--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:47:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplU/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -426.07 -428.78
2 -426.08 -429.88
--------------------------------------
TOTAL -426.08 -429.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890360 0.088058 0.369499 1.487910 0.863325 1428.31 1464.65 1.000
r(A<->C){all} 0.177335 0.021563 0.000022 0.468229 0.139267 241.48 247.15 1.003
r(A<->G){all} 0.162645 0.018597 0.000023 0.446616 0.126906 225.44 229.18 1.013
r(A<->T){all} 0.159084 0.018157 0.000039 0.419760 0.123905 186.29 222.40 1.000
r(C<->G){all} 0.168732 0.019430 0.000017 0.445961 0.133844 167.76 245.67 1.000
r(C<->T){all} 0.176270 0.022272 0.000509 0.483223 0.136686 205.00 206.71 1.001
r(G<->T){all} 0.155935 0.018131 0.000001 0.424579 0.118945 226.10 233.09 1.000
pi(A){all} 0.255775 0.000608 0.208735 0.305712 0.255851 1309.16 1405.08 1.000
pi(C){all} 0.284099 0.000661 0.240210 0.340056 0.283462 1241.33 1340.68 1.000
pi(G){all} 0.274890 0.000612 0.226893 0.322496 0.274518 1369.16 1435.08 1.000
pi(T){all} 0.185235 0.000477 0.143932 0.229971 0.184731 1419.48 1460.24 1.000
alpha{1,2} 0.408928 0.216801 0.000140 1.340468 0.236217 1271.79 1312.80 1.000
alpha{3} 0.459584 0.246332 0.000116 1.486232 0.288680 1202.07 1223.50 1.000
pinvar{all} 0.994659 0.000047 0.981823 0.999999 0.996779 1043.15 1140.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -388.655683
Model 2: PositiveSelection -388.655674
Model 0: one-ratio -388.655743
Model 7: beta -388.655655
Model 8: beta&w>1 -388.65568
Model 0 vs 1 1.199999999244028E-4
Model 2 vs 1 1.8000000068241206E-5
Model 8 vs 7 4.999999998744897E-5
>C1
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C2
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C3
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C4
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C5
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C6
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
C1 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C2 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C3 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C4 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C5 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C6 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
**************************************************
C1 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C2 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C3 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C4 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C5 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C6 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
**************************************************
C1 GIK
C2 GIK
C3 GIK
C4 GIK
C5 GIK
C6 GIK
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3090]--->[3090]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.628 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C2 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C3 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C4 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C5 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C6 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
**************************************************
C1 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C2 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C3 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C4 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C5 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C6 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
**************************************************
C1 GIK
C2 GIK
C3 GIK
C4 GIK
C5 GIK
C6 GIK
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C2 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C3 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C4 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C5 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C6 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
**************************************************
C1 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C2 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C3 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C4 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C5 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C6 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
