] (-531.425) (-529.404) (-530.337) * (-530.025) [-530.049] (-529.072) (-531.711) -- 0:00:26
557500 -- (-531.492) (-530.339) [-530.026] (-528.965) * [-531.124] (-530.569) (-529.214) (-532.290) -- 0:00:26
558000 -- (-538.607) (-528.655) (-530.984) [-529.746] * (-529.813) (-535.447) [-529.167] (-530.626) -- 0:00:26
558500 -- (-532.532) (-530.064) (-531.525) [-533.467] * (-531.656) (-531.111) [-531.659] (-530.555) -- 0:00:26
559000 -- (-534.552) (-530.815) [-532.954] (-533.288) * (-533.868) [-530.940] (-530.990) (-530.381) -- 0:00:26
559500 -- [-530.134] (-530.089) (-534.403) (-530.580) * (-532.629) (-530.570) (-532.677) [-531.707] -- 0:00:25
560000 -- (-531.821) (-530.543) (-531.229) [-530.270] * [-530.182] (-529.979) (-532.070) (-533.502) -- 0:00:25
Average standard deviation of split frequencies: 0.007735
560500 -- (-531.678) [-530.400] (-536.375) (-529.699) * [-530.773] (-529.796) (-531.091) (-531.939) -- 0:00:25
561000 -- (-530.938) (-532.784) (-529.780) [-530.244] * (-533.666) [-529.960] (-531.074) (-533.498) -- 0:00:25
561500 -- [-531.527] (-531.057) (-530.119) (-530.060) * [-530.443] (-529.255) (-531.307) (-530.728) -- 0:00:25
562000 -- [-531.527] (-532.747) (-530.317) (-530.930) * (-530.607) (-530.325) [-529.374] (-531.653) -- 0:00:25
562500 -- (-531.207) (-529.433) [-530.223] (-530.745) * (-531.201) (-529.141) (-536.035) [-532.035] -- 0:00:25
563000 -- (-530.690) (-529.294) [-532.828] (-530.352) * (-531.384) [-532.151] (-529.446) (-528.803) -- 0:00:25
563500 -- (-528.756) (-533.309) [-531.341] (-533.474) * (-530.567) (-535.763) [-534.192] (-529.367) -- 0:00:25
564000 -- (-529.305) [-534.180] (-531.189) (-531.882) * (-530.009) [-531.613] (-530.545) (-530.061) -- 0:00:26
564500 -- (-529.903) [-530.614] (-529.656) (-529.825) * (-530.938) [-530.207] (-530.346) (-534.253) -- 0:00:26
565000 -- (-532.608) (-529.619) (-529.262) [-531.599] * (-531.088) [-530.468] (-530.159) (-531.456) -- 0:00:26
Average standard deviation of split frequencies: 0.008162
565500 -- (-542.050) (-530.685) [-530.787] (-530.929) * [-531.044] (-529.260) (-530.796) (-530.578) -- 0:00:26
566000 -- (-534.178) (-530.796) [-531.748] (-531.913) * (-532.041) (-531.365) (-535.749) [-533.227] -- 0:00:26
566500 -- (-532.478) [-530.814] (-531.238) (-532.181) * (-535.094) [-531.132] (-529.918) (-533.064) -- 0:00:26
567000 -- (-530.429) (-530.240) (-530.214) [-531.151] * [-532.551] (-529.567) (-530.110) (-529.615) -- 0:00:25
567500 -- (-533.867) (-531.304) (-532.116) [-530.093] * (-532.025) (-535.689) (-531.612) [-532.132] -- 0:00:25
568000 -- (-529.978) (-532.057) [-529.306] (-529.490) * (-531.792) (-531.056) (-532.081) [-529.633] -- 0:00:25
568500 -- (-529.367) (-532.244) [-531.933] (-530.152) * (-529.137) (-530.991) (-529.536) [-530.396] -- 0:00:25
569000 -- (-531.393) (-531.766) (-530.269) [-531.891] * [-531.180] (-531.643) (-530.888) (-531.474) -- 0:00:25
569500 -- (-530.451) (-530.418) (-533.566) [-530.301] * (-529.831) (-530.892) [-528.991] (-532.646) -- 0:00:25
570000 -- [-530.610] (-530.432) (-529.846) (-530.523) * (-530.059) (-530.081) [-530.361] (-531.082) -- 0:00:25
Average standard deviation of split frequencies: 0.007765
570500 -- (-531.671) (-530.349) [-532.739] (-530.353) * [-530.248] (-532.565) (-529.503) (-531.757) -- 0:00:25
571000 -- (-530.258) [-531.386] (-531.505) (-530.356) * [-530.583] (-531.390) (-533.130) (-532.930) -- 0:00:25
571500 -- (-532.006) [-532.002] (-530.794) (-530.345) * [-531.178] (-530.730) (-533.269) (-532.018) -- 0:00:25
572000 -- (-529.734) [-531.273] (-530.430) (-530.015) * [-532.438] (-531.153) (-531.127) (-531.128) -- 0:00:25
572500 -- [-528.950] (-529.807) (-529.159) (-532.800) * (-531.224) (-529.898) (-531.860) [-532.628] -- 0:00:25
573000 -- [-529.649] (-530.012) (-528.777) (-531.943) * (-529.635) (-533.491) [-531.594] (-530.523) -- 0:00:25
573500 -- [-529.334] (-530.405) (-530.625) (-531.020) * (-530.179) (-531.036) [-532.338] (-532.530) -- 0:00:25
574000 -- (-529.532) [-531.544] (-530.879) (-530.768) * (-529.115) [-530.304] (-530.373) (-529.556) -- 0:00:25
574500 -- (-531.791) (-529.542) (-534.361) [-530.911] * [-529.965] (-532.244) (-530.247) (-531.239) -- 0:00:25
575000 -- (-532.006) [-529.513] (-533.025) (-530.790) * (-535.498) (-531.875) (-532.161) [-530.489] -- 0:00:25
Average standard deviation of split frequencies: 0.006875
575500 -- (-534.423) [-529.847] (-529.713) (-531.455) * [-532.569] (-530.300) (-530.149) (-532.392) -- 0:00:25
576000 -- (-534.314) (-530.754) [-530.679] (-531.905) * (-532.689) (-532.470) [-529.622] (-530.792) -- 0:00:25
576500 -- [-534.151] (-531.551) (-529.807) (-532.635) * [-529.462] (-529.855) (-534.522) (-529.215) -- 0:00:24
577000 -- (-530.249) [-529.547] (-529.762) (-532.563) * (-531.903) [-529.080] (-532.102) (-532.605) -- 0:00:24
577500 -- (-533.851) (-529.269) [-531.859] (-530.942) * (-531.490) (-531.685) [-532.464] (-532.362) -- 0:00:24
578000 -- [-530.313] (-530.846) (-530.463) (-531.002) * (-534.593) (-531.157) [-530.231] (-533.384) -- 0:00:24
578500 -- (-530.897) (-534.397) (-531.343) [-534.410] * (-535.211) [-533.259] (-530.440) (-531.464) -- 0:00:24
579000 -- (-531.859) [-534.401] (-531.174) (-532.935) * (-530.848) (-530.187) (-530.090) [-530.569] -- 0:00:24
579500 -- (-533.403) (-531.529) (-532.433) [-531.509] * [-532.181] (-530.264) (-534.464) (-530.490) -- 0:00:24
580000 -- [-530.173] (-531.218) (-531.306) (-529.273) * [-532.117] (-532.057) (-535.262) (-529.284) -- 0:00:24
Average standard deviation of split frequencies: 0.006982
580500 -- (-531.387) (-529.622) [-530.350] (-531.838) * (-529.072) (-531.727) (-532.349) [-529.261] -- 0:00:24
581000 -- (-531.204) (-531.120) [-531.129] (-531.469) * [-528.873] (-533.368) (-532.605) (-530.000) -- 0:00:25
581500 -- (-530.796) [-530.057] (-534.726) (-531.154) * [-530.629] (-531.359) (-534.438) (-530.099) -- 0:00:25
582000 -- (-529.696) [-531.140] (-535.372) (-530.390) * (-529.809) (-531.651) (-536.309) [-529.808] -- 0:00:25
582500 -- (-529.113) [-530.436] (-532.938) (-531.489) * (-530.638) (-534.259) [-530.896] (-530.092) -- 0:00:25
583000 -- [-533.035] (-529.175) (-534.303) (-531.850) * (-530.809) (-534.348) [-531.517] (-530.040) -- 0:00:25
583500 -- [-530.887] (-531.265) (-530.609) (-530.154) * (-533.582) [-535.145] (-531.282) (-529.729) -- 0:00:24
584000 -- (-530.045) (-531.625) (-530.448) [-532.772] * (-528.749) (-533.547) (-530.366) [-530.613] -- 0:00:24
584500 -- (-529.964) (-530.726) (-531.730) [-529.535] * (-528.861) (-534.192) (-531.466) [-532.312] -- 0:00:24
585000 -- (-532.435) (-530.596) [-532.236] (-532.111) * [-529.077] (-530.642) (-532.130) (-535.203) -- 0:00:24
Average standard deviation of split frequencies: 0.007186
585500 -- (-530.075) (-530.311) [-530.216] (-534.489) * (-529.388) (-530.643) (-534.260) [-531.161] -- 0:00:24
586000 -- (-531.873) (-529.715) [-529.446] (-531.728) * (-529.138) [-529.076] (-531.735) (-533.061) -- 0:00:24
586500 -- (-532.208) (-532.662) (-528.889) [-531.075] * [-532.834] (-533.236) (-529.569) (-529.856) -- 0:00:24
587000 -- (-529.951) (-531.352) [-529.601] (-532.144) * [-531.830] (-530.356) (-534.628) (-529.163) -- 0:00:24
587500 -- (-529.845) (-532.165) [-530.749] (-533.449) * (-531.919) [-529.578] (-531.936) (-531.375) -- 0:00:24
588000 -- (-530.767) (-531.812) [-533.842] (-535.211) * (-529.634) (-529.752) (-532.334) [-529.336] -- 0:00:24
588500 -- [-530.835] (-532.590) (-536.670) (-531.421) * (-533.386) (-530.661) (-530.838) [-529.868] -- 0:00:24
589000 -- [-530.106] (-533.633) (-534.573) (-532.150) * (-533.740) (-531.347) [-531.316] (-530.604) -- 0:00:24
589500 -- (-533.035) (-531.008) (-534.230) [-531.866] * (-531.563) (-529.026) (-532.670) [-529.361] -- 0:00:24
590000 -- (-532.278) [-532.141] (-530.751) (-530.629) * (-533.236) [-530.314] (-529.844) (-528.542) -- 0:00:24
Average standard deviation of split frequencies: 0.006917
590500 -- (-533.197) (-533.575) [-531.858] (-530.017) * (-537.429) [-530.912] (-530.696) (-529.733) -- 0:00:24
591000 -- (-534.757) [-531.060] (-530.592) (-529.605) * (-532.918) [-529.243] (-531.510) (-531.161) -- 0:00:24
591500 -- (-533.550) (-532.213) (-529.477) [-529.954] * [-529.392] (-528.661) (-532.159) (-530.974) -- 0:00:24
592000 -- (-530.711) [-530.642] (-529.376) (-529.816) * [-530.702] (-530.750) (-532.508) (-530.661) -- 0:00:24
592500 -- (-531.644) (-533.609) (-531.947) [-531.311] * [-530.567] (-531.349) (-531.595) (-535.232) -- 0:00:24
593000 -- (-529.792) [-531.449] (-530.163) (-530.621) * (-530.375) [-531.724] (-530.918) (-532.479) -- 0:00:24
593500 -- [-529.857] (-531.209) (-531.727) (-532.293) * [-531.527] (-531.371) (-529.553) (-531.922) -- 0:00:23
594000 -- (-531.034) (-529.467) [-528.801] (-531.892) * (-530.588) [-531.468] (-529.881) (-533.364) -- 0:00:23
594500 -- (-532.517) [-530.312] (-530.339) (-530.327) * (-531.237) (-532.682) [-528.720] (-532.653) -- 0:00:23
595000 -- (-531.042) (-533.471) (-529.884) [-534.285] * [-529.941] (-531.216) (-529.729) (-530.420) -- 0:00:23
Average standard deviation of split frequencies: 0.007593
595500 -- (-529.402) (-532.006) (-528.879) [-531.667] * (-529.197) (-532.666) [-530.512] (-531.513) -- 0:00:23
596000 -- [-529.627] (-529.364) (-530.393) (-532.641) * [-529.430] (-534.082) (-530.373) (-530.271) -- 0:00:23
596500 -- [-529.729] (-534.454) (-532.684) (-532.000) * (-531.888) (-531.370) (-535.273) [-529.249] -- 0:00:23
597000 -- (-534.135) (-529.655) [-528.751] (-531.517) * (-532.614) (-533.209) (-531.979) [-529.808] -- 0:00:24
597500 -- (-536.483) (-529.502) [-528.852] (-528.633) * (-529.009) [-531.399] (-531.258) (-530.754) -- 0:00:24
598000 -- (-530.444) (-532.759) (-533.205) [-529.251] * (-529.810) [-529.166] (-529.505) (-532.554) -- 0:00:24
598500 -- (-531.777) (-529.085) (-531.388) [-529.129] * (-529.232) (-530.807) (-531.338) [-535.761] -- 0:00:24
599000 -- (-532.477) (-535.009) [-531.970] (-531.647) * (-530.687) (-530.282) (-531.906) [-530.638] -- 0:00:24
599500 -- [-530.417] (-530.393) (-532.040) (-529.821) * (-530.423) [-530.840] (-531.428) (-530.947) -- 0:00:24
600000 -- (-531.376) (-540.833) (-537.825) [-529.965] * (-530.208) [-531.202] (-531.145) (-529.538) -- 0:00:24
Average standard deviation of split frequencies: 0.007743
600500 -- (-530.248) (-534.297) [-529.871] (-529.351) * (-529.745) [-533.903] (-531.044) (-531.073) -- 0:00:23
601000 -- (-530.544) [-531.938] (-531.283) (-530.774) * (-531.493) (-532.616) [-529.725] (-531.661) -- 0:00:23
601500 -- [-531.017] (-531.637) (-533.981) (-532.865) * (-530.699) [-531.083] (-528.901) (-532.803) -- 0:00:23
602000 -- (-533.502) (-531.369) (-533.286) [-531.370] * (-534.538) [-529.850] (-530.862) (-531.172) -- 0:00:23
602500 -- (-529.801) [-531.186] (-537.131) (-531.074) * (-529.708) [-529.028] (-534.055) (-532.369) -- 0:00:23
603000 -- [-530.424] (-532.983) (-535.928) (-530.711) * (-529.904) (-533.111) [-531.796] (-530.817) -- 0:00:23
603500 -- (-531.704) (-531.718) [-535.174] (-533.601) * (-529.884) (-530.341) [-533.676] (-530.020) -- 0:00:23
604000 -- (-529.344) (-535.325) (-531.218) [-530.733] * (-531.407) [-529.940] (-536.054) (-533.149) -- 0:00:23
604500 -- [-530.215] (-531.458) (-535.509) (-530.719) * (-529.076) (-530.778) (-535.652) [-529.427] -- 0:00:23
605000 -- [-529.883] (-531.982) (-529.357) (-532.485) * (-531.689) (-531.618) [-534.054] (-530.942) -- 0:00:23
Average standard deviation of split frequencies: 0.007727
605500 -- (-531.291) (-534.636) (-530.590) [-530.063] * (-534.224) (-530.884) (-534.102) [-532.120] -- 0:00:23
606000 -- (-531.061) (-529.689) (-529.635) [-528.975] * [-530.540] (-530.623) (-531.132) (-531.410) -- 0:00:23
606500 -- [-529.807] (-532.816) (-530.078) (-529.383) * [-530.920] (-531.513) (-529.165) (-534.057) -- 0:00:23
607000 -- (-530.068) (-530.029) [-530.085] (-533.223) * [-532.165] (-533.198) (-532.912) (-532.814) -- 0:00:23
607500 -- (-531.510) (-531.433) [-531.436] (-530.576) * (-531.703) [-530.286] (-532.456) (-532.130) -- 0:00:23
608000 -- [-531.058] (-530.458) (-533.529) (-529.967) * (-531.445) (-530.910) (-531.514) [-530.747] -- 0:00:23
608500 -- (-531.912) (-530.374) [-531.322] (-531.172) * (-536.878) [-529.375] (-530.759) (-531.349) -- 0:00:23
609000 -- (-531.577) [-528.875] (-529.905) (-531.953) * [-532.956] (-528.963) (-532.702) (-532.324) -- 0:00:23
609500 -- (-531.534) (-533.103) (-530.464) [-530.455] * (-534.731) (-534.169) [-532.706] (-530.145) -- 0:00:23
610000 -- (-535.528) (-531.419) [-529.987] (-533.936) * (-531.716) (-535.792) (-530.659) [-530.267] -- 0:00:23
Average standard deviation of split frequencies: 0.007514
610500 -- (-532.692) (-534.944) (-530.039) [-530.974] * (-530.689) (-534.027) (-533.476) [-530.343] -- 0:00:22
611000 -- (-529.138) (-531.937) [-529.971] (-533.818) * [-530.950] (-533.707) (-532.578) (-531.996) -- 0:00:22
611500 -- (-532.458) (-533.539) (-532.960) [-533.005] * (-533.931) [-536.020] (-529.736) (-529.724) -- 0:00:22
612000 -- (-534.761) (-530.522) (-532.160) [-532.958] * (-534.017) (-533.826) (-530.923) [-529.529] -- 0:00:22
612500 -- (-533.374) (-531.380) [-533.882] (-534.440) * (-532.819) (-536.513) (-531.480) [-532.253] -- 0:00:22
613000 -- (-536.717) [-530.971] (-530.219) (-531.342) * [-531.807] (-531.338) (-533.938) (-534.856) -- 0:00:23
613500 -- (-530.869) [-533.761] (-529.040) (-532.581) * (-530.129) [-529.961] (-535.084) (-531.153) -- 0:00:23
614000 -- (-533.716) [-533.257] (-529.869) (-530.030) * [-534.279] (-531.601) (-534.454) (-532.837) -- 0:00:23
614500 -- (-530.268) (-537.332) [-531.719] (-531.577) * (-541.175) (-530.340) (-530.804) [-531.685] -- 0:00:23
615000 -- (-532.171) (-534.071) (-531.322) [-529.998] * (-532.326) (-531.377) (-530.923) [-531.004] -- 0:00:23
Average standard deviation of split frequencies: 0.007347
615500 -- (-530.439) [-531.398] (-531.670) (-529.878) * (-530.783) [-529.910] (-529.543) (-529.520) -- 0:00:23
616000 -- [-529.835] (-532.467) (-531.635) (-532.546) * (-531.842) [-529.895] (-530.189) (-529.575) -- 0:00:23
616500 -- (-530.241) (-531.718) [-530.988] (-528.890) * (-533.450) (-532.070) (-529.900) [-530.178] -- 0:00:23
617000 -- (-529.028) [-529.910] (-530.370) (-532.617) * (-532.210) [-534.782] (-531.967) (-533.510) -- 0:00:22
617500 -- (-529.821) (-530.544) (-531.557) [-531.029] * (-533.135) (-529.035) [-531.217] (-531.880) -- 0:00:22
618000 -- (-532.896) (-531.097) (-535.236) [-529.461] * (-530.881) (-528.860) [-530.779] (-532.559) -- 0:00:22
618500 -- (-530.540) (-530.765) (-533.535) [-532.002] * (-531.067) (-531.207) (-530.536) [-533.511] -- 0:00:22
619000 -- (-529.215) (-533.550) [-529.877] (-531.122) * [-532.372] (-531.034) (-531.305) (-533.007) -- 0:00:22
619500 -- (-530.921) (-529.851) [-529.132] (-529.710) * (-530.217) [-531.127] (-529.492) (-530.109) -- 0:00:22
620000 -- [-529.866] (-533.609) (-532.553) (-533.561) * [-532.767] (-532.273) (-533.011) (-533.311) -- 0:00:22
Average standard deviation of split frequencies: 0.006734
620500 -- [-530.662] (-530.047) (-532.487) (-533.727) * (-530.693) [-531.499] (-531.241) (-530.652) -- 0:00:22
621000 -- (-528.633) (-532.835) (-531.526) [-528.689] * (-530.536) (-533.509) [-533.849] (-529.200) -- 0:00:22
621500 -- (-529.109) (-530.420) [-530.896] (-531.378) * [-529.123] (-530.772) (-533.694) (-528.996) -- 0:00:22
622000 -- (-529.320) [-531.912] (-530.415) (-534.450) * (-531.847) [-530.747] (-530.910) (-529.801) -- 0:00:22
622500 -- (-530.231) [-532.594] (-535.549) (-533.191) * (-533.492) (-534.835) (-530.019) [-529.522] -- 0:00:22
623000 -- [-532.547] (-530.341) (-530.561) (-531.706) * (-534.434) (-535.208) [-531.634] (-534.841) -- 0:00:22
623500 -- (-534.544) (-532.313) [-529.389] (-532.044) * [-531.236] (-529.443) (-530.738) (-535.870) -- 0:00:22
624000 -- [-530.180] (-532.409) (-534.287) (-532.663) * [-530.422] (-533.294) (-532.360) (-531.412) -- 0:00:22
624500 -- (-531.719) (-532.378) (-530.918) [-531.508] * [-529.281] (-535.739) (-529.874) (-533.613) -- 0:00:22