**************************************************
C1 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C2 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C3 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C4 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C5 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C6 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
**************************************************
C1 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C2 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C3 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C4 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C5 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C6 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
**************************************************
C1 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C2 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C3 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C4 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C5 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C6 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
**************************************************
C1 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C2 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C3 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C4 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C5 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C6 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
**************************************************
C1 GGCATCAAG
C2 GGCATCAAG
C3 GGCATCAAG
C4 GGCATCAAG
C5 GGCATCAAG
C6 GGCATCAAG
*********
>C1
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C2
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C3
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C4
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C5
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C6
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C1
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C2
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C3
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C4
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C5
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C6
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 309 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790802
Setting output file names to "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 464146562
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0897259577
Seed = 694830043
Swapseed = 1579790802
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -691.556816 -- -24.965149
Chain 2 -- -691.556816 -- -24.965149
Chain 3 -- -691.556816 -- -24.965149
Chain 4 -- -691.556816 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -691.556776 -- -24.965149
Chain 2 -- -691.556710 -- -24.965149
Chain 3 -- -691.556776 -- -24.965149
Chain 4 -- -691.556776 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-691.557] (-691.557) (-691.557) (-691.557) * [-691.557] (-691.557) (-691.557) (-691.557)
500 -- (-432.902) (-435.392) (-445.826) [-436.646] * (-439.804) (-433.193) (-434.759) [-438.243] -- 0:00:00
1000 -- (-434.644) [-432.544] (-435.700) (-433.473) * (-438.250) (-434.307) [-432.910] (-435.115) -- 0:00:00
1500 -- (-438.818) [-437.567] (-440.337) (-437.387) * (-445.991) (-435.307) [-431.835] (-431.327) -- 0:00:00
2000 -- (-433.041) (-433.473) [-432.488] (-430.646) * (-446.245) (-438.906) (-436.740) [-432.414] -- 0:00:00
2500 -- (-446.168) [-436.187] (-441.270) (-438.211) * (-430.240) (-445.195) [-435.933] (-436.016) -- 0:00:00
3000 -- (-436.094) (-440.753) [-440.929] (-431.701) * [-433.097] (-432.830) (-435.401) (-451.608) -- 0:00:00
3500 -- (-430.524) (-438.572) (-439.520) [-431.075] * (-443.358) [-435.297] (-431.930) (-431.933) -- 0:04:44
4000 -- (-435.339) (-428.953) [-437.107] (-438.706) * [-436.783] (-432.412) (-435.902) (-434.274) -- 0:04:09
4500 -- (-434.419) [-433.456] (-431.075) (-438.211) * (-433.414) (-437.790) (-442.189) [-432.685] -- 0:03:41
5000 -- (-441.895) (-435.800) (-432.193) [-431.453] * [-437.512] (-454.048) (-439.945) (-443.529) -- 0:03:19
Average standard deviation of split frequencies: 0.074826
5500 -- (-444.101) (-440.962) [-433.035] (-434.321) * (-431.983) (-445.389) [-438.972] (-435.679) -- 0:03:00
6000 -- [-433.525] (-438.303) (-433.092) (-438.604) * [-431.396] (-434.990) (-440.235) (-438.157) -- 0:02:45
6500 -- [-436.326] (-439.926) (-433.333) (-450.140) * [-436.640] (-433.982) (-436.943) (-442.331) -- 0:02:32
7000 -- (-436.894) [-436.077] (-443.773) (-434.885) * (-439.220) [-425.461] (-437.104) (-439.553) -- 0:02:21
7500 -- [-435.491] (-434.842) (-434.863) (-429.303) * (-431.475) (-425.818) (-442.212) [-434.837] -- 0:02:12
8000 -- [-428.366] (-445.908) (-440.290) (-431.526) * (-435.592) (-424.841) (-438.247) [-435.493] -- 0:02:04
8500 -- (-431.147) [-435.619] (-434.318) (-427.365) * (-431.184) (-430.253) (-430.472) [-430.868] -- 0:01:56
9000 -- (-435.672) (-456.631) (-445.197) [-427.905] * (-435.386) [-425.613] (-442.519) (-437.937) -- 0:01:50
9500 -- (-434.811) (-451.998) (-435.067) [-428.734] * (-438.151) (-425.896) (-432.529) [-432.628] -- 0:01:44
10000 -- [-439.171] (-439.558) (-430.791) (-426.185) * (-439.234) (-426.793) [-432.289] (-443.954) -- 0:01:39
Average standard deviation of split frequencies: 0.061381
10500 -- (-432.585) [-430.087] (-433.103) (-427.102) * (-435.576) (-427.109) [-433.631] (-445.788) -- 0:01:34
11000 -- [-435.137] (-429.364) (-434.864) (-426.869) * (-440.691) [-428.715] (-438.446) (-430.843) -- 0:01:29
11500 -- (-443.919) (-425.262) [-442.923] (-424.911) * [-441.943] (-429.205) (-436.646) (-426.157) -- 0:01:25
12000 -- (-437.166) (-425.903) (-440.191) [-429.543] * (-435.652) (-430.505) [-435.835] (-429.926) -- 0:01:22
12500 -- (-447.554) [-425.602] (-447.531) (-425.854) * [-431.275] (-425.140) (-431.217) (-425.139) -- 0:01:19
13000 -- [-437.346] (-428.836) (-438.022) (-427.867) * (-435.232) (-428.389) (-436.714) [-427.138] -- 0:01:15
13500 -- [-437.229] (-431.399) (-433.253) (-425.595) * (-435.021) (-427.730) (-439.354) [-427.394] -- 0:01:13
14000 -- (-443.960) [-425.546] (-438.370) (-425.493) * [-434.551] (-431.804) (-440.418) (-426.492) -- 0:01:10
14500 -- (-432.079) (-431.943) [-438.087] (-427.264) * (-441.341) (-429.001) (-440.952) [-426.550] -- 0:01:07
15000 -- (-437.818) [-427.940] (-440.425) (-428.429) * (-433.226) (-430.427) (-437.187) [-427.423] -- 0:01:05
Average standard deviation of split frequencies: 0.050741
15500 -- (-437.571) (-427.552) (-436.957) [-425.133] * (-434.668) (-432.124) (-440.361) [-430.009] -- 0:01:03
16000 -- (-440.579) (-429.237) (-438.947) [-425.684] * (-438.509) [-428.079] (-434.152) (-426.318) -- 0:01:01
16500 -- (-439.846) [-426.380] (-444.481) (-429.183) * (-431.755) (-425.434) (-443.339) [-426.523] -- 0:00:59
17000 -- (-439.757) (-427.728) [-433.309] (-429.720) * (-445.772) (-429.388) (-438.297) [-426.087] -- 0:00:57
17500 -- (-445.921) (-429.504) (-436.352) [-428.350] * (-439.583) (-430.306) [-431.252] (-435.975) -- 0:00:56
18000 -- [-435.969] (-426.557) (-438.606) (-431.778) * (-440.369) (-429.612) (-445.197) [-425.540] -- 0:00:54
18500 -- (-443.344) [-425.785] (-435.151) (-425.980) * (-440.645) (-426.344) (-442.143) [-424.842] -- 0:00:53
19000 -- (-435.141) (-428.689) (-438.760) [-425.880] * (-440.658) (-427.401) [-439.746] (-428.984) -- 0:01:43
19500 -- (-442.923) (-428.877) (-437.648) [-425.917] * [-433.041] (-428.133) (-438.722) (-425.611) -- 0:01:40
20000 -- [-444.668] (-428.650) (-436.251) (-425.510) * [-433.977] (-425.687) (-435.698) (-426.070) -- 0:01:38
Average standard deviation of split frequencies: 0.063361
20500 -- [-434.926] (-426.469) (-434.076) (-433.684) * [-436.706] (-427.683) (-439.974) (-427.456) -- 0:01:35
21000 -- (-438.292) (-426.763) (-435.904) [-427.721] * (-432.480) (-427.009) (-439.361) [-426.754] -- 0:01:33
21500 -- (-443.903) (-425.203) (-435.769) [-425.828] * (-437.403) (-428.075) [-435.900] (-427.181) -- 0:01:31
22000 -- (-442.453) (-427.793) [-430.754] (-435.227) * (-434.524) (-426.124) (-435.504) [-427.350] -- 0:01:28
22500 -- (-433.414) (-428.010) (-440.380) [-425.694] * (-434.077) (-424.451) [-425.224] (-428.228) -- 0:01:26
23000 -- (-435.082) (-426.429) [-431.455] (-425.259) * (-434.632) (-427.311) (-425.377) [-426.948] -- 0:01:24
23500 -- (-428.859) (-426.488) (-437.445) [-425.445] * (-437.486) (-427.673) (-426.854) [-427.805] -- 0:01:23
24000 -- (-425.828) (-425.134) (-455.237) [-426.426] * (-438.561) (-429.105) [-426.178] (-428.201) -- 0:01:21
24500 -- [-426.701] (-425.279) (-439.344) (-425.250) * [-432.443] (-428.817) (-425.748) (-426.401) -- 0:01:19
25000 -- [-427.339] (-431.645) (-435.577) (-426.347) * (-433.184) (-424.687) (-426.214) [-427.768] -- 0:01:18
Average standard deviation of split frequencies: 0.056301