625000 -- (-530.826) [-530.683] (-531.569) (-530.918) * (-529.284) (-536.177) (-530.460) [-532.056] -- 0:00:22
Average standard deviation of split frequencies: 0.007631
625500 -- (-530.107) (-531.301) (-531.116) [-531.015] * (-532.070) (-532.415) (-535.102) [-533.650] -- 0:00:22
626000 -- (-530.241) (-532.186) (-531.760) [-529.467] * (-533.202) [-529.205] (-531.250) (-530.673) -- 0:00:22
626500 -- (-530.884) [-529.691] (-531.075) (-531.664) * (-532.070) (-529.757) (-530.211) [-530.030] -- 0:00:22
627000 -- (-531.169) [-530.610] (-530.129) (-531.807) * (-530.627) [-530.913] (-530.828) (-532.153) -- 0:00:22
627500 -- (-530.639) (-529.420) [-529.145] (-530.890) * (-533.089) (-530.890) [-531.757] (-529.524) -- 0:00:21
628000 -- (-533.956) [-529.826] (-531.751) (-530.865) * [-529.703] (-529.947) (-529.415) (-535.413) -- 0:00:21
628500 -- (-531.505) (-530.858) [-531.742] (-530.320) * [-529.268] (-531.329) (-533.047) (-530.528) -- 0:00:21
629000 -- (-531.420) [-530.286] (-530.506) (-532.153) * (-530.324) (-529.711) [-533.701] (-530.171) -- 0:00:21
629500 -- [-529.246] (-533.077) (-530.151) (-534.454) * (-530.869) [-530.055] (-531.700) (-531.509) -- 0:00:21
630000 -- (-528.960) (-534.900) [-530.062] (-530.347) * (-535.706) (-530.902) (-531.412) [-531.862] -- 0:00:22
Average standard deviation of split frequencies: 0.007425
630500 -- (-530.172) (-531.293) [-529.307] (-528.969) * (-533.090) [-530.860] (-531.498) (-529.076) -- 0:00:22
631000 -- (-533.299) [-528.991] (-535.214) (-529.848) * [-530.122] (-530.283) (-532.705) (-532.888) -- 0:00:22
631500 -- (-529.333) (-530.706) (-531.962) [-529.589] * [-530.162] (-529.426) (-532.264) (-532.061) -- 0:00:22
632000 -- (-530.693) (-530.260) [-530.730] (-530.023) * (-529.092) [-530.071] (-530.167) (-532.961) -- 0:00:22
632500 -- [-532.596] (-536.040) (-533.214) (-530.671) * [-529.798] (-533.173) (-533.356) (-531.325) -- 0:00:22
633000 -- (-531.470) (-530.245) (-531.015) [-531.885] * (-529.309) (-533.702) [-536.074] (-528.971) -- 0:00:22
633500 -- (-530.815) (-529.859) [-531.745] (-532.845) * [-531.182] (-529.931) (-529.302) (-529.800) -- 0:00:21
634000 -- (-529.447) (-529.525) [-531.436] (-539.512) * (-533.496) [-530.975] (-531.153) (-529.991) -- 0:00:21
634500 -- (-530.509) (-532.228) [-532.683] (-534.274) * (-532.130) [-531.600] (-529.482) (-532.149) -- 0:00:21
635000 -- [-531.272] (-532.054) (-530.360) (-535.256) * (-533.229) (-533.008) [-530.208] (-531.212) -- 0:00:21
Average standard deviation of split frequencies: 0.007264
635500 -- (-533.497) [-531.807] (-529.869) (-528.743) * (-531.169) (-530.190) (-529.046) [-534.204] -- 0:00:21
636000 -- (-532.726) [-530.351] (-530.596) (-530.144) * [-530.579] (-531.679) (-529.502) (-530.782) -- 0:00:21
636500 -- (-532.606) (-531.365) [-530.630] (-533.301) * (-532.304) (-533.150) (-529.639) [-531.123] -- 0:00:21
637000 -- (-537.550) [-529.695] (-532.415) (-532.718) * (-532.662) (-530.211) (-531.271) [-532.316] -- 0:00:21
637500 -- [-532.562] (-529.522) (-532.260) (-528.972) * [-529.110] (-531.010) (-530.005) (-530.839) -- 0:00:21
638000 -- [-530.113] (-532.039) (-529.281) (-529.595) * (-537.085) (-530.071) (-528.850) [-533.902] -- 0:00:21
638500 -- (-534.308) [-530.757] (-532.667) (-529.750) * [-530.285] (-531.890) (-532.097) (-531.263) -- 0:00:21
639000 -- (-534.191) [-529.352] (-534.528) (-530.801) * (-530.140) (-530.372) (-532.623) [-531.493] -- 0:00:21
639500 -- (-531.015) (-528.864) [-529.369] (-533.961) * (-541.929) (-528.995) (-532.027) [-529.498] -- 0:00:21
640000 -- [-530.816] (-532.718) (-531.951) (-530.041) * (-536.136) [-529.506] (-529.948) (-530.909) -- 0:00:21
Average standard deviation of split frequencies: 0.006377
640500 -- (-534.430) (-534.417) [-533.246] (-531.878) * (-536.505) (-530.636) [-530.892] (-529.497) -- 0:00:21
641000 -- (-530.076) (-533.041) (-535.462) [-529.569] * (-535.753) [-530.275] (-528.750) (-529.038) -- 0:00:21
641500 -- (-535.393) (-530.248) (-529.177) [-529.002] * (-531.845) (-530.205) [-530.486] (-530.697) -- 0:00:21
642000 -- (-532.533) (-531.056) (-528.739) [-530.098] * (-528.815) (-531.881) (-536.027) [-529.616] -- 0:00:21
642500 -- [-531.468] (-529.368) (-532.186) (-530.139) * [-531.668] (-529.591) (-533.007) (-530.059) -- 0:00:21
643000 -- (-532.669) [-530.324] (-537.045) (-529.723) * (-532.551) (-528.679) [-529.256] (-529.639) -- 0:00:21
643500 -- [-531.574] (-530.275) (-531.412) (-531.102) * (-530.624) [-530.053] (-532.258) (-530.108) -- 0:00:21
644000 -- [-530.466] (-535.343) (-532.866) (-530.531) * [-530.766] (-532.022) (-530.483) (-531.974) -- 0:00:21
644500 -- (-532.363) (-530.148) [-533.135] (-529.881) * (-531.432) (-530.631) (-532.801) [-531.312] -- 0:00:20
645000 -- (-531.828) [-533.949] (-529.348) (-530.433) * (-530.661) (-532.196) [-530.662] (-531.617) -- 0:00:20
Average standard deviation of split frequencies: 0.005935
645500 -- [-529.515] (-534.427) (-531.439) (-531.273) * (-530.870) [-531.389] (-530.536) (-529.355) -- 0:00:20
646000 -- (-530.709) (-533.839) (-530.400) [-531.428] * (-530.300) (-528.850) [-529.867] (-529.899) -- 0:00:20
646500 -- (-532.258) [-531.245] (-531.238) (-529.697) * (-532.670) (-529.345) (-529.401) [-532.717] -- 0:00:20
647000 -- (-535.016) (-530.306) [-529.882] (-530.259) * (-530.260) (-533.168) (-528.930) [-531.798] -- 0:00:21
647500 -- (-532.728) (-530.127) [-531.122] (-530.558) * (-528.970) (-529.539) (-529.733) [-530.438] -- 0:00:21
648000 -- (-535.305) [-533.825] (-531.217) (-532.170) * (-530.014) (-532.159) (-530.113) [-530.824] -- 0:00:21
648500 -- (-530.179) [-530.149] (-530.035) (-532.381) * (-530.486) (-528.796) [-531.842] (-532.133) -- 0:00:21
649000 -- (-529.318) [-530.924] (-531.543) (-532.097) * (-531.330) [-529.720] (-530.357) (-530.685) -- 0:00:21
649500 -- (-531.429) (-529.908) [-531.454] (-530.913) * (-532.190) (-529.711) [-529.029] (-532.988) -- 0:00:21
650000 -- (-534.298) (-532.359) [-532.592] (-533.441) * (-530.534) (-529.586) (-529.380) [-534.038] -- 0:00:21
Average standard deviation of split frequencies: 0.005796
650500 -- (-533.324) [-533.484] (-530.411) (-534.523) * [-532.562] (-532.166) (-530.457) (-534.392) -- 0:00:20
651000 -- (-532.884) (-533.501) [-531.074] (-533.366) * (-531.404) [-530.584] (-531.468) (-531.576) -- 0:00:20
651500 -- (-529.904) (-534.044) [-532.131] (-530.808) * (-532.690) (-536.064) (-529.708) [-532.201] -- 0:00:20
652000 -- [-530.374] (-531.687) (-529.963) (-529.863) * (-531.718) (-533.666) (-531.519) [-529.625] -- 0:00:20
652500 -- [-533.996] (-529.462) (-531.147) (-533.880) * (-531.046) [-530.642] (-532.957) (-532.143) -- 0:00:20
653000 -- (-532.086) (-532.228) [-529.800] (-532.355) * (-529.778) (-529.807) [-529.372] (-530.161) -- 0:00:20
653500 -- (-530.216) [-532.875] (-531.219) (-531.778) * (-531.122) [-529.708] (-530.377) (-529.411) -- 0:00:20
654000 -- [-529.206] (-530.153) (-529.985) (-530.563) * (-533.049) (-531.572) [-530.431] (-530.476) -- 0:00:20
654500 -- (-529.813) (-530.457) [-529.380] (-528.931) * (-537.276) (-530.744) [-532.405] (-530.247) -- 0:00:20
655000 -- (-529.939) (-531.946) (-530.367) [-528.953] * (-536.297) (-529.231) [-529.635] (-530.351) -- 0:00:20
Average standard deviation of split frequencies: 0.006132
655500 -- (-531.559) (-532.257) (-532.943) [-529.358] * (-533.545) (-528.836) [-530.312] (-530.499) -- 0:00:20
656000 -- [-533.253] (-533.539) (-532.662) (-530.988) * [-530.329] (-531.221) (-534.283) (-530.285) -- 0:00:20
656500 -- (-537.363) (-532.040) (-530.209) [-531.023] * (-530.456) [-529.867] (-531.657) (-532.403) -- 0:00:20
657000 -- (-535.947) [-529.570] (-529.999) (-531.906) * (-529.571) (-532.550) [-530.261] (-532.708) -- 0:00:20
657500 -- (-531.356) [-529.924] (-529.888) (-532.633) * (-534.436) (-529.707) [-531.635] (-531.245) -- 0:00:20
658000 -- [-530.268] (-528.993) (-529.132) (-532.697) * [-529.961] (-531.866) (-533.701) (-533.844) -- 0:00:20
658500 -- (-530.401) (-530.481) [-529.888] (-531.127) * [-530.022] (-530.712) (-531.374) (-531.925) -- 0:00:20
659000 -- [-530.892] (-530.264) (-531.651) (-531.090) * (-532.231) (-532.558) (-533.236) [-534.865] -- 0:00:20
659500 -- [-530.284] (-531.179) (-532.070) (-531.975) * (-531.308) (-532.758) (-530.016) [-531.391] -- 0:00:20
660000 -- (-532.840) [-528.899] (-529.239) (-530.098) * (-529.660) [-531.686] (-531.514) (-529.324) -- 0:00:20
Average standard deviation of split frequencies: 0.005756
660500 -- (-531.290) [-530.711] (-530.143) (-529.918) * [-530.588] (-531.578) (-531.935) (-530.935) -- 0:00:20
661000 -- [-529.665] (-530.718) (-533.557) (-529.970) * [-532.283] (-530.999) (-530.550) (-534.179) -- 0:00:20
661500 -- [-529.661] (-530.763) (-530.761) (-528.774) * (-533.117) [-530.560] (-530.453) (-532.456) -- 0:00:19
662000 -- (-531.853) (-533.760) [-532.210] (-531.228) * (-529.753) (-529.174) [-530.896] (-530.636) -- 0:00:19
662500 -- (-534.386) (-529.111) (-532.682) [-530.155] * (-531.611) [-529.972] (-530.981) (-531.684) -- 0:00:19
663000 -- [-530.681] (-534.516) (-529.536) (-532.274) * (-533.167) (-530.223) (-533.086) [-532.887] -- 0:00:19
663500 -- (-534.843) [-531.413] (-530.151) (-533.250) * (-530.826) (-532.279) (-531.560) [-532.598] -- 0:00:19
664000 -- (-530.870) (-532.944) (-531.561) [-530.060] * (-539.166) (-531.976) [-531.341] (-532.002) -- 0:00:20
664500 -- (-530.480) (-535.076) [-531.884] (-529.721) * (-528.981) [-530.999] (-529.995) (-530.752) -- 0:00:20
665000 -- [-531.027] (-531.665) (-532.920) (-529.369) * (-531.443) (-532.533) [-530.150] (-533.559) -- 0:00:20
Average standard deviation of split frequencies: 0.006040
665500 -- (-533.274) [-532.196] (-533.793) (-530.925) * (-529.035) [-531.246] (-530.508) (-532.258) -- 0:00:20
666000 -- [-530.897] (-532.808) (-533.594) (-531.156) * (-529.050) (-533.457) (-535.186) [-535.666] -- 0:00:20
666500 -- (-531.804) [-534.136] (-532.892) (-532.805) * (-530.907) (-528.987) [-530.901] (-537.606) -- 0:00:20
667000 -- (-533.516) (-530.826) [-533.869] (-532.260) * (-531.479) (-531.291) (-532.191) [-532.233] -- 0:00:19
667500 -- (-530.390) (-529.781) [-530.639] (-533.255) * (-533.433) (-528.709) [-533.016] (-533.008) -- 0:00:19
668000 -- (-531.935) (-530.215) [-530.343] (-533.310) * (-533.478) (-530.156) (-531.406) [-529.144] -- 0:00:19
668500 -- [-531.021] (-532.044) (-531.159) (-529.179) * (-529.239) (-529.357) [-529.851] (-531.565) -- 0:00:19
669000 -- (-531.739) (-535.297) (-530.439) [-528.965] * (-535.223) (-529.624) [-531.605] (-533.648) -- 0:00:19
669500 -- [-530.359] (-530.382) (-530.807) (-530.118) * (-530.777) (-533.581) (-532.633) [-530.105] -- 0:00:19
670000 -- (-532.018) (-532.692) [-529.770] (-530.125) * [-533.705] (-534.457) (-535.010) (-529.612) -- 0:00:19
Average standard deviation of split frequencies: 0.006420
670500 -- [-529.623] (-530.730) (-531.889) (-532.558) * (-529.595) [-530.335] (-536.266) (-531.395) -- 0:00:19
671000 -- (-530.305) [-529.752] (-529.196) (-529.647) * (-530.069) (-530.932) [-529.929] (-530.023) -- 0:00:19
671500 -- [-530.205] (-532.588) (-531.662) (-532.222) * [-530.488] (-529.487) (-530.055) (-529.648) -- 0:00:19
672000 -- (-530.986) (-530.655) (-534.354) [-529.569] * (-531.850) (-530.582) [-533.503] (-532.088) -- 0:00:19
672500 -- (-531.571) [-529.951] (-529.563) (-530.003) * (-529.627) (-532.602) (-532.260) [-530.127] -- 0:00:19
673000 -- (-530.873) (-531.831) [-529.041] (-531.039) * (-531.646) (-532.006) [-530.523] (-533.065) -- 0:00:19
673500 -- (-532.256) (-533.568) (-529.094) [-529.612] * (-532.912) (-532.716) [-530.775] (-531.229) -- 0:00:19
674000 -- [-531.539] (-532.787) (-529.318) (-530.028) * [-533.175] (-530.231) (-530.044) (-532.619) -- 0:00:19
674500 -- [-530.682] (-529.730) (-534.323) (-528.841) * (-529.526) (-531.626) [-531.042] (-533.988) -- 0:00:19
675000 -- (-532.067) (-530.387) (-529.735) [-532.076] * (-531.486) [-529.162] (-529.967) (-532.892) -- 0:00:19
Average standard deviation of split frequencies: 0.006183
675500 -- (-530.053) (-529.746) (-532.348) [-531.686] * (-530.055) [-530.229] (-529.924) (-529.684) -- 0:00:19
676000 -- (-533.738) [-530.953] (-534.192) (-529.488) * (-532.203) [-533.960] (-529.308) (-529.738) -- 0:00:19
676500 -- (-532.705) (-531.805) [-530.145] (-529.594) * (-540.024) (-530.138) (-530.571) [-529.776] -- 0:00:19
677000 -- (-531.082) (-531.216) [-530.778] (-530.286) * [-531.727] (-532.607) (-531.778) (-532.090) -- 0:00:19
677500 -- (-530.608) (-531.407) [-529.579] (-530.722) * (-531.291) (-532.505) (-530.723) [-529.487] -- 0:00:19
678000 -- (-529.402) (-530.817) (-531.517) [-530.053] * (-529.011) [-530.136] (-529.065) (-530.486) -- 0:00:18
678500 -- (-530.585) [-533.512] (-529.427) (-529.339) * (-531.347) (-529.704) [-530.067] (-533.866) -- 0:00:18
679000 -- (-532.994) (-536.530) (-530.256) [-530.084] * (-533.575) (-530.699) (-531.377) [-532.774] -- 0:00:18
679500 -- [-532.331] (-532.528) (-534.424) (-533.334) * (-529.333) (-531.734) (-530.676) [-530.638] -- 0:00:18
680000 -- (-530.210) (-530.148) [-530.725] (-530.262) * [-529.373] (-530.835) (-529.499) (-530.674) -- 0:00:18
Average standard deviation of split frequencies: 0.006233
680500 -- (-531.307) [-529.992] (-530.818) (-528.732) * (-530.820) (-533.912) (-529.454) [-534.856] -- 0:00:19
681000 -- (-531.185) [-531.160] (-531.736) (-529.181) * (-528.659) [-532.871] (-530.353) (-530.230) -- 0:00:19
681500 -- (-530.234) [-530.833] (-532.466) (-532.752) * (-530.424) (-531.096) [-529.944] (-529.122) -- 0:00:19
682000 -- [-533.320] (-532.049) (-534.162) (-531.281) * [-529.740] (-531.105) (-530.361) (-529.623) -- 0:00:19
682500 -- (-536.832) (-530.373) (-530.280) [-530.497] * (-528.782) [-531.510] (-533.707) (-530.652) -- 0:00:19
683000 -- (-531.053) [-533.385] (-530.866) (-532.684) * [-530.898] (-530.193) (-529.130) (-530.601) -- 0:00:19
683500 -- [-530.715] (-529.947) (-532.785) (-532.148) * [-532.716] (-531.668) (-531.768) (-533.279) -- 0:00:18
684000 -- (-531.307) (-530.626) (-531.892) [-534.653] * (-531.237) [-529.850] (-533.227) (-530.498) -- 0:00:18
684500 -- [-529.907] (-533.308) (-530.366) (-531.601) * (-530.606) [-530.154] (-531.719) (-530.725) -- 0:00:18
685000 -- (-529.938) (-532.531) (-530.834) [-531.760] * (-529.595) [-529.677] (-532.027) (-533.533) -- 0:00:18
Average standard deviation of split frequencies: 0.006047
685500 -- (-529.307) (-530.887) [-530.648] (-530.910) * (-535.666) (-534.095) (-534.731) [-535.128] -- 0:00:18
686000 -- (-530.588) (-532.864) [-531.302] (-534.708) * (-534.194) (-533.649) (-532.436) [-530.583] -- 0:00:18
686500 -- [-531.282] (-529.411) (-530.467) (-535.489) * (-532.075) (-530.330) [-535.289] (-529.764) -- 0:00:18
687000 -- [-529.751] (-532.350) (-531.824) (-530.358) * (-532.086) [-529.347] (-531.407) (-533.720) -- 0:00:18
687500 -- [-530.260] (-532.936) (-530.267) (-530.517) * (-529.831) (-530.116) (-531.435) [-540.990] -- 0:00:18
688000 -- [-531.023] (-530.983) (-531.393) (-530.967) * [-531.235] (-530.250) (-532.052) (-535.844) -- 0:00:18
688500 -- (-529.166) (-535.480) (-534.032) [-529.251] * (-530.036) (-533.270) [-532.425] (-538.029) -- 0:00:18
689000 -- (-531.584) (-530.695) [-530.840] (-529.432) * (-530.076) [-532.934] (-532.571) (-533.635) -- 0:00:18
689500 -- (-530.339) (-530.297) [-533.108] (-529.676) * (-531.204) [-532.104] (-529.535) (-529.444) -- 0:00:18
690000 -- (-531.110) (-530.096) (-533.017) [-531.319] * (-530.976) (-531.340) [-532.625] (-529.253) -- 0:00:18
Average standard deviation of split frequencies: 0.006416
690500 -- [-531.363] (-531.674) (-534.949) (-530.998) * (-530.898) (-534.087) (-529.760) [-530.269] -- 0:00:18
691000 -- (-531.397) (-530.959) [-530.413] (-530.816) * (-529.959) [-530.340] (-535.558) (-530.393) -- 0:00:18
691500 -- [-532.095] (-530.678) (-534.612) (-530.048) * [-533.147] (-531.158) (-535.951) (-531.715) -- 0:00:18
692000 -- [-530.622] (-529.905) (-534.379) (-531.062) * (-533.684) (-531.773) [-530.262] (-529.883) -- 0:00:18
692500 -- (-534.643) (-531.995) [-530.120] (-530.315) * (-531.718) [-530.577] (-530.992) (-530.639) -- 0:00:18
693000 -- (-533.708) (-529.509) (-529.516) [-530.260] * (-532.224) (-531.709) (-529.856) [-530.773] -- 0:00:18
693500 -- (-533.559) (-534.599) [-531.186] (-529.374) * (-528.896) (-531.716) [-532.752] (-529.979) -- 0:00:18
694000 -- (-530.711) [-530.988] (-530.149) (-529.997) * (-529.556) (-532.028) (-532.605) [-532.196] -- 0:00:18
694500 -- (-531.896) (-533.215) (-529.337) [-532.116] * (-530.808) (-531.230) (-531.217) [-534.261] -- 0:00:18
695000 -- (-531.083) [-530.272] (-531.183) (-530.661) * [-531.268] (-529.218) (-533.429) (-537.418) -- 0:00:17
Average standard deviation of split frequencies: 0.006186
695500 -- (-529.464) (-530.080) [-529.928] (-531.551) * [-529.788] (-531.313) (-531.767) (-535.885) -- 0:00:17
696000 -- (-530.886) (-536.762) [-529.822] (-532.141) * (-535.530) [-530.296] (-530.279) (-530.420) -- 0:00:17
696500 -- (-531.751) (-532.377) (-531.228) [-530.585] * [-534.038] (-531.408) (-531.533) (-530.700) -- 0:00:17
697000 -- [-531.365] (-534.758) (-529.415) (-530.081) * (-531.629) (-531.573) (-532.058) [-529.557] -- 0:00:17
697500 -- (-529.950) (-530.084) [-529.483] (-529.814) * [-531.816] (-530.587) (-531.364) (-529.747) -- 0:00:18
698000 -- [-532.521] (-530.546) (-534.762) (-529.312) * (-529.517) [-531.800] (-530.297) (-531.449) -- 0:00:18
698500 -- (-530.234) (-529.869) (-530.897) [-530.463] * (-533.829) [-532.564] (-528.921) (-528.728) -- 0:00:18
699000 -- (-530.365) [-529.316] (-532.413) (-531.573) * (-533.242) [-530.751] (-529.594) (-529.982) -- 0:00:18
699500 -- (-530.365) (-528.871) (-535.025) [-529.676] * (-528.919) (-534.560) [-529.354] (-529.757) -- 0:00:18
700000 -- (-531.266) (-529.035) (-535.071) [-530.396] * (-530.855) (-531.423) [-531.543] (-531.853) -- 0:00:18
Average standard deviation of split frequencies: 0.006055
700500 -- (-534.390) [-530.756] (-532.527) (-529.521) * (-531.960) (-529.838) (-530.472) [-529.831] -- 0:00:17
701000 -- (-530.236) [-531.408] (-532.382) (-532.429) * (-533.983) [-534.863] (-533.452) (-529.696) -- 0:00:17
701500 -- [-530.432] (-532.528) (-530.341) (-529.673) * [-531.851] (-532.933) (-531.347) (-530.170) -- 0:00:17
702000 -- (-530.242) (-532.229) [-530.223] (-530.068) * (-532.362) (-533.014) [-529.445] (-529.328) -- 0:00:17
702500 -- (-531.058) (-530.125) (-532.099) [-530.281] * (-533.096) (-531.841) [-528.848] (-530.804) -- 0:00:17
703000 -- (-530.240) (-529.954) [-533.387] (-528.940) * (-530.337) (-530.096) [-529.241] (-530.241) -- 0:00:17
703500 -- [-531.412] (-530.512) (-534.709) (-530.150) * [-530.038] (-534.358) (-533.633) (-533.072) -- 0:00:17
704000 -- [-533.094] (-529.542) (-533.269) (-530.606) * (-530.056) (-529.890) [-530.562] (-530.623) -- 0:00:17
704500 -- (-529.503) [-531.846] (-529.911) (-531.641) * (-531.125) (-529.296) (-534.464) [-530.085] -- 0:00:17
705000 -- (-529.202) (-532.675) [-530.857] (-529.172) * (-531.657) [-531.265] (-530.960) (-530.865) -- 0:00:17
Average standard deviation of split frequencies: 0.005609
705500 -- (-529.268) (-532.360) (-530.432) [-529.879] * (-529.933) (-531.687) [-531.028] (-530.705) -- 0:00:17
706000 -- (-529.780) (-531.506) [-531.528] (-531.838) * (-530.872) [-533.825] (-530.332) (-530.990) -- 0:00:17
706500 -- (-533.923) [-531.882] (-531.921) (-531.626) * (-530.337) (-532.167) (-531.382) [-530.843] -- 0:00:17
707000 -- [-534.356] (-534.233) (-530.919) (-535.254) * (-533.446) (-531.765) [-529.349] (-529.796) -- 0:00:17
707500 -- (-533.852) (-529.712) [-529.373] (-533.821) * (-531.528) [-530.864] (-530.300) (-529.619) -- 0:00:17
708000 -- (-530.448) [-532.724] (-531.986) (-532.533) * (-531.192) (-534.206) (-532.583) [-529.167] -- 0:00:17
708500 -- [-530.398] (-530.193) (-530.404) (-537.230) * (-530.650) (-529.906) (-532.231) [-530.843] -- 0:00:17
709000 -- (-529.579) (-530.698) (-529.336) [-530.191] * (-531.919) (-530.280) (-529.364) [-531.497] -- 0:00:17
709500 -- (-531.291) (-530.214) [-532.546] (-531.871) * (-530.887) (-531.169) (-529.024) [-532.071] -- 0:00:17
710000 -- (-532.238) (-530.499) (-532.245) [-530.600] * (-529.988) (-533.583) [-529.457] (-531.752) -- 0:00:17
Average standard deviation of split frequencies: 0.005528
710500 -- [-532.342] (-531.693) (-531.081) (-529.056) * (-536.157) (-531.469) [-531.750] (-532.402) -- 0:00:17
711000 -- (-534.009) (-538.358) (-531.202) [-532.463] * [-531.799] (-529.334) (-529.369) (-531.350) -- 0:00:17
711500 -- (-530.593) [-531.807] (-532.683) (-530.816) * (-531.500) [-529.597] (-529.824) (-531.713) -- 0:00:17
712000 -- (-530.845) (-532.130) (-534.342) [-532.256] * [-530.639] (-529.922) (-532.813) (-529.173) -- 0:00:16
712500 -- (-532.881) [-530.228] (-531.162) (-534.642) * (-529.605) (-532.303) (-531.448) [-528.667] -- 0:00:16
713000 -- [-530.237] (-532.029) (-530.034) (-533.784) * (-533.077) (-530.183) [-530.464] (-529.494) -- 0:00:16
713500 -- (-531.908) (-529.614) (-530.746) [-532.103] * (-532.641) (-530.491) [-531.995] (-533.596) -- 0:00:16
714000 -- (-532.045) (-529.155) [-530.415] (-530.172) * (-531.394) [-529.825] (-534.518) (-531.222) -- 0:00:16
714500 -- (-529.945) (-532.291) (-535.586) [-530.152] * (-530.263) (-531.171) (-537.861) [-530.911] -- 0:00:17
715000 -- (-531.362) (-530.628) (-535.411) [-529.280] * (-530.503) [-529.674] (-534.094) (-534.275) -- 0:00:17
Average standard deviation of split frequencies: 0.005443
715500 -- [-533.832] (-531.552) (-531.077) (-529.933) * (-529.144) [-531.016] (-529.254) (-529.422) -- 0:00:17
716000 -- (-530.556) (-532.327) [-530.897] (-530.169) * (-533.621) (-533.167) (-529.721) [-535.766] -- 0:00:17
716500 -- (-530.226) [-531.627] (-531.741) (-533.438) * (-531.387) (-529.889) [-529.432] (-541.004) -- 0:00:17
717000 -- (-532.861) (-531.974) [-532.551] (-530.306) * [-530.263] (-529.673) (-529.759) (-530.078) -- 0:00:16
717500 -- (-537.266) [-532.737] (-536.205) (-529.089) * (-533.478) (-532.724) (-529.258) [-530.409] -- 0:00:16
718000 -- (-532.722) (-533.964) (-531.229) [-531.097] * (-530.737) (-531.330) [-529.455] (-532.668) -- 0:00:16
718500 -- (-531.178) (-529.677) (-531.580) [-532.121] * (-538.194) [-532.039] (-535.339) (-531.514) -- 0:00:16
719000 -- (-533.030) [-529.535] (-531.321) (-528.608) * (-532.073) (-531.832) (-533.276) [-532.017] -- 0:00:16
719500 -- (-530.786) (-531.474) [-529.031] (-530.801) * [-530.215] (-529.238) (-531.851) (-531.272) -- 0:00:16
720000 -- (-530.590) (-531.913) (-531.452) [-530.077] * (-533.370) (-530.766) (-534.272) [-531.634] -- 0:00:16
Average standard deviation of split frequencies: 0.005931
720500 -- [-531.279] (-530.515) (-531.389) (-531.366) * (-533.716) (-532.633) [-531.494] (-535.885) -- 0:00:16
721000 -- (-533.871) (-530.236) (-528.820) [-532.224] * [-532.294] (-530.253) (-530.946) (-532.435) -- 0:00:16
721500 -- (-531.387) (-530.685) (-531.618) [-530.574] * [-532.285] (-529.460) (-535.186) (-528.906) -- 0:00:16
722000 -- [-530.316] (-529.976) (-530.598) (-532.323) * (-529.660) (-530.237) (-534.778) [-529.145] -- 0:00:16
722500 -- (-533.425) (-530.032) [-530.096] (-532.913) * [-532.979] (-533.298) (-530.629) (-530.025) -- 0:00:16
723000 -- (-530.501) (-530.185) [-530.175] (-531.702) * [-531.529] (-531.750) (-533.637) (-533.976) -- 0:00:16
723500 -- (-534.414) (-530.145) (-529.225) [-534.983] * (-533.453) [-533.107] (-535.557) (-531.792) -- 0:00:16
724000 -- (-532.757) (-531.088) (-530.384) [-533.987] * (-530.983) (-530.785) [-531.247] (-534.591) -- 0:00:16
724500 -- (-533.065) (-529.952) [-531.220] (-528.700) * (-534.369) [-533.161] (-531.242) (-532.024) -- 0:00:16
725000 -- (-529.917) [-529.508] (-530.703) (-529.315) * [-535.825] (-531.946) (-531.782) (-532.298) -- 0:00:16
Average standard deviation of split frequencies: 0.005671
725500 -- (-529.781) (-530.177) (-530.578) [-531.214] * (-531.958) (-530.020) (-530.058) [-531.083] -- 0:00:16
726000 -- [-530.632] (-532.050) (-530.393) (-529.766) * [-530.273] (-531.030) (-530.146) (-530.072) -- 0:00:16
726500 -- (-529.316) (-529.708) [-531.899] (-532.750) * (-530.766) (-532.378) [-528.976] (-529.348) -- 0:00:16
727000 -- [-530.363] (-532.903) (-529.134) (-534.671) * [-529.778] (-530.778) (-531.614) (-529.692) -- 0:00:16
727500 -- [-531.094] (-533.201) (-530.326) (-535.068) * (-532.274) (-531.998) [-533.258] (-531.347) -- 0:00:16
728000 -- (-530.820) [-529.976] (-531.731) (-530.280) * (-533.981) (-529.395) [-529.933] (-534.766) -- 0:00:16
728500 -- (-529.433) (-529.739) [-530.475] (-530.441) * (-532.390) (-530.028) [-531.233] (-529.812) -- 0:00:16
729000 -- (-529.297) (-528.854) [-529.185] (-529.061) * (-530.122) [-531.322] (-529.888) (-533.269) -- 0:00:15
729500 -- (-533.354) (-529.939) [-530.175] (-528.883) * (-530.336) [-530.286] (-532.521) (-533.116) -- 0:00:15
730000 -- (-530.450) [-529.993] (-529.578) (-531.518) * [-529.547] (-530.319) (-531.247) (-530.260) -- 0:00:15
Average standard deviation of split frequencies: 0.006022
730500 -- (-530.632) (-530.091) [-529.082] (-529.995) * (-531.898) (-530.189) [-529.358] (-530.438) -- 0:00:15
731000 -- (-535.571) (-530.351) (-529.065) [-531.409] * [-528.984] (-531.461) (-529.398) (-534.181) -- 0:00:16
731500 -- (-533.566) [-529.751] (-529.396) (-532.673) * (-530.775) [-530.565] (-530.650) (-540.835) -- 0:00:16
732000 -- (-533.802) (-530.840) [-534.266] (-532.583) * [-531.349] (-530.906) (-532.905) (-530.691) -- 0:00:16
732500 -- (-530.180) (-530.344) [-529.869] (-534.292) * (-529.349) (-531.037) (-530.031) [-533.027] -- 0:00:16
733000 -- [-530.956] (-530.757) (-535.545) (-536.463) * (-531.537) [-529.555] (-528.842) (-536.206) -- 0:00:16
733500 -- (-530.829) (-533.007) (-534.108) [-533.259] * (-530.411) (-531.943) [-529.723] (-531.252) -- 0:00:15
734000 -- [-530.523] (-532.883) (-530.137) (-534.673) * [-531.764] (-530.996) (-532.204) (-530.092) -- 0:00:15
734500 -- [-529.896] (-530.244) (-535.261) (-534.734) * (-530.531) (-533.567) (-532.536) [-530.728] -- 0:00:15
735000 -- (-531.817) (-532.194) (-529.368) [-531.556] * (-530.205) [-530.156] (-534.696) (-531.255) -- 0:00:15
Average standard deviation of split frequencies: 0.005594
735500 -- (-532.157) [-529.112] (-530.973) (-529.312) * [-529.965] (-531.167) (-532.815) (-529.367) -- 0:00:15
736000 -- [-530.065] (-531.575) (-537.076) (-530.664) * (-529.867) [-529.459] (-532.096) (-529.173) -- 0:00:15
736500 -- (-531.087) (-531.067) (-529.379) [-531.073] * (-530.779) [-529.924] (-529.476) (-532.231) -- 0:00:15
737000 -- (-531.646) (-531.892) (-531.185) [-529.957] * [-530.572] (-529.220) (-531.439) (-531.043) -- 0:00:15
737500 -- [-530.772] (-532.718) (-530.838) (-530.383) * (-530.638) [-528.710] (-532.419) (-530.330) -- 0:00:15
738000 -- [-531.024] (-533.370) (-531.926) (-529.583) * (-530.218) [-531.994] (-533.879) (-531.829) -- 0:00:15
738500 -- (-530.234) [-534.132] (-535.801) (-530.962) * (-532.447) (-530.077) [-532.407] (-532.979) -- 0:00:15
739000 -- [-534.139] (-531.906) (-531.091) (-531.391) * (-529.832) (-534.702) (-532.283) [-530.936] -- 0:00:15
739500 -- (-529.373) [-529.522] (-531.373) (-532.148) * (-533.931) (-530.661) [-530.218] (-529.773) -- 0:00:15
740000 -- (-529.773) (-530.001) (-529.238) [-530.084] * (-532.085) (-528.912) [-532.007] (-529.771) -- 0:00:15
Average standard deviation of split frequencies: 0.005940
740500 -- [-530.385] (-529.156) (-531.121) (-531.472) * [-529.939] (-530.444) (-530.364) (-530.459) -- 0:00:15
741000 -- (-536.338) (-528.954) [-530.259] (-531.667) * (-531.701) (-529.731) [-529.018] (-531.311) -- 0:00:15
741500 -- (-531.756) [-528.623] (-528.684) (-528.823) * [-528.700] (-533.392) (-530.963) (-530.599) -- 0:00:15
742000 -- (-535.693) (-528.556) (-530.766) [-530.378] * [-530.636] (-531.004) (-529.206) (-530.602) -- 0:00:15
742500 -- [-531.324] (-532.731) (-529.824) (-536.742) * (-532.870) [-531.415] (-532.045) (-531.644) -- 0:00:15
743000 -- [-530.376] (-531.351) (-528.743) (-531.819) * (-533.387) (-531.796) [-531.165] (-531.268) -- 0:00:15
743500 -- (-530.815) [-530.148] (-528.991) (-529.258) * (-531.115) (-530.361) (-531.456) [-530.784] -- 0:00:15
744000 -- (-531.436) [-529.682] (-531.220) (-531.477) * (-530.016) [-530.658] (-531.742) (-533.152) -- 0:00:15
744500 -- (-530.207) [-530.005] (-532.023) (-531.642) * (-529.585) (-529.369) [-534.600] (-528.912) -- 0:00:15
745000 -- [-531.475] (-531.871) (-531.228) (-535.165) * [-530.863] (-530.576) (-529.828) (-533.343) -- 0:00:15
Average standard deviation of split frequencies: 0.005729
745500 -- (-533.494) [-529.851] (-533.553) (-531.143) * [-531.507] (-532.918) (-529.286) (-532.973) -- 0:00:15
746000 -- [-528.518] (-530.688) (-532.009) (-529.691) * (-532.272) [-531.283] (-530.760) (-529.803) -- 0:00:14
746500 -- (-530.183) (-533.068) (-529.167) [-530.529] * (-529.456) [-530.519] (-530.855) (-530.013) -- 0:00:14
747000 -- [-529.517] (-530.057) (-529.918) (-529.923) * [-533.214] (-531.905) (-533.849) (-530.755) -- 0:00:14
747500 -- (-532.298) [-530.897] (-530.019) (-534.286) * (-534.745) (-530.430) (-532.971) [-529.495] -- 0:00:14
748000 -- (-529.874) (-529.351) [-532.443] (-529.534) * (-533.598) [-530.347] (-530.219) (-529.783) -- 0:00:15
748500 -- [-530.000] (-529.261) (-530.927) (-532.873) * (-530.782) (-529.833) (-531.095) [-531.036] -- 0:00:15
749000 -- [-530.885] (-530.086) (-532.159) (-530.657) * (-532.983) (-529.716) [-529.190] (-529.379) -- 0:00:15
749500 -- [-529.957] (-531.332) (-530.079) (-531.507) * (-532.406) (-535.515) (-534.095) [-529.168] -- 0:00:15
750000 -- [-533.994] (-530.446) (-531.172) (-532.113) * (-531.039) [-530.240] (-536.071) (-531.309) -- 0:00:15
Average standard deviation of split frequencies: 0.005443
750500 -- (-531.331) (-529.302) (-529.697) [-532.173] * (-531.088) [-532.622] (-530.102) (-529.809) -- 0:00:14
751000 -- (-528.820) (-530.926) (-529.263) [-530.999] * (-532.981) [-532.949] (-530.995) (-529.647) -- 0:00:14
751500 -- (-530.654) (-532.017) [-529.644] (-529.557) * (-530.538) [-529.179] (-530.367) (-536.863) -- 0:00:14
752000 -- (-530.003) [-535.477] (-528.776) (-531.032) * [-530.471] (-530.027) (-530.447) (-536.860) -- 0:00:14
752500 -- (-530.083) (-531.991) [-531.186] (-533.162) * (-533.042) [-530.819] (-534.417) (-533.411) -- 0:00:14
753000 -- (-535.195) (-531.007) (-531.345) [-532.647] * (-530.349) (-532.218) (-530.766) [-530.228] -- 0:00:14
753500 -- (-529.457) [-529.425] (-535.675) (-529.826) * (-531.438) [-530.034] (-531.180) (-531.214) -- 0:00:14
754000 -- (-532.744) [-529.939] (-531.244) (-530.845) * (-531.144) [-531.351] (-530.382) (-532.786) -- 0:00:14
754500 -- (-529.454) [-530.554] (-536.838) (-531.145) * (-532.506) [-533.194] (-532.813) (-532.337) -- 0:00:14
755000 -- (-529.003) (-532.898) (-534.307) [-532.686] * (-533.958) (-532.277) (-530.064) [-533.396] -- 0:00:14
Average standard deviation of split frequencies: 0.005446
755500 -- (-529.283) [-532.607] (-530.925) (-529.958) * (-529.850) [-528.828] (-531.053) (-530.880) -- 0:00:14
756000 -- [-529.148] (-529.990) (-531.089) (-530.741) * (-530.574) (-529.298) (-531.695) [-531.733] -- 0:00:14
756500 -- (-530.012) [-534.849] (-529.893) (-532.574) * (-529.449) (-530.050) (-532.182) [-530.096] -- 0:00:14
757000 -- [-532.724] (-528.726) (-531.448) (-529.568) * [-532.585] (-532.586) (-533.108) (-532.968) -- 0:00:14
757500 -- [-531.454] (-531.626) (-528.604) (-535.449) * (-534.066) [-533.394] (-529.361) (-529.055) -- 0:00:14
758000 -- (-530.016) (-529.717) (-529.600) [-535.709] * [-531.790] (-531.585) (-531.564) (-531.372) -- 0:00:14
758500 -- (-530.558) (-530.047) [-530.741] (-532.098) * [-530.480] (-532.444) (-529.036) (-530.063) -- 0:00:14
759000 -- [-529.821] (-530.425) (-535.514) (-530.684) * (-530.226) (-532.112) (-530.113) [-531.133] -- 0:00:14
759500 -- (-529.792) (-530.773) [-531.064] (-529.464) * (-531.891) (-531.538) (-530.694) [-531.634] -- 0:00:14