25500 -- [-427.474] (-426.895) (-433.524) (-426.503) * [-429.179] (-428.307) (-426.573) (-425.478) -- 0:01:16
26000 -- (-426.984) (-427.057) (-430.782) [-425.435] * (-427.017) [-429.599] (-429.781) (-426.009) -- 0:01:14
26500 -- [-427.629] (-425.298) (-434.197) (-425.701) * [-428.998] (-425.874) (-436.789) (-425.684) -- 0:01:13
27000 -- (-425.555) [-425.437] (-434.610) (-432.315) * (-430.613) (-424.872) [-428.335] (-425.782) -- 0:01:12
27500 -- (-428.909) [-429.599] (-440.885) (-427.341) * (-426.022) [-427.448] (-427.675) (-425.079) -- 0:01:10
28000 -- (-426.554) [-429.020] (-441.200) (-430.922) * [-427.775] (-426.686) (-426.835) (-426.210) -- 0:01:09
28500 -- (-425.748) [-427.209] (-438.493) (-431.956) * (-426.335) [-427.889] (-428.044) (-429.926) -- 0:01:08
29000 -- (-425.855) [-425.823] (-440.670) (-426.762) * (-426.851) [-425.277] (-428.445) (-426.823) -- 0:01:06
29500 -- (-426.346) (-427.017) (-433.093) [-425.875] * (-424.926) [-426.278] (-431.955) (-426.651) -- 0:01:05
30000 -- (-425.552) (-428.132) (-433.504) [-424.842] * (-426.892) (-428.034) [-426.030] (-427.192) -- 0:01:04
Average standard deviation of split frequencies: 0.051240
30500 -- (-429.223) (-425.231) [-433.130] (-428.965) * (-426.122) (-425.166) [-425.929] (-425.447) -- 0:01:03
31000 -- (-427.020) [-426.354] (-434.595) (-425.693) * (-427.628) (-428.136) [-426.588] (-428.027) -- 0:01:02
31500 -- [-426.469] (-425.076) (-434.863) (-425.304) * (-426.282) [-425.031] (-427.119) (-430.321) -- 0:01:01
32000 -- (-426.817) (-426.355) [-433.125] (-426.946) * (-426.674) [-427.606] (-426.207) (-429.369) -- 0:01:00
32500 -- (-426.379) [-427.947] (-437.787) (-430.431) * [-425.217] (-427.609) (-427.986) (-425.439) -- 0:00:59
33000 -- [-427.806] (-426.884) (-435.401) (-431.143) * [-427.380] (-427.035) (-424.791) (-425.363) -- 0:00:58
33500 -- (-429.279) (-425.853) [-435.390] (-425.534) * (-427.049) (-429.965) (-432.347) [-425.304] -- 0:00:57
34000 -- (-426.772) (-431.627) (-432.265) [-427.286] * (-426.292) (-432.383) (-425.832) [-426.970] -- 0:00:56
34500 -- (-427.360) (-428.015) [-432.824] (-426.450) * (-426.526) (-428.327) (-427.307) [-433.614] -- 0:00:55
35000 -- (-427.000) (-426.104) [-436.421] (-427.064) * [-424.823] (-429.677) (-425.742) (-427.627) -- 0:01:22
Average standard deviation of split frequencies: 0.041351
35500 -- (-425.813) (-426.636) [-438.137] (-429.154) * (-424.723) [-427.666] (-434.824) (-425.873) -- 0:01:21
36000 -- (-428.475) (-427.286) [-434.929] (-426.968) * (-424.946) (-429.748) (-428.058) [-426.043] -- 0:01:20
36500 -- (-425.595) (-425.687) [-435.964] (-426.515) * [-429.268] (-427.196) (-425.537) (-429.089) -- 0:01:19
37000 -- [-426.503] (-426.137) (-432.439) (-432.364) * [-425.584] (-428.848) (-424.975) (-427.487) -- 0:01:18
37500 -- (-428.291) (-428.162) [-434.482] (-428.892) * (-425.243) (-426.363) [-425.862] (-428.266) -- 0:01:17
38000 -- [-425.813] (-428.996) (-433.544) (-430.067) * [-429.578] (-429.212) (-428.140) (-425.642) -- 0:01:15
38500 -- [-426.847] (-427.254) (-433.845) (-430.448) * (-428.149) [-428.753] (-426.389) (-425.905) -- 0:01:14
39000 -- [-426.728] (-427.380) (-446.836) (-430.741) * [-433.100] (-425.521) (-426.585) (-429.021) -- 0:01:13
39500 -- (-426.574) [-425.310] (-441.234) (-425.703) * [-426.829] (-426.059) (-426.098) (-426.257) -- 0:01:12
40000 -- (-427.005) (-426.842) [-433.581] (-427.203) * (-429.762) (-425.440) [-426.361] (-425.129) -- 0:01:12
Average standard deviation of split frequencies: 0.035996
40500 -- [-426.532] (-424.929) (-436.144) (-425.905) * (-426.661) [-425.222] (-426.580) (-427.896) -- 0:01:11
41000 -- (-429.177) (-427.305) (-438.639) [-427.583] * (-425.898) [-426.091] (-425.858) (-427.295) -- 0:01:10
41500 -- (-427.417) (-426.197) (-447.814) [-425.258] * [-426.324] (-427.056) (-425.055) (-428.733) -- 0:01:09
42000 -- (-428.997) [-426.250] (-442.182) (-425.427) * (-426.878) (-428.898) (-427.830) [-429.217] -- 0:01:08
42500 -- [-426.682] (-425.366) (-433.861) (-425.802) * [-427.011] (-433.050) (-426.745) (-426.957) -- 0:01:07
43000 -- (-429.051) [-425.482] (-440.977) (-426.630) * [-426.192] (-428.285) (-425.682) (-438.509) -- 0:01:06
43500 -- [-430.706] (-425.828) (-442.001) (-427.074) * (-434.568) [-425.730] (-425.496) (-427.917) -- 0:01:05
44000 -- (-426.661) (-430.791) [-441.057] (-425.372) * (-428.948) (-426.732) [-427.699] (-428.955) -- 0:01:05
44500 -- (-426.921) [-427.245] (-440.436) (-426.333) * [-426.469] (-426.241) (-425.742) (-427.662) -- 0:01:04