760000 -- [-532.022] (-529.454) (-531.661) (-530.508) * (-530.613) [-534.100] (-529.704) (-531.715) -- 0:00:14
Average standard deviation of split frequencies: 0.005495
760500 -- (-530.161) (-528.811) [-529.484] (-529.706) * (-531.650) (-530.618) [-529.433] (-532.728) -- 0:00:14
761000 -- (-530.497) [-529.422] (-529.959) (-529.566) * (-528.920) (-531.943) (-529.695) [-529.748] -- 0:00:14
761500 -- (-529.170) (-529.317) (-532.714) [-530.637] * (-530.909) (-533.007) [-532.004] (-530.822) -- 0:00:14
762000 -- [-531.689] (-530.585) (-531.314) (-531.929) * (-530.984) (-531.150) (-533.019) [-530.887] -- 0:00:14
762500 -- (-531.596) [-529.937] (-530.604) (-529.288) * (-530.987) [-531.078] (-532.913) (-529.260) -- 0:00:14
763000 -- (-529.776) (-533.094) (-534.473) [-529.696] * (-532.322) [-533.044] (-532.543) (-528.669) -- 0:00:13
763500 -- (-532.296) (-530.130) [-534.534] (-529.260) * (-531.245) (-533.347) (-530.002) [-529.412] -- 0:00:13
764000 -- (-532.351) (-531.346) (-530.493) [-530.281] * (-530.027) (-532.336) (-533.280) [-530.593] -- 0:00:13
764500 -- [-531.217] (-530.211) (-530.477) (-533.301) * (-529.003) (-532.949) [-532.981] (-535.635) -- 0:00:13
765000 -- [-530.489] (-533.690) (-533.100) (-530.528) * (-530.318) (-531.932) [-532.108] (-529.616) -- 0:00:13
Average standard deviation of split frequencies: 0.005416
765500 -- [-528.821] (-533.461) (-532.147) (-531.153) * (-532.824) [-531.311] (-530.659) (-531.930) -- 0:00:14
766000 -- (-531.042) (-534.106) (-533.185) [-530.398] * (-531.987) (-532.262) (-534.005) [-529.577] -- 0:00:14
766500 -- (-529.648) (-530.536) [-529.416] (-532.366) * (-529.784) [-531.258] (-533.177) (-530.265) -- 0:00:14
767000 -- [-531.136] (-528.999) (-530.838) (-530.465) * (-530.706) [-529.804] (-532.113) (-531.268) -- 0:00:13
767500 -- (-528.765) (-530.999) [-529.757] (-529.340) * (-535.592) (-530.115) [-529.987] (-531.741) -- 0:00:13
768000 -- (-531.653) [-529.170] (-532.105) (-529.849) * [-533.728] (-530.697) (-530.498) (-531.448) -- 0:00:13
768500 -- (-533.241) (-532.240) [-530.322] (-530.850) * (-530.276) [-529.594] (-536.354) (-529.464) -- 0:00:13
769000 -- (-529.530) (-528.764) [-529.972] (-530.750) * [-530.511] (-530.800) (-532.909) (-529.529) -- 0:00:13
769500 -- (-530.219) [-531.002] (-531.520) (-539.308) * (-531.030) (-533.229) [-530.338] (-529.947) -- 0:00:13
770000 -- [-529.260] (-530.641) (-531.049) (-529.746) * (-531.513) [-528.809] (-533.715) (-530.932) -- 0:00:13
Average standard deviation of split frequencies: 0.005505
770500 -- (-531.991) (-537.373) [-530.609] (-532.121) * [-529.280] (-528.978) (-531.421) (-529.340) -- 0:00:13
771000 -- (-531.938) (-530.296) (-531.842) [-531.597] * (-529.356) (-529.961) [-532.398] (-531.345) -- 0:00:13
771500 -- (-529.560) (-531.768) [-530.689] (-530.201) * (-537.509) (-531.423) [-533.405] (-535.201) -- 0:00:13
772000 -- (-534.700) [-534.538] (-529.812) (-530.047) * [-533.229] (-532.026) (-532.126) (-531.044) -- 0:00:13
772500 -- (-530.199) (-530.023) [-531.273] (-529.595) * (-533.299) (-530.367) [-530.951] (-531.971) -- 0:00:13
773000 -- (-531.143) (-533.398) (-529.300) [-530.911] * [-529.739] (-532.452) (-532.093) (-532.069) -- 0:00:13
773500 -- (-530.619) [-532.944] (-529.920) (-532.242) * (-528.807) (-530.649) [-530.443] (-532.189) -- 0:00:13
774000 -- (-529.681) (-531.593) [-530.679] (-531.237) * (-530.916) (-529.640) (-533.020) [-529.724] -- 0:00:13
774500 -- (-531.253) [-529.444] (-529.899) (-532.607) * (-529.449) [-529.681] (-528.821) (-529.433) -- 0:00:13
775000 -- [-529.802] (-531.110) (-530.957) (-530.769) * (-529.780) (-530.223) (-531.102) [-529.849] -- 0:00:13
Average standard deviation of split frequencies: 0.005629
775500 -- (-530.169) (-530.330) [-532.408] (-531.726) * (-533.091) [-529.625] (-530.046) (-530.565) -- 0:00:13
776000 -- [-532.130] (-528.861) (-530.908) (-531.135) * (-531.933) (-531.385) [-530.052] (-529.209) -- 0:00:13
776500 -- (-531.166) (-530.915) [-531.858] (-530.468) * [-529.484] (-530.407) (-531.937) (-531.300) -- 0:00:13
777000 -- [-531.951] (-531.504) (-531.244) (-530.148) * (-529.632) (-529.912) [-530.856] (-531.795) -- 0:00:13
777500 -- [-532.981] (-529.597) (-534.682) (-530.054) * (-530.076) (-529.513) [-530.037] (-536.100) -- 0:00:13
778000 -- (-531.289) (-533.227) (-533.398) [-530.122] * [-528.974] (-529.892) (-532.339) (-542.277) -- 0:00:13
778500 -- (-529.963) (-530.421) [-531.230] (-529.227) * (-531.721) (-530.299) [-531.617] (-530.493) -- 0:00:13
779000 -- (-532.568) [-529.565] (-530.981) (-532.317) * (-531.279) [-532.802] (-529.416) (-531.070) -- 0:00:13
779500 -- (-532.971) (-531.905) (-534.184) [-529.722] * (-530.717) (-530.504) (-529.650) [-532.738] -- 0:00:13
780000 -- [-534.475] (-530.219) (-529.662) (-530.391) * (-528.942) [-528.696] (-531.355) (-529.648) -- 0:00:12
Average standard deviation of split frequencies: 0.005394
780500 -- [-533.148] (-530.995) (-530.097) (-529.896) * (-531.572) (-528.717) (-529.953) [-531.994] -- 0:00:12
781000 -- (-531.816) (-533.147) (-530.846) [-536.791] * (-530.567) (-531.623) (-530.059) [-531.351] -- 0:00:12
781500 -- [-530.515] (-534.064) (-530.293) (-531.734) * (-529.566) (-530.771) [-530.172] (-529.882) -- 0:00:12
782000 -- [-530.400] (-529.441) (-530.708) (-529.309) * (-532.174) [-530.157] (-530.787) (-530.362) -- 0:00:12
782500 -- [-532.846] (-532.406) (-528.999) (-531.779) * (-530.197) (-528.899) [-529.927] (-530.796) -- 0:00:13
783000 -- [-532.774] (-531.637) (-534.573) (-529.193) * [-529.450] (-529.789) (-528.841) (-531.171) -- 0:00:13
783500 -- (-534.825) (-532.896) (-530.352) [-529.671] * (-531.996) [-529.998] (-532.160) (-530.630) -- 0:00:12
784000 -- [-536.531] (-533.469) (-531.127) (-536.685) * (-530.130) [-531.822] (-533.459) (-536.415) -- 0:00:12
784500 -- (-529.071) (-535.920) [-531.107] (-532.463) * [-532.404] (-533.314) (-530.734) (-532.620) -- 0:00:12
785000 -- (-529.042) (-531.468) (-530.108) [-531.228] * [-530.441] (-533.670) (-532.486) (-531.967) -- 0:00:12
Average standard deviation of split frequencies: 0.005398
785500 -- (-533.768) [-532.121] (-530.238) (-531.651) * [-530.045] (-536.544) (-534.299) (-531.381) -- 0:00:12
786000 -- (-534.721) (-531.088) [-529.543] (-532.629) * (-529.166) [-528.807] (-529.651) (-530.556) -- 0:00:12
786500 -- (-529.382) (-530.826) [-529.622] (-529.531) * (-531.566) (-530.248) [-530.437] (-529.907) -- 0:00:12
787000 -- (-529.494) (-532.493) [-532.938] (-530.206) * (-532.541) (-533.350) [-532.608] (-530.846) -- 0:00:12
787500 -- (-530.254) [-530.574] (-529.886) (-530.280) * (-530.543) (-532.407) [-529.665] (-530.704) -- 0:00:12
788000 -- (-534.322) [-531.883] (-530.825) (-530.919) * (-531.575) (-530.359) [-528.882] (-533.250) -- 0:00:12
788500 -- (-531.534) (-531.639) (-532.705) [-531.680] * [-530.139] (-529.854) (-530.085) (-531.468) -- 0:00:12
789000 -- (-529.722) (-534.408) [-530.346] (-531.908) * (-533.395) [-531.432] (-530.959) (-531.882) -- 0:00:12
789500 -- (-530.143) (-532.581) (-531.205) [-529.679] * [-531.714] (-533.375) (-531.131) (-530.349) -- 0:00:12
790000 -- [-531.919] (-529.516) (-532.473) (-529.940) * (-535.025) (-531.025) [-529.963] (-532.204) -- 0:00:12
Average standard deviation of split frequencies: 0.005326
790500 -- (-529.987) [-531.482] (-530.185) (-534.762) * (-537.831) (-530.725) (-535.092) [-534.732] -- 0:00:12
791000 -- (-530.806) (-529.986) [-533.744] (-530.105) * (-532.764) (-533.260) (-535.071) [-531.382] -- 0:00:12
791500 -- (-532.346) (-529.242) (-534.942) [-531.331] * (-533.601) (-531.370) [-534.486] (-534.481) -- 0:00:12
792000 -- (-531.393) [-529.811] (-528.951) (-529.188) * (-531.077) (-532.715) (-531.320) [-530.044] -- 0:00:12
792500 -- (-529.749) (-529.637) (-533.651) [-530.386] * [-529.127] (-532.886) (-534.124) (-530.927) -- 0:00:12
793000 -- (-529.647) [-530.892] (-530.957) (-533.597) * (-534.157) [-533.722] (-530.353) (-531.189) -- 0:00:12
793500 -- (-531.071) [-528.805] (-529.095) (-532.652) * [-535.859] (-532.790) (-534.668) (-528.898) -- 0:00:12
794000 -- (-531.198) [-529.211] (-529.794) (-532.454) * (-533.723) [-529.558] (-531.192) (-528.568) -- 0:00:12
794500 -- (-529.355) (-530.425) (-531.215) [-529.822] * (-533.172) (-530.341) (-532.166) [-528.582] -- 0:00:12
795000 -- (-532.035) (-533.864) (-530.780) [-530.040] * [-532.862] (-529.210) (-532.767) (-529.515) -- 0:00:12
Average standard deviation of split frequencies: 0.005764
795500 -- (-530.841) (-530.107) (-528.924) [-530.049] * (-529.638) (-529.731) [-530.772] (-533.702) -- 0:00:12
796000 -- [-530.874] (-537.351) (-530.160) (-531.252) * [-530.488] (-531.557) (-530.609) (-529.995) -- 0:00:12
796500 -- (-531.148) (-532.477) (-529.949) [-530.966] * (-532.467) [-531.216] (-529.765) (-531.282) -- 0:00:12
797000 -- (-530.402) (-533.900) [-530.464] (-529.468) * (-531.591) [-533.063] (-529.670) (-529.499) -- 0:00:11
797500 -- (-531.160) (-529.281) [-530.680] (-531.330) * (-531.486) (-530.191) [-532.227] (-528.817) -- 0:00:11
798000 -- (-534.008) (-528.981) (-530.405) [-530.559] * [-528.989] (-532.639) (-530.778) (-530.291) -- 0:00:11
798500 -- (-532.046) [-531.687] (-531.382) (-530.031) * (-531.822) (-532.418) [-528.919] (-535.949) -- 0:00:11
799000 -- (-530.971) (-534.186) (-530.463) [-529.864] * (-530.849) [-533.689] (-529.418) (-534.168) -- 0:00:12
799500 -- [-529.003] (-533.003) (-530.775) (-530.223) * (-531.143) (-530.158) [-529.889] (-534.523) -- 0:00:12
800000 -- (-529.057) (-532.996) (-530.835) [-530.468] * (-532.738) (-530.261) (-529.714) [-529.459] -- 0:00:12
Average standard deviation of split frequencies: 0.005809
800500 -- [-529.344] (-531.825) (-531.096) (-531.576) * [-532.508] (-530.384) (-530.388) (-529.429) -- 0:00:11
801000 -- (-530.123) (-529.469) (-531.484) [-528.947] * (-529.244) (-532.055) (-531.317) [-530.731] -- 0:00:11
801500 -- (-528.939) (-531.363) [-529.196] (-529.063) * (-531.944) [-531.201] (-531.607) (-534.539) -- 0:00:11
802000 -- (-529.939) [-529.782] (-532.071) (-532.325) * (-532.540) (-532.327) (-531.615) [-533.202] -- 0:00:11
802500 -- [-529.225] (-529.802) (-529.128) (-532.613) * (-531.638) (-530.922) (-533.293) [-529.836] -- 0:00:11
803000 -- (-529.466) (-533.982) (-531.744) [-530.914] * (-532.438) [-528.684] (-531.340) (-528.830) -- 0:00:11
803500 -- (-531.029) (-532.715) [-529.852] (-536.407) * (-529.580) [-531.440] (-530.603) (-530.737) -- 0:00:11
804000 -- (-532.882) [-532.255] (-529.278) (-531.835) * (-531.958) (-532.702) [-530.400] (-530.332) -- 0:00:11
804500 -- (-530.409) (-530.632) (-528.761) [-531.594] * (-529.188) (-533.430) [-529.977] (-530.189) -- 0:00:11
805000 -- [-531.323] (-529.740) (-530.963) (-529.965) * (-530.248) [-531.575] (-531.642) (-532.208) -- 0:00:11
Average standard deviation of split frequencies: 0.005810
805500 -- (-530.627) (-530.888) (-536.346) [-529.746] * (-531.938) (-534.185) [-530.098] (-529.368) -- 0:00:11
806000 -- (-535.620) (-531.886) [-529.574] (-533.485) * (-529.342) (-531.211) (-530.247) [-530.019] -- 0:00:11
806500 -- (-532.298) (-530.600) (-531.587) [-531.931] * (-530.476) [-529.133] (-529.484) (-531.530) -- 0:00:11
807000 -- [-530.421] (-532.053) (-529.711) (-533.482) * (-529.981) (-529.065) [-528.988] (-531.806) -- 0:00:11
807500 -- (-532.992) (-532.712) (-529.251) [-532.361] * [-531.104] (-530.711) (-530.723) (-532.199) -- 0:00:11
808000 -- (-530.595) (-532.170) [-528.772] (-531.642) * (-533.727) (-528.983) [-531.198] (-532.199) -- 0:00:11
808500 -- (-535.487) [-531.318] (-531.560) (-530.895) * (-531.651) (-530.823) [-531.486] (-529.652) -- 0:00:11
809000 -- [-538.570] (-530.690) (-531.803) (-532.475) * (-536.110) (-533.672) (-530.822) [-531.027] -- 0:00:11
809500 -- (-536.182) (-530.631) [-531.914] (-533.695) * (-531.416) (-530.556) [-530.568] (-531.214) -- 0:00:11
810000 -- (-531.115) [-532.430] (-530.577) (-534.768) * [-532.850] (-530.719) (-530.774) (-530.407) -- 0:00:11
Average standard deviation of split frequencies: 0.005660
810500 -- (-532.255) (-529.989) [-531.460] (-531.850) * [-531.822] (-532.090) (-530.473) (-530.701) -- 0:00:11
811000 -- [-530.098] (-532.335) (-531.870) (-531.883) * (-532.326) (-530.835) [-529.072] (-532.998) -- 0:00:11
811500 -- (-529.757) (-529.429) [-530.037] (-533.371) * (-535.514) (-530.509) [-529.712] (-530.061) -- 0:00:11
812000 -- (-532.860) (-530.564) [-530.118] (-532.093) * (-533.670) [-529.120] (-532.291) (-531.281) -- 0:00:11
812500 -- [-530.296] (-532.173) (-530.982) (-535.758) * (-533.102) [-531.235] (-532.263) (-532.436) -- 0:00:11
813000 -- [-529.395] (-530.901) (-530.415) (-532.301) * (-534.174) [-529.958] (-529.620) (-532.820) -- 0:00:11
813500 -- (-532.445) [-533.359] (-531.665) (-531.239) * [-532.024] (-529.874) (-530.160) (-533.609) -- 0:00:11
814000 -- (-533.765) [-534.722] (-532.869) (-531.166) * (-532.105) (-531.893) (-531.290) [-529.366] -- 0:00:10
814500 -- (-529.062) (-530.970) [-532.892] (-536.500) * [-530.695] (-528.710) (-530.733) (-530.069) -- 0:00:10
815000 -- (-530.082) (-533.805) (-530.700) [-531.265] * (-530.694) [-529.673] (-530.309) (-529.570) -- 0:00:10
Average standard deviation of split frequencies: 0.006008
815500 -- (-529.735) (-530.467) (-531.749) [-530.709] * [-530.665] (-532.123) (-532.213) (-532.216) -- 0:00:10
816000 -- (-529.720) (-533.423) [-530.898] (-533.997) * (-529.967) (-530.035) [-530.966] (-531.521) -- 0:00:11
816500 -- [-533.263] (-530.985) (-530.469) (-531.732) * (-533.635) [-532.778] (-532.598) (-530.663) -- 0:00:11
817000 -- (-532.435) (-529.057) (-529.829) [-531.563] * (-530.654) [-533.278] (-533.055) (-531.682) -- 0:00:10
817500 -- (-532.199) [-530.875] (-529.332) (-533.470) * (-530.080) [-529.991] (-530.257) (-529.679) -- 0:00:10
818000 -- [-530.481] (-532.584) (-531.121) (-530.507) * (-530.199) (-532.809) [-530.260] (-532.281) -- 0:00:10
818500 -- (-529.782) (-530.275) [-531.894] (-530.502) * (-530.488) (-529.479) [-531.365] (-529.865) -- 0:00:10
819000 -- (-530.136) (-533.500) [-530.991] (-529.474) * [-530.632] (-529.921) (-530.044) (-531.606) -- 0:00:10
819500 -- (-530.206) [-530.121] (-531.496) (-534.473) * (-532.885) (-532.626) [-530.691] (-529.687) -- 0:00:10
820000 -- (-532.930) [-529.921] (-529.566) (-529.749) * (-533.022) [-531.850] (-528.719) (-529.608) -- 0:00:10
Average standard deviation of split frequencies: 0.005782
820500 -- (-532.603) (-529.948) (-533.652) [-530.268] * [-531.358] (-530.635) (-533.650) (-529.644) -- 0:00:10
821000 -- (-535.033) (-533.720) [-531.209] (-529.318) * (-529.131) [-531.799] (-529.674) (-529.645) -- 0:00:10
821500 -- (-532.456) (-531.158) (-530.044) [-534.632] * (-530.317) (-534.480) (-529.279) [-529.556] -- 0:00:10
822000 -- (-529.945) (-531.467) [-528.745] (-530.356) * [-532.370] (-535.486) (-530.405) (-530.718) -- 0:00:10
822500 -- [-534.444] (-529.747) (-528.871) (-531.125) * [-534.200] (-535.436) (-532.685) (-532.605) -- 0:00:10
823000 -- (-530.235) (-533.934) [-529.433] (-531.814) * (-530.242) [-531.115] (-539.072) (-530.493) -- 0:00:10
823500 -- [-528.734] (-532.042) (-531.498) (-535.406) * [-529.922] (-530.561) (-538.377) (-532.554) -- 0:00:10
824000 -- (-535.152) (-530.978) [-531.720] (-533.925) * (-531.523) (-532.439) [-530.256] (-532.126) -- 0:00:10
824500 -- (-532.852) (-531.221) (-532.912) [-532.062] * [-531.956] (-534.618) (-530.900) (-530.763) -- 0:00:10
825000 -- (-529.763) [-530.926] (-529.815) (-532.928) * (-529.616) [-530.517] (-534.439) (-535.022) -- 0:00:10
Average standard deviation of split frequencies: 0.006011
825500 -- (-529.720) [-529.800] (-529.574) (-530.951) * (-530.323) (-530.417) [-530.308] (-532.674) -- 0:00:10
826000 -- [-532.531] (-533.574) (-531.960) (-531.526) * (-531.700) [-530.075] (-533.772) (-532.957) -- 0:00:10
826500 -- (-536.175) [-529.553] (-532.173) (-530.044) * [-532.200] (-529.735) (-532.847) (-530.760) -- 0:00:10
827000 -- (-532.966) [-528.968] (-533.185) (-530.896) * (-534.070) (-531.448) [-534.105] (-530.453) -- 0:00:10
827500 -- (-529.967) (-531.143) (-530.635) [-530.707] * (-532.809) (-532.520) (-534.306) [-541.974] -- 0:00:10
828000 -- (-530.197) (-531.816) [-530.258] (-530.233) * (-530.487) (-528.739) [-531.292] (-531.795) -- 0:00:10
828500 -- [-529.603] (-535.217) (-529.653) (-531.918) * (-531.235) [-529.970] (-532.530) (-533.236) -- 0:00:10
829000 -- [-530.789] (-530.567) (-532.424) (-533.719) * (-529.758) (-530.553) [-533.585] (-531.512) -- 0:00:10
829500 -- (-535.656) (-529.360) (-534.116) [-529.340] * (-533.187) (-529.999) (-530.107) [-530.387] -- 0:00:10
830000 -- (-531.815) (-532.555) (-534.093) [-528.713] * (-529.814) (-529.608) (-528.689) [-531.246] -- 0:00:10
Average standard deviation of split frequencies: 0.006280
830500 -- (-535.064) [-531.408] (-530.690) (-531.946) * (-530.035) [-530.620] (-528.761) (-531.583) -- 0:00:10
831000 -- (-529.013) (-532.485) (-533.296) [-529.294] * (-531.319) (-530.635) [-528.830] (-533.607) -- 0:00:09
831500 -- (-531.309) (-533.166) [-529.187] (-529.571) * (-539.551) (-535.852) (-529.367) [-530.945] -- 0:00:09
832000 -- (-534.171) [-532.254] (-529.053) (-530.701) * (-536.773) [-530.172] (-530.530) (-534.505) -- 0:00:09
832500 -- (-531.174) (-532.519) [-531.801] (-530.681) * (-531.277) (-530.836) (-531.812) [-530.878] -- 0:00:09
833000 -- (-530.915) (-530.743) [-535.126] (-534.074) * (-532.475) (-534.431) [-531.564] (-531.765) -- 0:00:10
833500 -- (-529.849) (-530.850) (-529.865) [-529.971] * (-529.005) (-530.908) [-531.403] (-529.315) -- 0:00:09
834000 -- [-530.364] (-529.645) (-533.301) (-531.102) * [-529.027] (-530.377) (-531.506) (-532.314) -- 0:00:09
834500 -- (-529.423) (-533.245) (-531.654) [-530.648] * [-530.461] (-531.150) (-532.606) (-529.266) -- 0:00:09
835000 -- (-529.235) (-531.300) [-530.539] (-531.580) * [-531.203] (-530.513) (-529.103) (-529.349) -- 0:00:09
Average standard deviation of split frequencies: 0.006203
835500 -- (-531.793) (-529.672) (-533.976) [-530.530] * (-529.015) (-532.128) (-530.072) [-529.097] -- 0:00:09
836000 -- (-530.381) (-529.789) (-531.441) [-530.918] * (-529.901) (-536.057) (-532.054) [-529.719] -- 0:00:09
836500 -- (-529.760) (-529.231) [-533.022] (-532.022) * (-530.289) (-531.185) [-533.803] (-529.136) -- 0:00:09
837000 -- (-531.391) [-532.343] (-532.527) (-531.740) * [-529.075] (-531.159) (-530.408) (-534.664) -- 0:00:09
837500 -- (-532.723) (-529.823) [-532.488] (-531.226) * (-529.598) (-534.890) [-530.738] (-531.852) -- 0:00:09
838000 -- (-531.518) [-529.200] (-535.019) (-531.231) * (-532.627) [-533.009] (-529.740) (-533.093) -- 0:00:09
838500 -- (-529.946) [-531.561] (-532.095) (-529.855) * [-530.807] (-532.723) (-531.852) (-533.383) -- 0:00:09
839000 -- (-529.702) [-533.496] (-529.793) (-530.638) * (-533.748) (-530.362) (-529.059) [-530.330] -- 0:00:09
839500 -- [-531.895] (-529.839) (-528.947) (-529.559) * (-531.409) (-533.137) [-530.067] (-529.519) -- 0:00:09
840000 -- (-531.263) [-529.227] (-530.240) (-532.009) * [-530.544] (-529.521) (-529.923) (-529.210) -- 0:00:09
Average standard deviation of split frequencies: 0.006056
840500 -- (-537.828) [-531.457] (-529.419) (-534.056) * (-530.840) (-531.618) (-531.978) [-531.607] -- 0:00:09
841000 -- [-529.928] (-530.450) (-531.136) (-530.451) * (-530.519) (-531.246) (-534.339) [-533.869] -- 0:00:09
841500 -- (-532.597) (-529.501) [-530.128] (-532.774) * (-529.695) [-529.814] (-532.641) (-532.927) -- 0:00:09
842000 -- (-531.879) (-529.504) [-530.771] (-531.423) * (-534.870) (-529.145) (-531.449) [-531.296] -- 0:00:09
842500 -- (-531.517) [-529.870] (-535.843) (-528.716) * (-531.875) (-531.231) (-532.401) [-532.351] -- 0:00:09
843000 -- (-530.281) (-529.363) (-530.772) [-530.423] * (-531.203) [-529.932] (-532.242) (-531.495) -- 0:00:09
843500 -- (-529.233) (-531.424) (-530.616) [-530.683] * (-530.362) (-530.460) [-528.908] (-529.883) -- 0:00:09
844000 -- [-528.839] (-530.563) (-532.235) (-529.851) * (-533.314) (-530.110) (-530.262) [-529.492] -- 0:00:09
844500 -- (-532.580) (-532.327) (-531.812) [-530.057] * (-534.509) [-530.867] (-530.028) (-532.154) -- 0:00:09
845000 -- (-531.118) [-534.484] (-531.741) (-531.436) * (-531.901) (-530.190) [-530.852] (-536.951) -- 0:00:09
Average standard deviation of split frequencies: 0.006129
845500 -- (-531.465) (-533.074) [-531.464] (-531.237) * (-531.175) [-529.615] (-531.786) (-532.798) -- 0:00:09
846000 -- (-531.166) [-531.579] (-530.107) (-532.343) * (-530.268) [-530.552] (-532.632) (-530.677) -- 0:00:09
846500 -- (-531.204) [-529.275] (-531.577) (-529.953) * (-531.101) (-531.567) (-530.241) [-529.593] -- 0:00:09
847000 -- (-535.465) (-532.131) [-532.183] (-533.134) * [-528.992] (-528.875) (-531.596) (-534.963) -- 0:00:09
847500 -- (-529.768) [-529.297] (-529.883) (-529.842) * [-529.167] (-530.005) (-533.101) (-533.665) -- 0:00:08
848000 -- [-529.221] (-531.686) (-530.414) (-531.601) * (-530.127) [-531.681] (-531.550) (-532.718) -- 0:00:08
848500 -- (-532.886) (-530.126) (-529.771) [-529.547] * (-535.895) (-531.172) (-530.253) [-530.938] -- 0:00:08
849000 -- (-530.353) [-530.137] (-529.221) (-530.219) * (-531.742) (-532.049) (-531.275) [-530.395] -- 0:00:08
849500 -- (-532.467) (-533.322) [-529.073] (-531.258) * (-530.352) [-532.717] (-530.222) (-530.629) -- 0:00:09
850000 -- (-529.931) (-529.543) (-529.523) [-531.695] * (-530.041) (-531.053) (-530.693) [-532.113] -- 0:00:09
Average standard deviation of split frequencies: 0.006059
850500 -- (-532.887) (-529.867) (-529.449) [-531.837] * [-531.947] (-530.369) (-529.396) (-530.490) -- 0:00:08
851000 -- [-530.078] (-532.101) (-532.393) (-533.824) * (-530.400) (-530.022) (-529.954) [-531.382] -- 0:00:08
851500 -- (-534.464) [-529.471] (-531.023) (-531.898) * (-530.872) (-529.964) (-529.520) [-530.305] -- 0:00:08
852000 -- (-529.578) [-531.884] (-530.209) (-530.587) * (-533.564) (-530.145) [-532.835] (-531.301) -- 0:00:08
852500 -- (-528.850) (-530.478) [-529.986] (-529.666) * (-529.889) [-530.803] (-530.271) (-530.318) -- 0:00:08
853000 -- (-529.083) (-531.851) [-530.534] (-530.233) * [-530.243] (-532.289) (-531.479) (-531.356) -- 0:00:08
853500 -- (-535.001) [-532.467] (-530.407) (-529.430) * (-529.912) (-533.808) (-535.323) [-530.935] -- 0:00:08
854000 -- (-530.116) (-531.557) [-530.041] (-531.488) * (-529.651) [-532.775] (-531.158) (-532.191) -- 0:00:08
854500 -- (-532.323) [-531.599] (-530.382) (-539.679) * [-530.358] (-531.944) (-532.537) (-533.125) -- 0:00:08
855000 -- (-530.510) [-528.856] (-529.509) (-529.220) * (-533.292) (-530.418) [-532.693] (-528.748) -- 0:00:08
Average standard deviation of split frequencies: 0.006278
855500 -- (-531.669) (-531.500) [-529.978] (-530.767) * (-529.642) (-531.586) [-532.513] (-531.219) -- 0:00:08
856000 -- [-530.065] (-531.658) (-529.811) (-536.981) * [-529.153] (-534.334) (-530.209) (-532.713) -- 0:00:08
856500 -- (-532.065) (-533.124) (-530.036) [-529.158] * [-530.162] (-531.439) (-531.274) (-533.167) -- 0:00:08
857000 -- (-529.307) (-531.532) (-531.252) [-529.384] * (-532.075) (-531.466) [-530.314] (-532.220) -- 0:00:08
857500 -- (-531.660) (-530.293) [-529.726] (-529.993) * (-532.657) [-532.856] (-530.003) (-530.979) -- 0:00:08
858000 -- (-529.881) [-529.285] (-533.378) (-531.374) * (-535.096) [-534.764] (-528.728) (-532.415) -- 0:00:08
858500 -- (-532.549) [-529.203] (-530.419) (-531.524) * (-532.378) [-529.915] (-533.055) (-530.917) -- 0:00:08
859000 -- (-530.233) (-533.286) (-531.260) [-533.373] * (-533.375) [-532.740] (-532.093) (-531.868) -- 0:00:08
859500 -- (-532.205) (-529.344) [-532.548] (-533.809) * (-530.364) (-529.504) (-530.495) [-529.288] -- 0:00:08
860000 -- [-531.395] (-534.916) (-529.746) (-531.007) * (-530.710) (-528.854) (-534.516) [-531.385] -- 0:00:08
Average standard deviation of split frequencies: 0.005988
860500 -- (-529.522) (-529.956) (-531.098) [-530.834] * (-530.082) [-530.031] (-532.326) (-529.360) -- 0:00:08
861000 -- (-531.102) [-530.527] (-531.592) (-530.475) * (-530.668) (-529.236) (-533.278) [-528.952] -- 0:00:08
861500 -- (-530.459) (-530.267) (-532.385) [-530.791] * (-532.843) (-529.171) [-529.874] (-529.155) -- 0:00:08
862000 -- (-531.141) [-534.779] (-531.549) (-533.672) * (-530.952) (-531.158) [-530.577] (-531.353) -- 0:00:08
862500 -- [-529.761] (-533.813) (-532.474) (-530.125) * [-532.019] (-529.566) (-529.738) (-528.974) -- 0:00:08
863000 -- (-530.440) (-531.958) (-530.304) [-531.184] * (-529.731) [-529.333] (-531.219) (-531.324) -- 0:00:08
863500 -- (-531.029) (-530.278) (-534.684) [-530.966] * (-534.705) (-532.654) (-533.113) [-530.617] -- 0:00:08
864000 -- (-533.676) (-531.248) (-532.053) [-531.058] * (-530.763) [-529.513] (-537.680) (-532.757) -- 0:00:08
864500 -- [-531.057] (-531.100) (-532.959) (-529.868) * (-530.850) (-533.052) (-530.923) [-531.499] -- 0:00:07
865000 -- (-537.589) (-530.507) (-529.875) [-529.125] * (-532.032) [-531.414] (-534.358) (-530.780) -- 0:00:07
Average standard deviation of split frequencies: 0.005697
865500 -- (-532.284) (-531.206) (-529.877) [-529.218] * (-529.884) (-530.371) [-530.682] (-530.630) -- 0:00:07
866000 -- (-528.754) (-529.909) (-529.866) [-530.237] * (-529.020) (-531.094) [-530.364] (-534.038) -- 0:00:07
866500 -- (-530.057) [-531.892] (-530.995) (-529.306) * (-530.245) [-531.181] (-529.785) (-531.933) -- 0:00:08
867000 -- (-530.959) [-530.008] (-529.846) (-532.321) * (-529.833) (-531.789) [-530.647] (-531.841) -- 0:00:07
867500 -- (-530.296) (-529.230) [-530.589] (-534.833) * (-532.871) (-530.204) [-531.771] (-530.057) -- 0:00:07
868000 -- (-531.085) (-533.044) (-536.020) [-529.771] * [-529.602] (-530.566) (-529.375) (-535.743) -- 0:00:07
868500 -- (-531.691) (-532.283) (-531.261) [-529.631] * (-530.000) [-529.190] (-530.205) (-529.263) -- 0:00:07
869000 -- [-530.723] (-529.653) (-534.130) (-529.673) * [-531.582] (-531.838) (-529.486) (-531.249) -- 0:00:07
869500 -- [-534.269] (-529.561) (-531.553) (-529.596) * (-529.671) [-534.105] (-531.822) (-530.958) -- 0:00:07
870000 -- [-533.081] (-531.986) (-531.687) (-532.055) * (-535.991) [-529.692] (-530.466) (-536.395) -- 0:00:07
Average standard deviation of split frequencies: 0.005559
870500 -- [-533.106] (-531.867) (-532.187) (-530.403) * [-531.582] (-530.231) (-529.971) (-529.456) -- 0:00:07
871000 -- (-530.362) [-529.814] (-530.845) (-530.178) * [-531.207] (-531.245) (-530.307) (-534.200) -- 0:00:07
871500 -- [-531.850] (-530.110) (-531.451) (-530.072) * (-533.059) (-533.588) [-529.715] (-529.247) -- 0:00:07
872000 -- (-532.468) (-533.495) (-531.974) [-529.990] * [-531.362] (-531.655) (-533.662) (-530.703) -- 0:00:07
872500 -- (-528.997) (-530.753) (-530.714) [-529.619] * (-529.176) (-529.879) (-534.532) [-533.714] -- 0:00:07
873000 -- (-529.454) [-530.174] (-530.835) (-531.129) * (-532.405) [-530.764] (-530.700) (-530.736) -- 0:00:07
873500 -- (-529.473) [-530.293] (-531.156) (-533.439) * (-531.260) (-540.304) (-531.836) [-530.935] -- 0:00:07
874000 -- (-529.018) [-530.522] (-529.463) (-532.137) * (-531.744) (-530.786) (-530.342) [-529.587] -- 0:00:07
874500 -- (-529.946) (-532.767) [-528.826] (-529.083) * (-529.421) (-532.751) (-532.245) [-530.721] -- 0:00:07
875000 -- (-531.111) (-531.376) (-530.956) [-530.450] * [-529.769] (-528.931) (-532.058) (-530.497) -- 0:00:07
Average standard deviation of split frequencies: 0.005812
875500 -- (-533.836) (-532.715) (-529.489) [-529.721] * (-532.867) (-529.433) (-530.952) [-531.339] -- 0:00:07
876000 -- (-531.940) (-532.450) (-530.787) [-530.762] * (-529.069) [-530.451] (-533.383) (-530.562) -- 0:00:07
876500 -- (-530.662) (-533.859) [-530.181] (-530.002) * [-529.974] (-529.573) (-535.407) (-530.223) -- 0:00:07
877000 -- [-530.361] (-532.920) (-530.573) (-531.514) * (-529.483) [-529.733] (-529.160) (-531.064) -- 0:00:07
877500 -- (-530.299) (-530.862) (-529.457) [-529.865] * (-531.524) (-529.657) [-531.561] (-531.842) -- 0:00:07
878000 -- (-532.804) (-531.108) [-529.359] (-530.264) * [-530.475] (-530.614) (-530.786) (-530.399) -- 0:00:07
878500 -- (-535.033) [-535.802] (-531.061) (-533.472) * (-529.177) (-531.821) [-532.680] (-529.250) -- 0:00:07
879000 -- (-537.171) (-534.896) [-530.920] (-530.378) * [-529.604] (-528.779) (-533.716) (-531.889) -- 0:00:07
879500 -- (-530.941) (-531.315) [-531.707] (-535.570) * (-529.328) (-529.745) (-530.539) [-536.230] -- 0:00:07
880000 -- (-531.029) [-531.922] (-531.825) (-529.040) * (-530.335) [-529.239] (-531.469) (-532.031) -- 0:00:07
Average standard deviation of split frequencies: 0.006174
880500 -- (-533.410) [-531.433] (-532.041) (-531.556) * (-531.720) (-533.286) (-532.910) [-530.850] -- 0:00:07
881000 -- [-530.679] (-533.595) (-530.521) (-534.805) * (-529.981) (-533.047) (-529.668) [-529.776] -- 0:00:07
881500 -- (-530.881) (-532.497) [-530.115] (-530.903) * (-529.723) (-529.939) [-529.784] (-532.317) -- 0:00:06
882000 -- (-531.289) (-531.750) [-530.520] (-531.311) * (-529.666) [-529.457] (-531.291) (-531.293) -- 0:00:06
882500 -- (-532.651) [-530.275] (-530.750) (-531.465) * [-529.338] (-530.461) (-531.154) (-531.460) -- 0:00:06
883000 -- (-531.820) [-529.117] (-535.552) (-536.148) * [-529.673] (-531.253) (-530.865) (-531.371) -- 0:00:06
883500 -- (-531.679) [-529.029] (-530.133) (-530.802) * (-532.431) (-534.956) (-531.615) [-530.277] -- 0:00:06
884000 -- [-529.404] (-532.185) (-533.864) (-532.986) * (-530.714) (-532.422) (-529.999) [-529.943] -- 0:00:06
884500 -- (-533.767) [-531.300] (-532.389) (-529.802) * (-530.067) (-531.639) [-529.001] (-532.330) -- 0:00:06
885000 -- (-535.708) (-530.731) (-534.924) [-531.312] * [-530.034] (-529.663) (-529.944) (-531.758) -- 0:00:06
Average standard deviation of split frequencies: 0.006456
885500 -- (-535.029) [-530.125] (-532.566) (-531.439) * (-529.301) (-531.503) (-531.522) [-530.944] -- 0:00:06
886000 -- (-529.915) (-530.090) (-531.703) [-528.855] * (-535.720) (-529.910) [-530.415] (-530.927) -- 0:00:06
886500 -- [-533.102] (-530.201) (-531.220) (-530.020) * (-532.892) (-529.993) (-531.342) [-529.697] -- 0:00:06
887000 -- (-533.296) (-531.670) (-530.526) [-528.850] * (-533.569) (-531.655) [-530.597] (-532.850) -- 0:00:06
887500 -- (-531.028) (-530.214) [-531.240] (-531.521) * (-533.417) (-532.201) (-532.996) [-530.678] -- 0:00:06
888000 -- [-529.535] (-531.135) (-534.177) (-529.111) * (-535.968) (-531.073) [-531.630] (-531.005) -- 0:00:06
888500 -- (-532.414) (-531.872) [-531.401] (-531.021) * (-528.804) (-531.942) [-530.715] (-530.173) -- 0:00:06
889000 -- (-529.568) [-531.525] (-531.135) (-533.122) * (-530.657) [-531.143] (-531.502) (-533.584) -- 0:00:06
889500 -- (-529.687) (-532.269) (-532.232) [-531.329] * (-530.100) (-530.696) (-533.969) [-532.349] -- 0:00:06
890000 -- (-532.846) [-530.701] (-536.965) (-531.313) * (-529.663) (-530.144) (-530.981) [-534.622] -- 0:00:06
Average standard deviation of split frequencies: 0.006669
890500 -- [-531.611] (-531.691) (-532.608) (-533.139) * (-531.463) (-533.756) (-530.528) [-532.216] -- 0:00:06
891000 -- [-528.919] (-529.977) (-531.250) (-530.563) * (-529.430) (-533.457) [-533.551] (-530.083) -- 0:00:06
891500 -- (-529.721) [-530.232] (-530.582) (-529.266) * (-533.985) (-533.968) (-534.393) [-529.987] -- 0:00:06
892000 -- [-528.743] (-534.968) (-534.144) (-529.656) * (-529.559) (-530.711) [-531.284] (-529.836) -- 0:00:06
892500 -- (-529.318) [-529.657] (-534.637) (-535.959) * (-530.566) (-530.661) (-532.040) [-531.298] -- 0:00:06
893000 -- (-532.432) (-529.925) (-531.821) [-531.213] * (-531.190) [-535.275] (-530.245) (-530.916) -- 0:00:06
893500 -- (-531.109) [-530.086] (-529.563) (-532.992) * [-531.423] (-530.102) (-533.727) (-531.192) -- 0:00:06
894000 -- (-530.776) (-533.228) (-529.844) [-531.462] * (-533.485) (-531.954) (-530.935) [-529.865] -- 0:00:06
894500 -- (-532.657) [-529.904] (-529.802) (-531.979) * (-535.863) (-530.037) [-531.603] (-529.849) -- 0:00:06
895000 -- (-536.353) [-530.305] (-532.431) (-529.974) * [-530.760] (-530.051) (-531.018) (-530.710) -- 0:00:06