45000 -- (-425.286) (-428.729) [-432.649] (-424.933) * [-424.978] (-428.300) (-427.358) (-426.991) -- 0:01:03
Average standard deviation of split frequencies: 0.032793
45500 -- [-425.550] (-427.732) (-455.136) (-428.333) * (-427.257) [-427.931] (-426.047) (-427.185) -- 0:01:02
46000 -- (-426.649) (-429.990) (-428.792) [-425.322] * [-425.272] (-426.518) (-427.768) (-426.074) -- 0:01:02
46500 -- [-426.491] (-433.392) (-428.856) (-426.270) * (-425.442) (-428.073) (-426.041) [-426.594] -- 0:01:01
47000 -- [-428.528] (-427.170) (-430.953) (-427.464) * [-424.759] (-432.328) (-426.292) (-425.594) -- 0:01:00
47500 -- (-424.766) (-430.620) [-425.865] (-426.343) * (-426.516) (-427.475) (-426.688) [-427.367] -- 0:01:00
48000 -- (-425.481) (-431.320) (-425.672) [-427.216] * (-425.477) (-427.830) [-426.099] (-426.499) -- 0:00:59
48500 -- (-427.010) [-425.753] (-435.042) (-425.077) * (-425.550) [-427.208] (-426.154) (-426.293) -- 0:00:58
49000 -- (-424.791) [-424.507] (-426.081) (-425.606) * [-425.852] (-426.153) (-424.582) (-428.436) -- 0:00:58
49500 -- (-426.553) (-425.204) (-425.638) [-426.931] * [-425.233] (-427.566) (-435.548) (-426.849) -- 0:00:57
50000 -- (-426.470) (-424.988) [-427.812] (-429.547) * [-426.487] (-426.947) (-433.901) (-426.777) -- 0:00:57
Average standard deviation of split frequencies: 0.029773
50500 -- (-428.959) (-424.810) (-426.845) [-425.436] * (-425.959) (-426.399) (-435.225) [-428.329] -- 0:00:56
51000 -- [-429.716] (-428.888) (-427.110) (-428.269) * (-431.195) (-428.780) (-427.498) [-427.764] -- 0:01:14
51500 -- (-426.715) (-427.218) [-427.485] (-425.914) * [-425.710] (-427.132) (-426.839) (-427.668) -- 0:01:13
52000 -- (-426.371) (-426.034) [-424.703] (-427.071) * [-425.393] (-426.824) (-432.344) (-425.996) -- 0:01:12
52500 -- (-427.457) (-425.239) [-425.969] (-429.846) * (-425.066) (-427.191) (-426.033) [-425.940] -- 0:01:12
53000 -- (-427.814) (-424.793) [-427.558] (-426.254) * (-426.637) (-427.154) (-424.751) [-427.658] -- 0:01:11
53500 -- (-425.984) [-425.188] (-425.174) (-425.899) * (-424.993) (-428.004) [-426.347] (-425.302) -- 0:01:10
54000 -- (-425.924) (-425.724) (-427.228) [-426.104] * (-424.631) [-425.334] (-426.632) (-428.443) -- 0:01:10
54500 -- (-425.564) (-429.041) (-425.517) [-424.779] * (-428.340) (-425.480) [-427.294] (-426.949) -- 0:01:09
55000 -- [-425.487] (-427.431) (-425.683) (-427.334) * (-425.901) (-429.426) (-433.922) [-426.166] -- 0:01:08
Average standard deviation of split frequencies: 0.028621
55500 -- (-425.555) [-425.848] (-426.928) (-425.130) * (-428.644) (-425.961) [-428.004] (-426.311) -- 0:01:08
56000 -- [-426.530] (-430.388) (-430.050) (-426.588) * (-426.751) (-426.089) [-426.261] (-425.398) -- 0:01:07
56500 -- [-425.442] (-429.025) (-428.831) (-427.826) * [-427.168] (-431.645) (-429.477) (-427.054) -- 0:01:06
57000 -- [-426.307] (-426.189) (-426.543) (-426.621) * (-426.815) (-428.319) (-426.549) [-425.828] -- 0:01:06
57500 -- (-427.320) [-425.481] (-426.461) (-425.739) * [-425.443] (-429.583) (-425.100) (-425.386) -- 0:01:05
58000 -- (-429.113) [-426.268] (-428.181) (-425.343) * [-425.489] (-428.850) (-424.855) (-429.696) -- 0:01:04
58500 -- (-428.008) (-425.213) (-424.989) [-425.300] * (-430.810) (-428.413) (-426.354) [-426.665] -- 0:01:04
59000 -- (-428.597) (-429.330) [-427.667] (-425.310) * (-426.117) (-427.825) (-430.764) [-425.618] -- 0:01:03
59500 -- [-427.377] (-432.823) (-427.778) (-425.245) * (-425.470) [-428.406] (-426.939) (-425.304) -- 0:01:03
60000 -- (-426.376) (-427.928) (-427.381) [-425.432] * [-425.246] (-426.713) (-426.129) (-425.694) -- 0:01:02
Average standard deviation of split frequencies: 0.034578
60500 -- [-425.701] (-427.101) (-427.556) (-425.547) * (-425.902) [-425.842] (-428.249) (-425.825) -- 0:01:02
61000 -- (-432.860) [-427.065] (-425.162) (-425.234) * [-426.278] (-429.889) (-428.210) (-427.386) -- 0:01:01
61500 -- (-433.095) (-425.084) (-428.648) [-424.998] * (-425.846) [-429.766] (-425.476) (-428.330) -- 0:01:01
62000 -- (-428.676) [-425.612] (-425.593) (-429.435) * (-429.749) (-429.078) (-427.559) [-426.911] -- 0:01:00
62500 -- (-425.626) (-426.549) (-424.829) [-425.056] * (-426.252) (-426.314) [-427.110] (-426.324) -- 0:01:00
63000 -- (-424.983) [-427.955] (-426.081) (-425.551) * (-426.494) (-427.074) [-427.842] (-427.320) -- 0:00:59
63500 -- (-424.758) (-427.157) [-424.932] (-425.422) * (-428.020) [-426.019] (-425.187) (-427.220) -- 0:00:58
64000 -- (-426.136) (-425.821) [-426.135] (-429.206) * (-425.738) [-427.958] (-426.278) (-425.453) -- 0:00:58