Average standard deviation of split frequencies: 0.005998
895500 -- (-537.477) (-529.619) [-530.087] (-538.897) * [-528.895] (-531.425) (-530.524) (-532.282) -- 0:00:06
896000 -- [-530.674] (-529.851) (-530.896) (-529.200) * [-532.012] (-539.052) (-530.442) (-530.058) -- 0:00:06
896500 -- [-531.627] (-530.856) (-531.789) (-529.118) * [-531.981] (-531.184) (-530.451) (-531.831) -- 0:00:06
897000 -- (-535.559) (-530.671) (-529.443) [-529.118] * (-534.512) (-532.356) (-530.883) [-531.480] -- 0:00:06
897500 -- [-532.048] (-530.576) (-533.025) (-530.728) * [-529.804] (-531.496) (-530.756) (-529.659) -- 0:00:06
898000 -- [-530.711] (-531.596) (-528.982) (-533.750) * (-530.788) (-532.813) [-529.565] (-529.104) -- 0:00:06
898500 -- (-530.026) (-532.395) [-531.511] (-532.983) * (-530.453) (-532.416) (-529.937) [-529.732] -- 0:00:06
899000 -- (-529.593) [-532.641] (-530.430) (-531.491) * [-531.726] (-530.579) (-531.384) (-530.597) -- 0:00:06
899500 -- (-529.423) (-530.400) [-531.472] (-534.441) * (-531.470) [-531.468] (-531.753) (-529.474) -- 0:00:06
900000 -- (-533.588) [-529.339] (-532.501) (-531.413) * (-536.782) (-529.952) [-529.621] (-529.722) -- 0:00:06
Average standard deviation of split frequencies: 0.005897
900500 -- (-530.609) (-532.241) (-531.376) [-529.923] * (-530.032) (-533.220) (-531.603) [-531.129] -- 0:00:05
901000 -- (-530.516) (-531.794) (-531.181) [-531.379] * (-530.013) [-532.642] (-533.144) (-529.639) -- 0:00:05
901500 -- (-528.934) [-530.334] (-530.770) (-533.359) * [-533.389] (-533.259) (-530.908) (-533.672) -- 0:00:05
902000 -- (-530.618) (-530.897) [-530.974] (-530.636) * [-531.873] (-533.061) (-530.549) (-530.520) -- 0:00:05
902500 -- [-529.585] (-530.914) (-530.987) (-532.800) * (-532.858) [-531.426] (-532.321) (-530.111) -- 0:00:05
903000 -- (-530.116) [-530.176] (-529.917) (-533.615) * (-533.178) (-530.426) [-529.518] (-531.784) -- 0:00:05
903500 -- (-531.702) (-530.447) [-530.463] (-534.157) * (-531.521) (-532.343) (-529.061) [-529.395] -- 0:00:05
904000 -- [-530.981] (-534.049) (-534.026) (-530.688) * (-530.905) [-530.971] (-532.584) (-530.422) -- 0:00:05
904500 -- (-529.178) [-530.426] (-531.193) (-533.849) * [-529.577] (-531.855) (-530.544) (-532.309) -- 0:00:05
905000 -- (-529.314) [-533.538] (-533.602) (-531.594) * (-531.528) (-530.622) [-529.286] (-531.278) -- 0:00:05
Average standard deviation of split frequencies: 0.005585
905500 -- (-530.303) (-531.904) (-530.185) [-532.813] * (-530.441) (-530.590) [-529.823] (-530.308) -- 0:00:05
906000 -- [-532.643] (-531.936) (-531.745) (-534.579) * (-532.910) [-530.834] (-530.164) (-530.192) -- 0:00:05
906500 -- (-529.911) [-531.302] (-541.399) (-536.559) * [-531.624] (-531.979) (-530.613) (-528.974) -- 0:00:05
907000 -- [-532.169] (-533.269) (-542.543) (-535.251) * (-531.491) (-530.412) [-530.905] (-531.683) -- 0:00:05
907500 -- [-529.680] (-531.023) (-531.511) (-531.315) * (-529.721) (-531.152) (-530.403) [-531.636] -- 0:00:05
908000 -- (-529.863) (-529.414) [-530.740] (-531.098) * (-531.301) (-529.765) [-535.920] (-534.808) -- 0:00:05
908500 -- [-530.546] (-531.127) (-536.362) (-534.680) * [-530.180] (-529.520) (-530.685) (-532.234) -- 0:00:05
909000 -- (-530.685) (-531.109) [-531.331] (-529.874) * [-531.315] (-530.417) (-532.067) (-532.916) -- 0:00:05
909500 -- (-531.008) [-529.879] (-532.044) (-530.573) * (-534.179) (-535.493) [-530.778] (-533.847) -- 0:00:05
910000 -- (-532.763) (-530.286) (-532.750) [-532.248] * (-531.415) (-531.780) [-532.510] (-530.037) -- 0:00:05
Average standard deviation of split frequencies: 0.005315
910500 -- [-532.019] (-531.737) (-529.617) (-533.057) * [-532.419] (-530.441) (-531.493) (-529.891) -- 0:00:05
911000 -- (-529.183) (-529.698) [-531.047] (-529.218) * (-533.068) [-530.253] (-530.124) (-530.070) -- 0:00:05
911500 -- (-532.855) (-530.253) [-530.122] (-530.504) * (-532.196) [-532.146] (-530.521) (-530.949) -- 0:00:05
912000 -- [-530.541] (-532.920) (-530.436) (-529.813) * [-530.121] (-529.356) (-533.362) (-531.507) -- 0:00:05
912500 -- (-534.506) (-532.347) [-529.402] (-534.147) * (-532.043) (-531.565) (-532.911) [-534.977] -- 0:00:05
913000 -- (-532.731) (-532.018) [-529.125] (-529.496) * (-529.374) (-531.762) [-529.102] (-536.127) -- 0:00:05
913500 -- (-533.596) (-534.518) [-529.194] (-529.743) * [-531.014] (-531.896) (-529.962) (-532.848) -- 0:00:05
914000 -- [-532.712] (-534.445) (-529.402) (-537.180) * (-532.617) (-531.934) (-529.572) [-531.290] -- 0:00:05
914500 -- (-534.606) (-532.425) [-532.336] (-530.243) * (-530.251) (-538.434) [-529.134] (-535.490) -- 0:00:05
915000 -- (-532.357) (-530.985) [-530.953] (-533.543) * (-531.009) (-536.926) (-531.299) [-528.936] -- 0:00:05
Average standard deviation of split frequencies: 0.004803
915500 -- (-531.250) (-531.375) [-530.062] (-530.581) * (-533.254) (-533.325) (-531.620) [-532.039] -- 0:00:05
916000 -- [-531.600] (-532.027) (-531.401) (-529.884) * (-531.189) (-531.318) (-531.746) [-530.594] -- 0:00:05
916500 -- (-530.522) [-530.343] (-534.069) (-530.995) * (-532.541) [-530.914] (-532.843) (-536.024) -- 0:00:05
917000 -- (-529.358) [-529.764] (-532.487) (-530.131) * (-534.677) (-530.874) [-532.843] (-532.386) -- 0:00:04
917500 -- (-531.681) (-529.950) (-529.257) [-531.659] * [-532.396] (-531.435) (-532.362) (-534.497) -- 0:00:04
918000 -- (-530.210) (-532.259) [-533.449] (-529.994) * (-536.123) (-535.030) (-532.708) [-532.560] -- 0:00:04
918500 -- (-530.748) (-530.051) [-530.461] (-531.318) * (-530.707) (-533.911) [-533.287] (-529.092) -- 0:00:04
919000 -- (-529.946) (-531.034) (-532.528) [-530.826] * (-531.341) [-529.839] (-533.485) (-529.885) -- 0:00:04
919500 -- (-529.009) [-534.788] (-533.204) (-534.160) * (-530.030) (-531.466) [-532.595] (-531.765) -- 0:00:04
920000 -- [-529.100] (-535.392) (-531.613) (-530.379) * (-530.539) (-534.296) [-530.403] (-530.597) -- 0:00:04
Average standard deviation of split frequencies: 0.004574
920500 -- (-529.421) (-532.173) (-531.156) [-529.455] * (-529.578) (-530.837) (-531.833) [-530.038] -- 0:00:04
921000 -- [-530.638] (-533.504) (-530.132) (-529.232) * (-529.901) [-530.014] (-532.239) (-531.097) -- 0:00:04
921500 -- [-529.032] (-532.554) (-530.889) (-531.858) * [-530.310] (-530.285) (-530.940) (-529.097) -- 0:00:04
922000 -- (-529.888) (-529.661) [-530.433] (-531.434) * (-539.515) [-530.387] (-529.383) (-531.736) -- 0:00:04
922500 -- (-531.826) [-529.661] (-530.009) (-530.687) * (-530.705) (-530.406) [-529.702] (-531.955) -- 0:00:04
923000 -- [-530.617] (-530.092) (-533.946) (-530.259) * [-531.898] (-531.474) (-531.284) (-532.825) -- 0:00:04
923500 -- [-531.048] (-529.899) (-533.880) (-532.303) * (-533.418) (-533.251) (-529.126) [-530.217] -- 0:00:04
924000 -- (-529.807) (-531.866) (-531.085) [-530.608] * (-531.567) (-532.015) (-532.704) [-530.217] -- 0:00:04
924500 -- [-532.242] (-533.857) (-531.167) (-536.061) * (-529.439) (-530.473) (-530.887) [-530.145] -- 0:00:04
925000 -- (-534.080) (-533.981) [-530.074] (-529.641) * (-529.456) (-533.887) [-531.004] (-530.693) -- 0:00:04
Average standard deviation of split frequencies: 0.004989
925500 -- [-532.995] (-532.934) (-532.404) (-530.755) * (-530.518) (-532.984) [-530.524] (-534.920) -- 0:00:04
926000 -- (-532.664) [-532.215] (-531.586) (-529.568) * (-531.736) (-531.337) [-530.115] (-532.142) -- 0:00:04
926500 -- (-529.394) [-531.367] (-531.215) (-530.628) * [-531.446] (-532.009) (-529.182) (-529.984) -- 0:00:04
927000 -- (-529.150) [-529.411] (-533.043) (-532.668) * (-532.756) (-535.538) [-529.738] (-529.918) -- 0:00:04
927500 -- (-534.582) (-528.964) [-530.226] (-529.696) * (-533.211) (-530.782) (-533.318) [-529.183] -- 0:00:04
928000 -- (-529.567) (-530.935) [-530.275] (-531.872) * (-532.267) (-530.063) [-529.125] (-528.934) -- 0:00:04
928500 -- (-533.784) (-530.540) [-532.680] (-530.281) * (-530.204) (-530.655) [-532.653] (-532.013) -- 0:00:04
929000 -- [-530.347] (-530.107) (-529.591) (-530.246) * (-528.978) (-531.671) (-530.135) [-533.269] -- 0:00:04
929500 -- [-529.847] (-529.294) (-530.979) (-530.165) * (-529.488) (-532.846) [-531.017] (-531.069) -- 0:00:04
930000 -- (-532.204) [-531.207] (-530.549) (-530.549) * (-528.783) [-530.427] (-530.020) (-532.794) -- 0:00:04
Average standard deviation of split frequencies: 0.004761
930500 -- (-530.068) (-532.054) (-530.429) [-528.844] * (-530.315) [-529.545] (-531.042) (-531.877) -- 0:00:04
931000 -- (-531.386) [-531.323] (-531.818) (-533.547) * (-531.406) (-531.506) [-535.275] (-531.808) -- 0:00:04
931500 -- (-529.031) (-530.440) [-529.788] (-529.400) * (-531.216) [-530.163] (-529.614) (-533.841) -- 0:00:04
932000 -- (-533.143) [-531.781] (-529.216) (-529.965) * (-529.187) (-531.610) [-528.716] (-530.085) -- 0:00:04
932500 -- (-533.383) (-531.777) [-529.778] (-530.115) * (-530.206) [-530.676] (-529.227) (-534.085) -- 0:00:04
933000 -- [-528.963] (-530.446) (-531.673) (-531.622) * [-528.846] (-530.978) (-529.955) (-533.890) -- 0:00:04
933500 -- [-530.910] (-533.425) (-530.527) (-531.263) * (-530.429) (-532.918) (-531.296) [-530.388] -- 0:00:03
934000 -- [-531.051] (-529.810) (-530.682) (-531.863) * (-531.541) [-532.881] (-530.059) (-532.509) -- 0:00:03
934500 -- (-531.239) (-531.115) [-531.928] (-531.611) * [-529.236] (-537.346) (-530.298) (-530.560) -- 0:00:03
935000 -- (-531.058) (-530.484) [-531.461] (-530.817) * (-531.468) [-530.579] (-529.056) (-532.049) -- 0:00:03
Average standard deviation of split frequencies: 0.004801
935500 -- (-529.838) (-529.591) (-529.783) [-529.845] * (-536.131) [-531.236] (-530.918) (-531.872) -- 0:00:03
936000 -- (-534.083) [-529.070] (-530.473) (-529.818) * (-539.636) [-532.087] (-529.380) (-530.990) -- 0:00:03
936500 -- (-531.033) (-530.652) (-531.786) [-529.623] * (-539.019) (-530.337) (-531.799) [-530.175] -- 0:00:03
937000 -- (-531.367) [-529.525] (-531.659) (-530.533) * (-532.048) [-531.361] (-530.489) (-530.232) -- 0:00:03
937500 -- (-531.343) [-528.637] (-531.672) (-532.658) * (-529.436) (-533.463) [-531.030] (-528.993) -- 0:00:03
938000 -- (-531.132) [-529.752] (-531.591) (-533.444) * (-532.691) [-532.969] (-533.190) (-531.102) -- 0:00:03
938500 -- (-531.771) (-531.585) [-531.375] (-531.769) * (-533.578) [-533.672] (-529.199) (-530.361) -- 0:00:03
939000 -- (-531.013) (-531.145) [-534.189] (-529.146) * (-529.401) [-529.645] (-529.804) (-529.179) -- 0:00:03
939500 -- (-530.237) [-532.416] (-529.660) (-530.428) * (-529.070) (-530.409) [-530.249] (-532.814) -- 0:00:03
940000 -- (-530.294) (-533.480) [-529.641] (-531.660) * [-531.927] (-530.772) (-531.618) (-529.875) -- 0:00:03
Average standard deviation of split frequencies: 0.004711
940500 -- (-530.975) [-530.960] (-531.579) (-531.322) * (-532.148) (-529.712) (-529.560) [-532.179] -- 0:00:03
941000 -- [-529.547] (-529.215) (-533.046) (-537.412) * (-530.887) (-534.406) (-529.587) [-532.875] -- 0:00:03
941500 -- (-532.165) (-530.754) (-530.078) [-529.156] * (-530.396) [-529.805] (-529.732) (-531.579) -- 0:00:03
942000 -- (-529.454) [-531.356] (-530.086) (-530.334) * (-531.770) (-528.583) (-530.402) [-531.388] -- 0:00:03
942500 -- (-531.290) (-531.518) (-529.460) [-529.750] * (-531.845) (-528.999) [-530.374] (-531.598) -- 0:00:03
943000 -- (-529.963) (-530.135) [-529.695] (-531.853) * (-533.229) (-531.485) (-531.699) [-532.102] -- 0:00:03
943500 -- (-533.173) (-530.895) (-531.040) [-529.575] * [-529.586] (-531.332) (-535.415) (-529.820) -- 0:00:03
944000 -- [-532.226] (-530.509) (-533.024) (-531.996) * (-531.391) (-536.435) (-531.565) [-529.304] -- 0:00:03
944500 -- [-530.906] (-531.820) (-531.233) (-532.938) * [-530.841] (-535.189) (-532.536) (-531.233) -- 0:00:03
945000 -- (-532.980) (-530.917) (-532.314) [-531.870] * (-533.370) (-530.277) [-530.344] (-531.786) -- 0:00:03
Average standard deviation of split frequencies: 0.004584
945500 -- (-529.617) (-531.365) (-532.866) [-536.656] * (-533.234) (-530.202) [-530.050] (-531.673) -- 0:00:03
946000 -- [-529.888] (-531.241) (-529.028) (-529.222) * (-533.748) (-528.791) (-531.417) [-530.500] -- 0:00:03
946500 -- (-532.346) (-529.943) [-530.265] (-529.016) * (-534.388) (-528.818) [-530.207] (-531.300) -- 0:00:03
947000 -- (-530.003) (-530.108) (-533.872) [-529.470] * (-531.725) [-529.503] (-530.525) (-530.247) -- 0:00:03
947500 -- (-529.926) [-533.869] (-533.713) (-529.894) * [-533.658] (-529.893) (-532.754) (-533.874) -- 0:00:03
948000 -- [-533.511] (-532.190) (-532.226) (-530.419) * (-530.286) [-531.254] (-530.803) (-532.250) -- 0:00:03
948500 -- (-531.157) (-532.290) (-532.077) [-531.621] * [-530.272] (-533.149) (-532.589) (-532.283) -- 0:00:03
949000 -- (-531.333) [-531.230] (-530.171) (-532.168) * (-531.805) [-530.534] (-532.226) (-533.691) -- 0:00:03
949500 -- (-532.690) (-535.105) (-530.221) [-531.156] * (-530.012) (-531.318) [-535.987] (-531.406) -- 0:00:03
950000 -- (-529.759) (-532.804) (-533.202) [-529.743] * (-530.064) [-530.970] (-532.663) (-530.286) -- 0:00:03
Average standard deviation of split frequencies: 0.004859
950500 -- (-532.898) (-531.570) [-529.434] (-529.648) * (-530.448) (-530.081) [-530.104] (-529.690) -- 0:00:02
951000 -- (-532.364) (-530.781) [-530.533] (-531.529) * (-530.481) (-531.548) [-531.158] (-531.390) -- 0:00:02
951500 -- (-534.997) [-531.653] (-529.379) (-536.694) * (-531.248) [-530.330] (-528.890) (-530.074) -- 0:00:02
952000 -- [-532.612] (-532.392) (-530.294) (-530.909) * (-533.861) (-531.542) [-529.737] (-530.155) -- 0:00:02
952500 -- [-532.200] (-530.897) (-532.510) (-531.940) * (-529.762) [-530.423] (-530.776) (-531.807) -- 0:00:02
953000 -- (-533.264) (-528.943) (-531.223) [-530.337] * (-530.677) (-532.194) (-531.504) [-529.772] -- 0:00:02
953500 -- [-531.750] (-530.865) (-532.798) (-533.080) * [-530.700] (-533.050) (-532.251) (-531.751) -- 0:00:02
954000 -- (-529.255) (-532.079) (-531.882) [-529.633] * (-529.302) (-530.833) [-533.239] (-530.621) -- 0:00:02
954500 -- (-529.963) (-530.512) (-530.387) [-530.078] * (-531.082) (-529.735) (-533.142) [-533.871] -- 0:00:02
955000 -- [-529.930] (-529.475) (-531.257) (-530.442) * (-530.504) [-530.871] (-531.317) (-529.870) -- 0:00:02
Average standard deviation of split frequencies: 0.005391
955500 -- [-531.894] (-531.946) (-532.510) (-536.040) * [-530.375] (-530.722) (-531.815) (-534.084) -- 0:00:02
956000 -- (-530.836) (-529.703) [-530.527] (-529.721) * [-532.178] (-529.512) (-531.181) (-534.008) -- 0:00:02
956500 -- [-530.837] (-529.130) (-529.193) (-531.178) * (-530.478) (-534.262) [-531.513] (-529.909) -- 0:00:02
957000 -- (-529.825) [-529.286] (-531.519) (-532.007) * (-530.565) [-531.444] (-530.627) (-530.505) -- 0:00:02
957500 -- (-533.207) (-529.630) [-529.880] (-531.175) * (-530.877) (-529.098) (-530.352) [-529.767] -- 0:00:02
958000 -- (-532.466) (-529.406) (-531.225) [-529.322] * (-532.682) (-529.488) (-531.166) [-530.990] -- 0:00:02
958500 -- [-529.957] (-530.726) (-530.534) (-529.262) * (-529.772) [-529.587] (-530.986) (-533.407) -- 0:00:02
959000 -- [-530.000] (-530.346) (-531.622) (-533.359) * (-530.106) (-531.431) [-529.331] (-530.822) -- 0:00:02
959500 -- (-530.955) (-529.714) (-531.484) [-528.918] * (-537.316) [-530.803] (-529.768) (-531.408) -- 0:00:02
960000 -- (-531.126) [-530.886] (-531.394) (-529.337) * (-532.228) (-530.929) (-529.759) [-531.039] -- 0:00:02
Average standard deviation of split frequencies: 0.005005
960500 -- [-530.912] (-533.718) (-531.699) (-535.605) * (-535.565) (-528.945) (-532.155) [-530.031] -- 0:00:02
961000 -- (-537.727) [-529.672] (-535.247) (-530.319) * (-531.098) (-532.879) (-530.046) [-530.848] -- 0:00:02
961500 -- (-531.872) (-530.091) (-532.470) [-530.116] * (-530.811) [-530.569] (-529.179) (-532.544) -- 0:00:02
962000 -- [-533.903] (-533.192) (-534.345) (-533.901) * (-532.290) (-530.817) (-531.057) [-532.276] -- 0:00:02
962500 -- (-533.387) [-531.136] (-534.600) (-531.228) * (-530.599) (-529.961) (-531.875) [-532.520] -- 0:00:02
963000 -- (-531.622) (-530.314) [-530.092] (-530.165) * (-535.284) (-530.164) (-532.275) [-529.978] -- 0:00:02
963500 -- (-529.596) (-531.017) [-530.245] (-530.165) * [-532.910] (-528.843) (-531.358) (-534.814) -- 0:00:02
964000 -- [-529.482] (-529.570) (-531.762) (-530.373) * (-530.559) (-529.790) (-529.195) [-530.110] -- 0:00:02
964500 -- [-530.648] (-532.706) (-531.282) (-530.838) * (-529.577) [-531.639] (-529.372) (-532.093) -- 0:00:02
965000 -- (-530.446) (-529.343) [-530.021] (-531.796) * (-529.549) (-532.051) (-529.825) [-531.001] -- 0:00:02
Average standard deviation of split frequencies: 0.005303
965500 -- (-531.966) (-530.613) (-529.928) [-533.625] * [-529.567] (-531.604) (-530.575) (-533.345) -- 0:00:02
966000 -- (-530.092) (-530.467) (-530.513) [-532.914] * (-532.290) [-530.810] (-534.226) (-533.226) -- 0:00:02
966500 -- (-529.648) (-531.591) (-529.074) [-531.280] * (-534.795) [-531.830] (-529.442) (-532.509) -- 0:00:02
967000 -- (-528.972) (-529.493) [-529.597] (-530.504) * (-536.446) (-531.621) [-530.764] (-531.238) -- 0:00:01
967500 -- [-531.233] (-531.091) (-530.075) (-530.300) * [-531.009] (-532.615) (-531.548) (-530.332) -- 0:00:01
968000 -- (-530.272) [-530.347] (-531.169) (-532.926) * (-531.852) (-531.619) [-530.059] (-531.138) -- 0:00:01
968500 -- (-531.787) (-531.515) (-535.453) [-530.573] * (-533.229) (-532.687) [-530.493] (-532.857) -- 0:00:01
969000 -- (-530.008) [-529.241] (-533.272) (-530.234) * (-530.570) [-528.768] (-530.970) (-540.062) -- 0:00:01
969500 -- (-529.860) (-533.296) [-532.208] (-530.127) * [-532.255] (-528.997) (-530.341) (-530.442) -- 0:00:01
970000 -- [-530.524] (-534.267) (-529.994) (-528.980) * (-533.449) (-530.487) [-533.552] (-529.621) -- 0:00:01
Average standard deviation of split frequencies: 0.005277
970500 -- (-533.670) (-534.642) [-530.885] (-532.026) * (-530.751) [-532.003] (-531.279) (-531.061) -- 0:00:01
971000 -- (-533.526) [-530.837] (-529.671) (-529.776) * [-530.562] (-533.775) (-531.235) (-530.448) -- 0:00:01
971500 -- [-530.146] (-530.684) (-531.380) (-530.363) * [-530.043] (-530.219) (-530.913) (-531.739) -- 0:00:01
972000 -- [-531.042] (-533.036) (-531.003) (-530.005) * (-529.261) (-532.275) [-532.011] (-530.366) -- 0:00:01
972500 -- [-531.000] (-530.309) (-531.086) (-530.044) * [-532.831] (-533.033) (-529.064) (-535.112) -- 0:00:01
973000 -- (-530.994) [-529.900] (-530.014) (-532.994) * (-530.054) [-530.757] (-531.552) (-531.261) -- 0:00:01
973500 -- (-530.789) (-529.278) [-532.760] (-534.170) * (-530.649) (-532.504) [-531.902] (-530.548) -- 0:00:01
974000 -- [-531.101] (-532.172) (-534.692) (-537.682) * [-530.404] (-528.673) (-531.683) (-531.997) -- 0:00:01
974500 -- (-530.233) (-530.117) (-529.727) [-530.468] * (-529.872) (-533.198) [-530.997] (-533.226) -- 0:00:01
975000 -- (-529.877) [-531.013] (-530.847) (-530.582) * (-530.854) (-536.165) [-534.682] (-531.262) -- 0:00:01
Average standard deviation of split frequencies: 0.005410
975500 -- (-531.187) (-529.992) [-531.258] (-532.364) * (-529.426) (-532.558) (-529.437) [-529.635] -- 0:00:01
976000 -- [-534.444] (-533.303) (-529.480) (-530.991) * (-529.426) (-530.112) [-532.066] (-529.112) -- 0:00:01
976500 -- (-534.957) [-530.502] (-532.578) (-532.503) * (-529.869) (-531.309) [-530.735] (-532.284) -- 0:00:01
977000 -- (-530.154) [-531.407] (-530.466) (-529.614) * (-530.065) (-530.896) (-531.603) [-529.683] -- 0:00:01
977500 -- (-529.310) (-531.681) (-530.331) [-529.399] * [-529.728] (-539.866) (-530.535) (-530.438) -- 0:00:01
978000 -- (-529.310) (-532.839) (-529.979) [-529.990] * (-535.422) [-529.947] (-529.659) (-533.327) -- 0:00:01
978500 -- [-530.485] (-535.255) (-532.173) (-529.754) * (-529.169) [-528.928] (-530.051) (-533.159) -- 0:00:01
979000 -- (-530.180) (-534.385) [-530.213] (-531.644) * (-529.476) [-532.275] (-529.866) (-530.838) -- 0:00:01
979500 -- [-533.514] (-531.569) (-531.190) (-529.904) * (-530.929) (-531.453) [-532.813] (-529.925) -- 0:00:01
980000 -- [-530.720] (-530.572) (-534.188) (-529.799) * [-531.415] (-533.818) (-532.891) (-531.155) -- 0:00:01
Average standard deviation of split frequencies: 0.005384
980500 -- (-529.220) (-532.481) (-534.674) [-529.571] * (-530.145) (-529.503) (-534.134) [-530.460] -- 0:00:01
981000 -- (-530.137) [-530.255] (-532.157) (-530.054) * (-529.923) (-537.616) (-534.415) [-533.360] -- 0:00:01
981500 -- (-530.486) (-535.363) (-532.019) [-529.451] * (-531.526) (-532.266) (-533.698) [-530.386] -- 0:00:01
982000 -- (-530.983) (-533.379) [-530.593] (-529.146) * [-531.856] (-530.704) (-529.920) (-531.870) -- 0:00:01
982500 -- (-530.650) (-531.067) (-530.374) [-529.233] * (-531.422) [-534.209] (-530.264) (-531.807) -- 0:00:01
983000 -- (-531.013) [-530.148] (-530.982) (-531.577) * (-531.038) (-536.536) [-531.625] (-531.852) -- 0:00:01
983500 -- (-530.764) [-529.854] (-529.630) (-533.257) * [-531.163] (-532.045) (-530.735) (-532.051) -- 0:00:00
984000 -- [-530.602] (-530.065) (-531.297) (-530.331) * [-532.683] (-531.711) (-532.729) (-535.814) -- 0:00:00
984500 -- (-530.130) [-531.605] (-531.715) (-532.348) * (-532.519) [-531.268] (-528.900) (-537.483) -- 0:00:00
985000 -- (-530.077) (-532.309) (-534.537) [-531.706] * (-532.581) [-528.816] (-532.594) (-531.691) -- 0:00:00
Average standard deviation of split frequencies: 0.005323
985500 -- [-530.439] (-530.738) (-534.776) (-533.067) * [-530.169] (-530.017) (-534.051) (-535.297) -- 0:00:00
986000 -- (-529.298) (-529.333) (-532.259) [-530.208] * [-535.456] (-529.575) (-536.704) (-530.234) -- 0:00:00
986500 -- (-530.486) [-530.957] (-530.989) (-532.026) * [-530.454] (-531.461) (-530.209) (-532.072) -- 0:00:00
987000 -- (-531.567) (-529.690) [-531.426] (-529.435) * (-529.261) [-532.601] (-531.564) (-530.829) -- 0:00:00
987500 -- (-543.129) (-530.381) [-534.504] (-532.110) * (-529.575) (-533.514) [-530.607] (-528.773) -- 0:00:00
988000 -- (-532.460) (-534.381) [-529.335] (-535.291) * (-530.605) [-532.421] (-531.656) (-529.402) -- 0:00:00
988500 -- [-529.294] (-533.797) (-531.229) (-546.940) * (-532.208) [-532.528] (-530.425) (-530.405) -- 0:00:00
989000 -- (-529.191) (-529.646) (-532.528) [-535.045] * (-530.340) (-534.426) [-529.933] (-531.240) -- 0:00:00
989500 -- (-531.034) (-530.150) (-530.389) [-533.216] * (-530.580) (-531.847) (-530.116) [-532.018] -- 0:00:00
990000 -- (-532.267) (-533.050) (-531.789) [-532.268] * [-530.456] (-532.859) (-530.786) (-530.975) -- 0:00:00
Average standard deviation of split frequencies: 0.005139
990500 -- (-534.648) (-535.594) (-530.536) [-530.548] * (-529.690) (-529.893) [-530.775] (-529.574) -- 0:00:00
991000 -- [-532.718] (-532.551) (-530.976) (-529.627) * (-533.622) (-532.704) [-530.914] (-533.870) -- 0:00:00
991500 -- (-535.276) (-530.699) (-533.499) [-530.810] * (-529.008) (-530.912) (-531.602) [-529.801] -- 0:00:00
992000 -- [-534.247] (-532.928) (-530.511) (-531.218) * (-528.967) [-530.632] (-530.342) (-529.907) -- 0:00:00
992500 -- (-533.440) (-534.454) [-533.169] (-530.815) * (-531.621) [-528.644] (-529.420) (-530.258) -- 0:00:00
993000 -- [-529.478] (-530.469) (-530.732) (-528.920) * [-529.809] (-531.970) (-530.315) (-529.630) -- 0:00:00
993500 -- (-531.864) [-533.083] (-533.449) (-531.921) * (-530.092) [-529.999] (-531.925) (-531.517) -- 0:00:00
994000 -- [-531.305] (-532.079) (-529.035) (-530.416) * [-532.460] (-529.486) (-530.395) (-533.827) -- 0:00:00
994500 -- (-530.448) [-530.552] (-529.315) (-531.847) * (-534.986) [-530.289] (-531.492) (-532.093) -- 0:00:00
995000 -- (-529.556) [-530.537] (-530.975) (-530.277) * (-534.836) (-531.760) (-532.712) [-533.363] -- 0:00:00
Average standard deviation of split frequencies: 0.005238
995500 -- (-532.048) [-532.217] (-530.277) (-531.257) * [-531.703] (-530.974) (-529.616) (-528.945) -- 0:00:00
996000 -- (-530.269) (-528.922) (-529.408) [-529.914] * (-531.548) [-530.199] (-528.746) (-531.531) -- 0:00:00
996500 -- (-530.992) (-531.936) (-531.189) [-529.157] * (-531.165) (-529.291) [-530.693] (-531.439) -- 0:00:00
997000 -- (-532.108) (-531.243) [-530.558] (-530.106) * (-529.106) (-530.365) [-530.026] (-530.883) -- 0:00:00
997500 -- (-530.463) (-529.944) (-531.785) [-529.645] * (-529.465) [-530.373] (-531.838) (-531.647) -- 0:00:00
998000 -- (-532.205) [-530.646] (-532.233) (-529.958) * (-529.397) [-530.532] (-530.254) (-529.500) -- 0:00:00
998500 -- (-529.481) (-530.132) [-530.143] (-530.678) * (-531.809) (-531.591) [-530.840] (-529.786) -- 0:00:00
999000 -- (-529.472) (-529.889) [-529.420] (-531.018) * [-529.787] (-533.074) (-532.546) (-533.329) -- 0:00:00
999500 -- (-529.148) (-529.711) [-529.316] (-529.751) * (-529.213) (-530.667) (-531.736) [-530.155] -- 0:00:00
1000000 -- (-529.602) (-530.594) (-530.612) [-531.876] * (-529.423) (-533.698) (-531.562) [-532.690] -- 0:00:00
Average standard deviation of split frequencies: 0.005276
Analysis completed in 1 mins 1 seconds
Analysis used 59.73 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -528.52
Likelihood of best state for "cold" chain of run 2 was -528.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.7 % ( 39 %) Dirichlet(Pi{all})
34.6 % ( 24 %) Slider(Pi{all})
79.0 % ( 53 %) Multiplier(Alpha{1,2})
78.0 % ( 56 %) Multiplier(Alpha{3})
24.8 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.4 % ( 34 %) Dirichlet(Pi{all})
35.0 % ( 25 %) Slider(Pi{all})
78.9 % ( 57 %) Multiplier(Alpha{1,2})
77.8 % ( 48 %) Multiplier(Alpha{3})
25.9 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.0 % ( 31 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.3 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166905 0.82 0.67
3 | 166872 166925 0.84
4 | 166178 166474 166646
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167137 0.82 0.67
3 | 166346 166401 0.84
4 | 166646 166776 166694
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -530.39
| 12 2 2 |
| 1 12 1 2 1 1 |
| 1 2 2 *1 12 1 11 |
| 2 2 11 2 1 11 1 2 1 121 1 12 1 |
| 1 1 2 1 2 1 2 1 21 2|
| 2 1 * 2 2 12 |
| 2 2 2 2 1 12 1 12 |
| 1 1 12 * 1 2 2 2 2 1 2 |
|2 2 1 * 2 2 2 2 1 * 2 2 2 2 1|
|11 2 2 2 1 2 1 2 |
| 1 2 1 2 |
| 2 1 1 |
| 12 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -531.92
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -530.26 -532.95
2 -530.29 -535.08
--------------------------------------
TOTAL -530.28 -534.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897096 0.093916 0.369730 1.495452 0.861001 1501.00 1501.00 1.000
r(A<->C){all} 0.166624 0.019606 0.000028 0.444711 0.127808 175.73 207.20 1.002
r(A<->G){all} 0.176831 0.022523 0.000002 0.482408 0.138477 219.36 249.89 1.002
r(A<->T){all} 0.169030 0.020455 0.000004 0.455773 0.132443 115.23 187.71 1.001
r(C<->G){all} 0.162526 0.020404 0.000023 0.459395 0.123651 230.45 265.21 1.001
r(C<->T){all} 0.167506 0.019376 0.000036 0.444754 0.130127 202.22 255.62 1.000
r(G<->T){all} 0.157482 0.017545 0.000025 0.418547 0.122603 316.03 348.96 1.000
pi(A){all} 0.212222 0.000424 0.171364 0.251551 0.211281 1047.40 1144.15 1.000
pi(C){all} 0.278392 0.000521 0.233847 0.322837 0.278452 1266.55 1344.44 1.000
pi(G){all} 0.317333 0.000568 0.270671 0.362618 0.316695 1032.85 1208.08 1.000
pi(T){all} 0.192053 0.000389 0.151469 0.228530 0.191421 1333.15 1417.08 1.000
alpha{1,2} 0.400764 0.199982 0.000271 1.309040 0.252595 1226.20 1269.37 1.002
alpha{3} 0.460678 0.244375 0.000114 1.469624 0.302884 1097.34 1252.03 1.000
pinvar{all} 0.995945 0.000023 0.987126 0.999997 0.997444 1089.10 1178.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- .*...*
10 -- .*..*.
11 -- ...**.
12 -- .****.
13 -- ..*..*
14 -- .*.***
15 -- .*.*..
16 -- ..****
17 -- ..**..
18 -- ...*.*
19 -- ....**
20 -- .**.**
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.000942 0.153231 0.154564 2
8 452 0.150566 0.002827 0.148568 0.152565 2
9 441 0.146902 0.004240 0.143904 0.149900 2
10 437 0.145570 0.003298 0.143238 0.147901 2
11 437 0.145570 0.001413 0.144570 0.146569 2
12 436 0.145237 0.008480 0.139241 0.151233 2
13 435 0.144903 0.007066 0.139907 0.149900 2
14 433 0.144237 0.004240 0.141239 0.147235 2
15 431 0.143571 0.006124 0.139241 0.147901 2
16 426 0.141905 0.001884 0.140573 0.143238 2
17 423 0.140906 0.015546 0.129913 0.151899 2
18 422 0.140573 0.006595 0.135909 0.145237 2
19 421 0.140240 0.006124 0.135909 0.144570 2
20 412 0.137242 0.003769 0.134577 0.139907 2
21 382 0.127249 0.006595 0.122585 0.131912 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099093 0.010220 0.000025 0.291259 0.070904 1.000 2
length{all}[2] 0.103566 0.010665 0.000058 0.304138 0.072302 1.000 2
length{all}[3] 0.099187 0.009942 0.000023 0.294412 0.068911 1.000 2
length{all}[4] 0.099726 0.009722 0.000023 0.295521 0.068172 1.000 2
length{all}[5] 0.097871 0.009480 0.000045 0.295007 0.068435 1.000 2
length{all}[6] 0.100942 0.009928 0.000024 0.294532 0.070733 1.000 2
length{all}[7] 0.107889 0.010913 0.000218 0.310225 0.076133 0.999 2
length{all}[8] 0.097022 0.010972 0.000375 0.309674 0.065589 0.999 2
length{all}[9] 0.094874 0.008991 0.000321 0.265917 0.067727 0.998 2
length{all}[10] 0.102143 0.010608 0.000453 0.319333 0.068512 0.999 2
length{all}[11] 0.095583 0.007987 0.000250 0.271197 0.073581 1.003 2
length{all}[12] 0.105234 0.011291 0.000147 0.302611 0.073866 0.998 2
length{all}[13] 0.102360 0.010486 0.000125 0.296513 0.070566 0.999 2
length{all}[14] 0.095947 0.008914 0.000383 0.284201 0.066713 1.004 2
length{all}[15] 0.104992 0.009733 0.000115 0.313756 0.072850 1.005 2
length{all}[16] 0.094084 0.008876 0.000052 0.274042 0.066530 0.998 2
length{all}[17] 0.096591 0.007829 0.001235 0.257441 0.070794 0.998 2
length{all}[18] 0.102400 0.010490 0.000576 0.271906 0.077247 0.999 2
length{all}[19] 0.098644 0.008795 0.000761 0.302467 0.073660 1.000 2
length{all}[20] 0.105221 0.010656 0.000156 0.318874 0.072177 0.999 2
length{all}[21] 0.099932 0.009365 0.000060 0.298144 0.068172 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005276
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 387
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 129 / 129 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 129 / 129 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102487 0.020444 0.072594 0.081641 0.071446 0.095238 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -567.391008
Iterating by ming2
Initial: fx= 567.391008
x= 0.10249 0.02044 0.07259 0.08164 0.07145 0.09524 0.30000 1.30000
1 h-m-p 0.0000 0.0002 305.7446 +++ 552.196063 m 0.0002 14 | 1/8
2 h-m-p 0.0007 0.0053 68.6607 ++ 546.593276 m 0.0053 25 | 2/8
3 h-m-p 0.0006 0.0028 56.3208 ++ 543.135449 m 0.0028 36 | 3/8
4 h-m-p 0.0000 0.0001 85.7196 ++ 541.450300 m 0.0001 47 | 4/8
5 h-m-p 0.0005 0.0268 25.0169 -----------.. | 4/8
6 h-m-p 0.0000 0.0003 214.2510 +++ 528.448563 m 0.0003 79 | 5/8
7 h-m-p 0.0160 8.0000 11.7761 -------------.. | 5/8
8 h-m-p 0.0000 0.0004 175.4097 +++ 515.257139 m 0.0004 113 | 6/8
9 h-m-p 0.0160 8.0000 7.8277 -------------.. | 6/8
10 h-m-p 0.0000 0.0002 125.0749 +++ 511.685997 m 0.0002 147 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 ------------Y 511.685997 0 0.0000 170 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 +++++ 511.685997 m 8.0000 185 | 7/8
13 h-m-p 0.0054 2.6980 0.6039 --------N 511.685997 0 0.0000 205 | 7/8
14 h-m-p 0.0160 8.0000 0.0000 ---Y 511.685997 0 0.0001 220 | 7/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 511.685997 m 8.0000 235 | 7/8
16 h-m-p 0.0160 8.0000 0.7951 +++++ 511.685975 m 8.0000 250 | 7/8
17 h-m-p 1.6000 8.0000 0.3408 ++ 511.685973 m 8.0000 262 | 7/8
18 h-m-p 0.7772 8.0000 3.5081 ++ 511.685970 m 8.0000 274 | 7/8
19 h-m-p 1.6000 8.0000 3.6034 ++ 511.685969 m 8.0000 285 | 7/8
20 h-m-p 1.6000 8.0000 4.4221 -------------Y 511.685969 0 0.0000 309 | 7/8
21 h-m-p 0.4444 8.0000 0.0000 ----------Y 511.685969 0 0.0000 330 | 7/8
22 h-m-p 0.0160 8.0000 0.0000 -------C 511.685969 0 0.0000 349
Out..