64500 -- (-430.340) (-431.150) (-425.472) [-425.201] * (-429.266) [-426.859] (-433.192) (-425.001) -- 0:00:58
65000 -- (-425.775) [-424.532] (-425.024) (-426.826) * [-426.763] (-428.580) (-429.096) (-425.427) -- 0:00:57
Average standard deviation of split frequencies: 0.029284
65500 -- (-427.613) [-428.484] (-424.631) (-430.423) * (-427.311) (-429.297) [-426.534] (-429.645) -- 0:00:57
66000 -- [-427.601] (-429.035) (-425.839) (-430.259) * [-427.494] (-426.324) (-430.083) (-431.250) -- 0:00:56
66500 -- (-424.935) (-426.585) [-425.920] (-428.090) * (-427.085) (-428.627) [-427.336] (-429.262) -- 0:00:56
67000 -- (-426.162) (-430.590) (-425.936) [-430.510] * (-425.369) [-428.714] (-426.688) (-428.355) -- 0:00:55
67500 -- (-428.012) [-429.623] (-428.018) (-429.956) * (-427.296) (-426.100) (-428.175) [-424.763] -- 0:01:09
68000 -- (-426.088) [-428.403] (-438.038) (-426.708) * (-430.600) (-425.482) [-429.188] (-431.478) -- 0:01:08
68500 -- [-425.009] (-429.354) (-427.592) (-426.102) * (-429.198) [-425.750] (-426.299) (-427.220) -- 0:01:07
69000 -- (-426.951) (-425.878) [-427.570] (-428.866) * (-434.733) (-425.861) [-426.167] (-430.156) -- 0:01:07
69500 -- [-432.374] (-425.325) (-426.856) (-431.564) * [-426.045] (-425.848) (-428.926) (-426.751) -- 0:01:06
70000 -- (-434.560) (-427.642) [-429.686] (-428.769) * (-429.959) (-427.284) [-427.010] (-426.509) -- 0:01:06
Average standard deviation of split frequencies: 0.030178
70500 -- [-426.073] (-427.933) (-428.096) (-424.839) * (-426.430) [-430.583] (-425.493) (-428.274) -- 0:01:05
71000 -- (-425.815) (-425.976) [-425.704] (-425.655) * [-429.835] (-425.445) (-427.457) (-426.676) -- 0:01:05
71500 -- (-426.619) (-428.922) [-431.632] (-425.188) * (-426.628) (-426.770) (-426.157) [-427.995] -- 0:01:04
72000 -- [-424.920] (-427.162) (-425.872) (-425.279) * (-425.928) (-429.588) [-425.783] (-427.570) -- 0:01:04
72500 -- (-424.631) [-429.361] (-427.630) (-424.797) * [-427.957] (-428.051) (-426.244) (-427.593) -- 0:01:03
73000 -- (-428.873) [-424.887] (-431.122) (-425.776) * (-429.854) (-425.492) (-425.388) [-426.032] -- 0:01:03
73500 -- (-428.849) (-426.950) [-425.853] (-425.744) * (-431.853) [-425.601] (-427.008) (-425.662) -- 0:01:03
74000 -- (-427.939) (-425.012) (-426.859) [-426.654] * (-430.431) [-427.986] (-425.885) (-426.082) -- 0:01:02
74500 -- (-427.026) (-432.075) [-425.612] (-427.050) * (-427.384) (-426.091) (-425.784) [-426.909] -- 0:01:02
75000 -- (-426.725) (-426.053) (-427.060) [-427.725] * (-424.733) (-425.081) [-425.488] (-424.714) -- 0:01:01
Average standard deviation of split frequencies: 0.025137
75500 -- [-426.304] (-429.754) (-426.855) (-426.885) * (-426.748) (-427.396) [-426.275] (-427.618) -- 0:01:01
76000 -- [-426.055] (-427.690) (-425.199) (-426.222) * (-424.839) (-427.649) (-427.275) [-426.954] -- 0:01:00
76500 -- [-426.028] (-433.015) (-429.400) (-427.326) * [-425.528] (-426.576) (-426.796) (-428.769) -- 0:01:00
77000 -- [-425.508] (-430.336) (-425.886) (-426.432) * (-428.421) (-425.613) (-425.976) [-429.420] -- 0:00:59
77500 -- (-431.115) [-426.058] (-427.438) (-425.164) * (-426.317) (-426.225) [-425.273] (-426.280) -- 0:00:59
78000 -- (-424.689) (-425.904) (-436.462) [-426.028] * (-426.875) (-431.115) [-427.247] (-427.956) -- 0:00:59
78500 -- (-427.743) (-425.496) [-428.991] (-426.326) * [-426.528] (-430.503) (-427.918) (-426.962) -- 0:00:58
79000 -- (-426.291) (-425.271) [-427.915] (-429.928) * (-426.405) (-438.294) (-424.992) [-425.732] -- 0:00:58
79500 -- (-428.173) (-426.107) [-428.131] (-426.127) * [-427.350] (-425.359) (-427.124) (-424.945) -- 0:00:57
80000 -- (-426.251) (-425.337) [-427.384] (-426.386) * (-427.914) (-424.643) [-427.829] (-426.273) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-425.704) (-425.048) (-430.116) [-427.554] * (-434.956) [-429.673] (-426.095) (-426.048) -- 0:00:57
81000 -- (-427.786) [-425.978] (-426.591) (-426.526) * (-425.520) (-426.234) (-426.950) [-428.618] -- 0:00:56
81500 -- (-427.983) (-430.799) (-427.586) [-425.054] * [-428.417] (-425.819) (-425.722) (-426.684) -- 0:00:56
82000 -- (-425.680) (-434.050) (-426.176) [-426.814] * [-429.007] (-426.458) (-426.021) (-426.575) -- 0:00:55
82500 -- (-426.567) [-428.796] (-426.190) (-427.571) * (-430.195) [-429.570] (-428.114) (-427.319) -- 0:00:55
83000 -- (-427.230) (-426.690) [-425.057] (-430.093) * [-426.667] (-429.052) (-427.255) (-425.759) -- 0:00:55