lnL = -511.685969
350 lfun, 350 eigenQcodon, 2100 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018525 0.023264 0.015043 0.047557 0.030055 0.093740 0.000100 0.564406 0.140072
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.621809
np = 9
lnL0 = -539.426838
Iterating by ming2
Initial: fx= 539.426838
x= 0.01853 0.02326 0.01504 0.04756 0.03006 0.09374 0.00011 0.56441 0.14007
1 h-m-p 0.0000 0.0000 285.2227 ++ 538.938517 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0011 104.8655 ++++ 528.324964 m 0.0011 28 | 2/9
3 h-m-p 0.0000 0.0000 218.1475 ++ 526.717634 m 0.0000 40 | 3/9
4 h-m-p 0.0000 0.0002 174.2803 ++ 525.075275 m 0.0002 52 | 4/9
5 h-m-p 0.0000 0.0000 631.2324 ++ 524.907621 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0012 65.8681 +++ 514.734584 m 0.0012 77 | 6/9
7 h-m-p 0.0014 0.0133 12.5637 ++ 512.674078 m 0.0133 89 | 7/9
8 h-m-p 0.0021 0.0104 21.0740 ------------.. | 7/9
9 h-m-p 0.0000 0.0001 128.2197 ++ 511.686089 m 0.0001 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 511.686089 m 8.0000 135 | 7/9
11 h-m-p 0.0160 8.0000 0.0240 +++++ 511.686051 m 8.0000 151 | 7/9
12 h-m-p 0.7573 3.7864 0.1567 ++ 511.686012 m 3.7864 165 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 511.686012 0 1.6000 179 | 8/9
14 h-m-p 0.0011 0.5613 1.6243 +++++ 511.686012 m 0.5613 195 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 Y 511.686012 0 1.6000 207 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 Y 511.686012 0 0.0160 220
Out..
lnL = -511.686012
221 lfun, 663 eigenQcodon, 2652 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056404 0.080070 0.077639 0.062776 0.064804 0.082839 0.000100 1.763877 0.599736 0.330868 75.565104
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.146598
np = 11
lnL0 = -530.386700
Iterating by ming2
Initial: fx= 530.386700
x= 0.05640 0.08007 0.07764 0.06278 0.06480 0.08284 0.00011 1.76388 0.59974 0.33087 75.56510
1 h-m-p 0.0000 0.0000 38.9997 ++ 530.375540 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0363 14.0703 +++++ 524.428617 m 0.0363 33 | 2/11
3 h-m-p 0.0062 0.0308 10.6066 ++ 520.655666 m 0.0308 47 | 3/11
4 h-m-p 0.0000 0.0002 273.8409 ++ 520.234728 m 0.0002 61 | 4/11
5 h-m-p 0.0000 0.0001 726.5983 ++ 519.919606 m 0.0001 75 | 5/11
6 h-m-p 0.0002 0.0012 320.3120 ++ 516.645450 m 0.0012 89 | 6/11
7 h-m-p 0.0000 0.0000 9832.3141 ++ 515.678019 m 0.0000 103 | 7/11
8 h-m-p 0.0002 0.0012 527.7596 ++ 511.685989 m 0.0012 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 511.685989 m 8.0000 131 | 8/11
10 h-m-p 0.0160 8.0000 0.0142 --------Y 511.685989 0 0.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 511.685989 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 0.7052 ++++Y 511.685972 0 5.5053 197 | 8/11
13 h-m-p 1.6000 8.0000 0.1014 +Y 511.685972 0 4.1697 215 | 8/11
14 h-m-p 1.6000 8.0000 0.0060 Y 511.685972 0 1.0409 232 | 8/11
15 h-m-p 1.6000 8.0000 0.0006 +Y 511.685972 0 4.0000 250 | 8/11
16 h-m-p 1.6000 8.0000 0.0003 ++ 511.685972 m 8.0000 267 | 8/11
17 h-m-p 0.0980 8.0000 0.0263 ++C 511.685972 0 1.3538 286 | 8/11
18 h-m-p 1.6000 8.0000 0.0004 ++ 511.685972 m 8.0000 303 | 8/11
19 h-m-p 0.0160 8.0000 1.9604 +++++ 511.685969 m 8.0000 323 | 8/11
20 h-m-p 1.6000 8.0000 0.0075 ++ 511.685969 m 8.0000 337 | 8/11
21 h-m-p 0.5041 8.0000 0.1198 ----Y 511.685969 0 0.0005 358 | 8/11
22 h-m-p 0.0180 8.0000 0.0033 ----------Y 511.685969 0 0.0000 385 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 ----Y 511.685969 0 0.0000 406
Out..
lnL = -511.685969
407 lfun, 1628 eigenQcodon, 7326 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -511.683081 S = -511.682988 -0.000036
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:03
did 20 / 44 patterns 0:03
did 30 / 44 patterns 0:03
did 40 / 44 patterns 0:03
did 44 / 44 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056756 0.083058 0.078465 0.024409 0.039928 0.102567 0.000100 0.474718 1.478250
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.282945
np = 9
lnL0 = -558.301088
Iterating by ming2
Initial: fx= 558.301088
x= 0.05676 0.08306 0.07847 0.02441 0.03993 0.10257 0.00011 0.47472 1.47825
1 h-m-p 0.0000 0.0000 278.8445 ++ 558.128435 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0236 23.3063 ++++CYCCCC 555.891262 5 0.0166 39 | 1/9
3 h-m-p 0.0033 0.0166 8.4401 ------------.. | 1/9
4 h-m-p 0.0000 0.0002 281.8557 +++ 542.109151 m 0.0002 74 | 2/9
5 h-m-p 0.0001 0.0007 123.8258 ++ 532.864290 m 0.0007 86 | 3/9
6 h-m-p 0.0001 0.0003 244.4617 ++ 522.665076 m 0.0003 98 | 4/9
7 h-m-p 0.0011 0.0055 14.8801 ++ 522.164383 m 0.0055 110 | 5/9
8 h-m-p 0.0000 0.0002 205.7048 ++ 519.437879 m 0.0002 122 | 6/9
9 h-m-p 0.0033 0.1081 12.2870 ------------.. | 6/9
10 h-m-p 0.0000 0.0005 123.5997 +++ 511.686096 m 0.0005 157 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 511.686096 m 8.0000 169 | 7/9
12 h-m-p 0.0159 7.9668 0.0764 ---------Y 511.686096 0 0.0000 192 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 511.686096 m 8.0000 209 | 7/9
14 h-m-p 0.0160 8.0000 0.3569 +++++ 511.686068 m 8.0000 226 | 7/9
15 h-m-p 1.6000 8.0000 0.1480 ++ 511.686067 m 8.0000 240 | 7/9
16 h-m-p 0.7397 8.0000 1.6007 ++ 511.686062 m 8.0000 254 | 7/9
17 h-m-p 1.6000 8.0000 1.3815 ++ 511.686061 m 8.0000 266 | 7/9
18 h-m-p 1.6000 8.0000 1.5724 ++ 511.686061 m 8.0000 278 | 7/9
19 h-m-p 0.1736 0.8681 47.3192 ----------Y 511.686061 0 0.0000 300 | 7/9
20 h-m-p 0.0160 8.0000 0.0023 +++++ 511.686061 m 8.0000 315 | 7/9
21 h-m-p 0.1963 8.0000 0.0947 +++ 511.686061 m 8.0000 330 | 7/9
22 h-m-p 0.0120 1.1221 63.0702 ++++ 511.686061 m 1.1221 346 | 7/9
23 h-m-p 1.6000 8.0000 5.5788 ----------N 511.686061 0 0.0000 368 | 7/9
24 h-m-p 0.1500 0.7501 0.0000 -Y 511.686061 0 0.0094 381
Out..
lnL = -511.686061
382 lfun, 4202 eigenQcodon, 22920 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037790 0.051334 0.026293 0.074336 0.056366 0.064996 0.000100 0.900000 0.716312 1.121357 67.608492
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.467427
np = 11
lnL0 = -527.101125
Iterating by ming2
Initial: fx= 527.101125
x= 0.03779 0.05133 0.02629 0.07434 0.05637 0.06500 0.00011 0.90000 0.71631 1.12136 67.60849
1 h-m-p 0.0000 0.0000 86.1840 ++ 527.043092 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 81.4871 ++++ 522.616533 m 0.0008 32 | 2/11
3 h-m-p 0.0090 0.0449 6.4245 ++ 518.959590 m 0.0449 46 | 3/11
4 h-m-p 0.0000 0.0000 12566.6720 ++ 518.283000 m 0.0000 60 | 4/11
5 h-m-p 0.0001 0.0006 199.7829 ++ 516.801936 m 0.0006 74 | 5/11
6 h-m-p 0.0000 0.0000 2992.6154 ++ 515.796347 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 3537.6555 CYCYC 515.611398 4 0.0000 109 | 6/11
8 h-m-p 0.0019 0.0095 11.8497 ++ 514.848769 m 0.0095 123 | 7/11
9 h-m-p 0.0131 0.1232 1.6875 ++ 511.686146 m 0.1232 137 | 8/11
10 h-m-p 1.6000 8.0000 0.0004 ------------N 511.686146 0 0.0000 163
Out..
lnL = -511.686146
164 lfun, 1968 eigenQcodon, 10824 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -511.717816 S = -511.685885 -0.014086
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:12
did 20 / 44 patterns 0:12
did 30 / 44 patterns 0:12
did 40 / 44 patterns 0:13
did 44 / 44 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=129
NC_011896_1_WP_010908315_1_1476_MLBR_RS06975 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
NC_002677_1_NP_301994_1_866_rplT MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR
**************************************************
NC_011896_1_WP_010908315_1_1476_MLBR_RS06975 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
NC_002677_1_NP_301994_1_866_rplT RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810 RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI
**************************************************
NC_011896_1_WP_010908315_1_1476_MLBR_RS06975 SDPAAFTALVEVARSGLPEDVNVPSGEAA
NC_002677_1_NP_301994_1_866_rplT SDPAAFTALVEVARSGLPEDVNVPSGEAA
NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080 SDPAAFTALVEVARSGLPEDVNVPSGEAA
NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630 SDPAAFTALVEVARSGLPEDVNVPSGEAA
NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630 SDPAAFTALVEVARSGLPEDVNVPSGEAA
NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810 SDPAAFTALVEVARSGLPEDVNVPSGEAA
*****************************
>NC_011896_1_WP_010908315_1_1476_MLBR_RS06975 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT >NC_002677_1_NP_301994_1_866_rplT ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT >NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT >NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT >NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT >NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810 ATGGCACGCGTAAAGCGGGCAGTCAATGCCCATAAGAAGCGGCGCACTGT CTTGAAGGCTTCGAAAGGCTATCGCGGCCAGCGGTCCCGGCTCTATCGTA AAGCCAAAGAGCAGCAGCTGCATTCGTTGGGCTACGCTTACCGCGACCGT CGCGCGCGTAAGGGGGAGTTCCGCAAATTGTGGATTTCGCGAATCAACGC GGCTGCGCGCGCCAATGACATCACTTACAACCGGTTGATCCAGGGCCTGA AGGCTGCGGATGTCGACGTGGATCGCAAGAATCTCGCCGATATTGCGATC AGCGATCCGGCGGCGTTCACGGCGCTCGTTGAGGTTGCCCGGTCGGGGTT ACCCGAAGATGTCAACGTGCCATCCGGAGAAGCTGCT
>NC_011896_1_WP_010908315_1_1476_MLBR_RS06975 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA >NC_002677_1_NP_301994_1_866_rplT MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA >NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA >NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA >NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA >NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810 MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDR RARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAI SDPAAFTALVEVARSGLPEDVNVPSGEAA
#NEXUS
[ID: 0810766796]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908315_1_1476_MLBR_RS06975
NC_002677_1_NP_301994_1_866_rplT
NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080
NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630
NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630
NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908315_1_1476_MLBR_RS06975,
2 NC_002677_1_NP_301994_1_866_rplT,
3 NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080,
4 NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630,
5 NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630,
6 NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07090368,2:0.0723019,3:0.06891092,4:0.06817221,5:0.06843493,6:0.07073257);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07090368,2:0.0723019,3:0.06891092,4:0.06817221,5:0.06843493,6:0.07073257);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -530.26 -532.95
2 -530.29 -535.08
--------------------------------------
TOTAL -530.28 -534.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897096 0.093916 0.369730 1.495452 0.861001 1501.00 1501.00 1.000
r(A<->C){all} 0.166624 0.019606 0.000028 0.444711 0.127808 175.73 207.20 1.002
r(A<->G){all} 0.176831 0.022523 0.000002 0.482408 0.138477 219.36 249.89 1.002
r(A<->T){all} 0.169030 0.020455 0.000004 0.455773 0.132443 115.23 187.71 1.001
r(C<->G){all} 0.162526 0.020404 0.000023 0.459395 0.123651 230.45 265.21 1.001
r(C<->T){all} 0.167506 0.019376 0.000036 0.444754 0.130127 202.22 255.62 1.000
r(G<->T){all} 0.157482 0.017545 0.000025 0.418547 0.122603 316.03 348.96 1.000
pi(A){all} 0.212222 0.000424 0.171364 0.251551 0.211281 1047.40 1144.15 1.000
pi(C){all} 0.278392 0.000521 0.233847 0.322837 0.278452 1266.55 1344.44 1.000
pi(G){all} 0.317333 0.000568 0.270671 0.362618 0.316695 1032.85 1208.08 1.000
pi(T){all} 0.192053 0.000389 0.151469 0.228530 0.191421 1333.15 1417.08 1.000
alpha{1,2} 0.400764 0.199982 0.000271 1.309040 0.252595 1226.20 1269.37 1.002
alpha{3} 0.460678 0.244375 0.000114 1.469624 0.302884 1097.34 1252.03 1.000
pinvar{all} 0.995945 0.000023 0.987126 0.999997 0.997444 1089.10 1178.27 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplT/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 129
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 8 8 8 8 8 8
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 4 4 4 4 4 4 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 0 0 0 0 0 0 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 7 7 7 7 7 7 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 6 6 6 6 6 | Asp GAT 5 5 5 5 5 5 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 4 4 4 | GCC 5 5 5 5 5 5 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 8 8 8 8 8 8 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908315_1_1476_MLBR_RS06975
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
#2: NC_002677_1_NP_301994_1_866_rplT
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
#3: NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
#4: NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
#5: NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
#6: NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 18
CTC 18 | CCC 6 | CAC 0 | CGC 48
CTA 0 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 12 | CCG 6 | CAG 24 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 0
ATC 24 | ACC 0 | AAC 18 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 42 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 36 | Asp D GAT 30 | Gly G GGT 0
GTC 24 | GCC 30 | GAC 18 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 12 | GGA 6
GTG 12 | GCG 48 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14729 C:0.24806 A:0.21705 G:0.38760
position 2: T:0.21705 C:0.25581 A:0.31783 G:0.20930
position 3: T:0.20930 C:0.33333 A:0.10078 G:0.35659
Average T:0.19121 C:0.27907 A:0.21189 G:0.31783
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -511.685969 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 67.608492
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908315_1_1476_MLBR_RS06975: 0.000004, NC_002677_1_NP_301994_1_866_rplT: 0.000004, NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080: 0.000004, NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630: 0.000004, NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630: 0.000004, NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 67.60849
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
7..2 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
7..3 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
7..4 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
7..5 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
7..6 0.000 316.9 70.1 67.6085 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -511.686012 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908315_1_1476_MLBR_RS06975: 0.000004, NC_002677_1_NP_301994_1_866_rplT: 0.000004, NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080: 0.000004, NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630: 0.000004, NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630: 0.000004, NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 316.9 70.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -511.685969 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000003 0.000661 0.000001 78.609824
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908315_1_1476_MLBR_RS06975: 0.000004, NC_002677_1_NP_301994_1_866_rplT: 0.000004, NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080: 0.000004, NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630: 0.000004, NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630: 0.000004, NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00066 0.99934
w: 0.00000 1.00000 78.60982
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
7..2 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
7..3 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
7..4 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
7..5 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
7..6 0.000 316.9 70.1 78.5582 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908315_1_1476_MLBR_RS06975)
Pr(w>1) post mean +- SE for w
1 M 0.999** 78.558
2 A 0.999** 78.558
3 R 0.999** 78.558
4 V 0.999** 78.558
5 K 0.999** 78.558
6 R 0.999** 78.558
7 A 0.999** 78.558
8 V 0.999** 78.558
9 N 0.999** 78.558
10 A 0.999** 78.558
11 H 0.999** 78.558
12 K 0.999** 78.558
13 K 0.999** 78.558
14 R 0.999** 78.558
15 R 0.999** 78.558
16 T 0.999** 78.558
17 V 0.999** 78.558
18 L 0.999** 78.558
19 K 0.999** 78.558
20 A 0.999** 78.558
21 S 0.999** 78.558
22 K 0.999** 78.558
23 G 0.999** 78.558
24 Y 0.999** 78.558
25 R 0.999** 78.558
26 G 0.999** 78.558
27 Q 0.999** 78.558
28 R 0.999** 78.558
29 S 0.999** 78.558
30 R 0.999** 78.558
31 L 0.999** 78.558
32 Y 0.999** 78.558
33 R 0.999** 78.558
34 K 0.999** 78.558
35 A 0.999** 78.558
36 K 0.999** 78.558
37 E 0.999** 78.558
38 Q 0.999** 78.558
39 Q 0.999** 78.558
40 L 0.999** 78.558
41 H 0.999** 78.558
42 S 0.999** 78.558
43 L 0.999** 78.558
44 G 0.999** 78.558
45 Y 0.999** 78.558
46 A 0.999** 78.558
47 Y 0.999** 78.558
48 R 0.999** 78.558
49 D 0.999** 78.558
50 R 0.999** 78.558
51 R 0.999** 78.558
52 A 0.999** 78.558
53 R 0.999** 78.558
54 K 0.999** 78.558
55 G 0.999** 78.558
56 E 0.999** 78.558
57 F 0.999** 78.558
58 R 0.999** 78.558
59 K 0.999** 78.558
60 L 0.999** 78.558
61 W 0.999** 78.558
62 I 0.999** 78.558
63 S 0.999** 78.558
64 R 0.999** 78.558
65 I 0.999** 78.558
66 N 0.999** 78.558
67 A 0.999** 78.558
68 A 0.999** 78.558
69 A 0.999** 78.558
70 R 0.999** 78.558
71 A 0.999** 78.558
72 N 0.999** 78.558
73 D 0.999** 78.558
74 I 0.999** 78.558
75 T 0.999** 78.558
76 Y 0.999** 78.558
77 N 0.999** 78.558
78 R 0.999** 78.558
79 L 0.999** 78.558
80 I 0.999** 78.558
81 Q 0.999** 78.558
82 G 0.999** 78.558
83 L 0.999** 78.558
84 K 0.999** 78.558
85 A 0.999** 78.558
86 A 0.999** 78.558
87 D 0.999** 78.558
88 V 0.999** 78.558
89 D 0.999** 78.558
90 V 0.999** 78.558
91 D 0.999** 78.558
92 R 0.999** 78.558
93 K 0.999** 78.558
94 N 0.999** 78.558
95 L 0.999** 78.558
96 A 0.999** 78.558
97 D 0.999** 78.558
98 I 0.999** 78.558
99 A 0.999** 78.558
100 I 0.999** 78.558
101 S 0.999** 78.558
102 D 0.999** 78.558
103 P 0.999** 78.558
104 A 0.999** 78.558
105 A 0.999** 78.558
106 F 0.999** 78.558
107 T 0.999** 78.558
108 A 0.999** 78.558
109 L 0.999** 78.558
110 V 0.999** 78.558
111 E 0.999** 78.558
112 V 0.999** 78.558
113 A 0.999** 78.558
114 R 0.999** 78.558
115 S 0.999** 78.558
116 G 0.999** 78.558
117 L 0.999** 78.558
118 P 0.999** 78.558
119 E 0.999** 78.558
120 D 0.999** 78.558
121 V 0.999** 78.558
122 N 0.999** 78.558
123 V 0.999** 78.558
124 P 0.999** 78.558
125 S 0.999** 78.558
126 G 0.999** 78.558
127 E 0.999** 78.558
128 A 0.999** 78.558
129 A 0.999** 78.558
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908315_1_1476_MLBR_RS06975)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -511.686061 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 54.945488 98.999998
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908315_1_1476_MLBR_RS06975: 0.000004, NC_002677_1_NP_301994_1_866_rplT: 0.000004, NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080: 0.000004, NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630: 0.000004, NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630: 0.000004, NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 54.94549 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.29466 0.31696 0.33052 0.34149 0.35145 0.36116 0.37128 0.38263 0.39696 0.42129
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
7..2 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
7..3 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
7..4 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
7..5 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
7..6 0.000 316.9 70.1 0.3568 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -511.686146 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.998875 0.005000 1.317783 67.628066
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908315_1_1476_MLBR_RS06975: 0.000004, NC_002677_1_NP_301994_1_866_rplT: 0.000004, NZ_LVXE01000004_1_WP_010908315_1_1789_A3216_RS03080: 0.000004, NZ_LYPH01000077_1_WP_010908315_1_2622_A8144_RS12630: 0.000004, NZ_CP029543_1_WP_010908315_1_1498_DIJ64_RS07630: 0.000004, NZ_AP014567_1_WP_010908315_1_1534_JK2ML_RS07810: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99887 p = 0.00500 q = 1.31778
(p1 = 0.00113) w = 67.62807
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09989 0.09989 0.09989 0.09989 0.09989 0.09989 0.09989 0.09989 0.09989 0.09989 0.00113
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 67.62807
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
7..2 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
7..3 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
7..4 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
7..5 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
7..6 0.000 316.9 70.1 0.0761 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908315_1_1476_MLBR_RS06975)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908315_1_1476_MLBR_RS06975)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:13
Model 1: NearlyNeutral -511.686012 Model 2: PositiveSelection -511.685969 Model 0: one-ratio -511.685969 Model 7: beta -511.686061 Model 8: beta&w>1 -511.686146 Model 0 vs 1 8.600000001024455E-5 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 1.700000000255386E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