83500 -- (-426.980) (-427.535) (-427.312) [-427.371] * (-426.915) [-430.743] (-425.960) (-426.539) -- 0:00:54
84000 -- (-426.569) [-429.204] (-427.324) (-425.595) * (-429.326) [-426.006] (-424.934) (-428.478) -- 0:01:05
84500 -- (-428.063) [-425.291] (-426.150) (-426.213) * (-426.819) [-426.154] (-430.210) (-430.134) -- 0:01:05
85000 -- (-429.694) (-425.671) [-427.753] (-426.560) * [-425.382] (-426.390) (-425.530) (-431.448) -- 0:01:04
Average standard deviation of split frequencies: 0.026542
85500 -- (-431.594) (-430.114) [-426.280] (-426.371) * (-433.441) (-428.976) [-425.265] (-425.849) -- 0:01:04
86000 -- (-424.417) [-425.717] (-428.069) (-425.768) * (-426.762) (-426.175) [-426.057] (-426.031) -- 0:01:03
86500 -- (-429.459) [-433.570] (-425.756) (-431.832) * (-428.384) [-427.539] (-431.347) (-425.363) -- 0:01:03
87000 -- (-432.787) (-425.881) (-426.122) [-428.105] * (-428.319) (-426.522) [-427.539] (-425.610) -- 0:01:02
87500 -- (-432.664) (-425.459) (-426.876) [-427.320] * (-425.915) (-426.333) [-427.766] (-426.766) -- 0:01:02
88000 -- (-430.682) [-425.560] (-428.590) (-426.884) * (-426.457) (-428.961) [-428.517] (-430.341) -- 0:01:02
88500 -- (-428.103) (-426.781) [-426.380] (-428.111) * (-428.587) (-426.619) [-426.073] (-427.533) -- 0:01:01
89000 -- (-426.162) [-425.371] (-428.951) (-431.304) * (-428.391) [-425.304] (-426.670) (-426.096) -- 0:01:01
89500 -- (-428.443) (-426.912) (-430.282) [-426.475] * (-426.686) [-428.094] (-426.141) (-426.252) -- 0:01:01
90000 -- (-425.947) (-426.542) [-430.156] (-426.674) * (-429.019) (-425.693) (-426.510) [-426.002] -- 0:01:00
Average standard deviation of split frequencies: 0.026270
90500 -- (-427.490) (-425.361) [-430.412] (-429.387) * (-426.518) (-425.529) [-425.540] (-426.289) -- 0:01:00
91000 -- (-429.800) (-427.936) (-427.963) [-425.332] * (-426.937) (-429.492) [-427.519] (-428.133) -- 0:00:59
91500 -- (-426.652) [-426.038] (-426.544) (-425.548) * (-427.920) (-427.383) [-429.021] (-433.984) -- 0:00:59
92000 -- [-427.795] (-424.856) (-428.089) (-429.096) * (-426.923) (-428.065) [-425.560] (-430.540) -- 0:00:59
92500 -- (-430.054) (-426.611) (-431.240) [-426.994] * (-425.563) (-425.929) [-425.642] (-428.226) -- 0:00:58
93000 -- [-427.524] (-427.189) (-429.710) (-427.924) * (-424.920) (-426.679) (-424.602) [-427.358] -- 0:00:58
93500 -- (-425.473) [-426.351] (-430.901) (-431.167) * (-426.253) (-426.054) (-425.883) [-426.293] -- 0:00:58
94000 -- (-425.724) (-430.164) (-425.307) [-427.276] * (-426.039) (-425.956) (-424.717) [-425.903] -- 0:00:57
94500 -- (-426.180) [-426.157] (-424.925) (-434.556) * (-428.031) (-426.483) [-428.538] (-424.902) -- 0:00:57
95000 -- (-426.896) [-425.871] (-426.126) (-429.425) * (-427.444) [-426.648] (-427.443) (-425.249) -- 0:00:57
Average standard deviation of split frequencies: 0.028946
95500 -- (-424.821) [-425.250] (-427.165) (-425.602) * (-424.665) [-427.175] (-430.023) (-428.314) -- 0:00:56
96000 -- (-424.979) (-425.392) (-426.438) [-426.688] * (-425.716) [-432.036] (-424.745) (-430.032) -- 0:00:56
96500 -- (-424.943) (-429.513) [-426.393] (-426.428) * (-425.467) [-425.785] (-426.419) (-427.211) -- 0:00:56
97000 -- (-425.372) (-429.522) (-427.889) [-425.687] * (-425.987) (-426.083) (-429.343) [-428.466] -- 0:00:55
97500 -- [-426.727] (-429.055) (-428.511) (-427.145) * (-427.184) (-425.748) [-428.325] (-428.594) -- 0:00:55
98000 -- [-429.872] (-426.070) (-425.744) (-430.142) * (-427.481) [-427.809] (-425.379) (-426.586) -- 0:00:55
98500 -- (-426.795) (-425.986) [-425.990] (-427.500) * (-426.357) (-426.206) (-426.212) [-425.722] -- 0:00:54
99000 -- [-424.742] (-425.949) (-425.339) (-427.733) * (-426.119) [-425.289] (-424.752) (-427.897) -- 0:00:54
99500 -- [-425.599] (-426.675) (-428.750) (-426.731) * [-425.099] (-430.481) (-425.458) (-432.261) -- 0:00:54
100000 -- [-425.231] (-427.269) (-427.143) (-425.738) * (-426.639) [-428.036] (-428.114) (-432.374) -- 0:00:54
Average standard deviation of split frequencies: 0.030808
100500 -- (-427.699) (-427.100) [-429.652] (-425.652) * (-427.419) [-429.145] (-434.087) (-425.538) -- 0:01:02
101000 -- (-428.917) [-424.714] (-429.226) (-426.620) * (-425.936) [-428.332] (-428.396) (-425.965) -- 0:01:02
101500 -- [-426.486] (-426.194) (-433.943) (-425.489) * [-426.518] (-427.055) (-426.310) (-426.307) -- 0:01:01
102000 -- (-426.485) (-429.549) (-431.071) [-426.880] * (-424.703) [-426.701] (-426.407) (-428.388) -- 0:01:01
102500 -- (-425.007) (-428.752) [-426.185] (-427.576) * (-426.447) (-426.219) [-426.656] (-427.323) -- 0:01:01
103000 -- (-425.671) (-429.529) (-429.154) [-426.420] * (-428.487) [-426.890] (-431.976) (-425.826) -- 0:01:00
103500 -- [-426.180] (-425.861) (-428.081) (-430.584) * (-430.274) [-426.244] (-426.696) (-425.449) -- 0:01:00
104000 -- [-426.211] (-425.305) (-427.310) (-427.142) * (-428.083) (-427.195) [-428.009] (-426.787) -- 0:01:00
104500 -- (-429.002) (-426.305) [-425.680] (-429.822) * (-427.127) (-429.349) [-427.618] (-426.512) -- 0:00:59
105000 -- (-426.004) (-425.373) [-425.844] (-430.141) * (-425.922) (-424.897) (-427.632) [-427.393] -- 0:00:59
Average standard deviation of split frequencies: 0.031130
105500 -- (-424.793) (-427.531) (-425.544) [-426.881] * (-427.454) (-427.257) [-427.147] (-425.087) -- 0:00:59
106000 -- (-424.827) [-426.301] (-427.246) (-424.891) * (-427.903) (-430.592) (-426.131) [-425.986] -- 0:00:59
106500 -- (-426.964) [-428.664] (-428.356) (-425.536) * [-424.613] (-433.139) (-426.536) (-426.641) -- 0:00:58
107000 -- (-428.576) (-427.874) [-426.591] (-427.082) * [-425.384] (-432.329) (-425.891) (-427.025) -- 0:00:58
107500 -- (-427.324) [-426.303] (-428.274) (-426.174) * (-432.145) [-426.020] (-428.610) (-424.848) -- 0:00:58
108000 -- (-426.071) (-427.571) (-425.025) [-426.607] * (-426.872) (-425.374) (-428.780) [-425.579] -- 0:00:57
108500 -- (-426.276) (-428.472) [-424.991] (-425.949) * (-427.677) [-429.731] (-426.041) (-424.987) -- 0:00:57
109000 -- (-425.539) (-426.751) [-425.702] (-433.842) * [-429.960] (-428.332) (-428.152) (-425.815) -- 0:00:57
109500 -- [-426.631] (-425.313) (-427.472) (-428.760) * (-426.399) [-427.079] (-427.609) (-428.333) -- 0:00:56
110000 -- [-426.818] (-428.185) (-427.582) (-427.303) * (-426.094) (-426.521) [-432.340] (-426.585) -- 0:00:56
Average standard deviation of split frequencies: 0.031835
110500 -- (-428.656) [-425.755] (-428.368) (-426.621) * (-426.070) (-425.669) (-425.812) [-424.807] -- 0:00:56
111000 -- (-426.997) [-426.840] (-427.348) (-428.964) * (-425.774) (-425.225) (-424.861) [-426.684] -- 0:00:56
111500 -- (-426.872) [-427.597] (-428.912) (-425.769) * (-429.483) [-426.866] (-426.832) (-426.363) -- 0:00:55
112000 -- [-426.242] (-425.947) (-427.517) (-426.599) * (-430.319) (-426.455) [-427.653] (-426.186) -- 0:00:55
112500 -- [-426.636] (-426.176) (-426.009) (-427.219) * (-427.719) [-429.309] (-427.968) (-428.051) -- 0:00:55
113000 -- (-427.305) (-427.085) (-425.792) [-425.226] * (-426.647) (-427.344) [-426.160] (-425.493) -- 0:00:54
113500 -- (-427.057) (-427.927) (-427.113) [-426.419] * [-427.011] (-430.256) (-426.241) (-425.291) -- 0:00:54
114000 -- (-426.739) (-428.850) (-430.201) [-427.567] * (-427.898) (-430.548) [-427.676] (-425.043) -- 0:00:54
114500 -- (-426.889) (-427.513) (-425.461) [-427.851] * (-427.420) (-430.722) [-428.948] (-429.521) -- 0:00:54
115000 -- (-425.358) (-428.448) [-426.109] (-428.613) * (-427.169) [-426.021] (-427.641) (-426.345) -- 0:00:53
Average standard deviation of split frequencies: 0.029516
115500 -- (-425.369) [-434.001] (-425.717) (-428.596) * (-428.856) (-426.947) [-427.155] (-426.812) -- 0:00:53
116000 -- (-424.720) [-428.586] (-426.214) (-425.946) * (-429.221) (-427.927) (-430.619) [-426.316] -- 0:00:53
116500 -- [-426.044] (-428.073) (-426.046) (-424.458) * [-424.842] (-429.918) (-428.972) (-425.438) -- 0:01:00
117000 -- (-426.955) (-428.359) (-433.066) [-424.989] * (-426.663) [-426.502] (-425.673) (-430.961) -- 0:01:00
117500 -- (-427.439) [-426.129] (-425.387) (-425.350) * (-426.469) (-426.600) [-426.261] (-427.254) -- 0:01:00
118000 -- (-426.334) (-428.532) [-425.689] (-426.554) * (-435.551) [-425.921] (-428.057) (-426.318) -- 0:00:59
118500 -- (-426.524) [-428.899] (-425.934) (-427.488) * (-432.429) [-427.643] (-427.896) (-431.348) -- 0:00:59
119000 -- (-426.368) (-428.910) [-424.915] (-427.100) * (-432.794) [-426.727] (-425.707) (-425.981) -- 0:00:59
119500 -- [-427.355] (-426.599) (-425.769) (-424.931) * (-427.335) (-428.789) (-426.501) [-425.660] -- 0:00:58
120000 -- (-427.606) (-426.415) (-425.700) [-426.257] * [-426.166] (-428.679) (-426.050) (-427.811) -- 0:00:58
Average standard deviation of split frequencies: 0.030842
120500 -- (-428.365) (-426.961) (-424.627) [-425.559] * (-427.480) [-424.589] (-428.001) (-426.059) -- 0:00:58
121000 -- (-427.088) (-427.631) [-427.188] (-428.594) * (-427.753) [-425.403] (-429.483) (-428.138) -- 0:00:58
121500 -- [-426.573] (-425.867) (-426.064) (-426.316) * (-427.155) [-427.013] (-425.219) (-426.305) -- 0:00:57
122000 -- (-428.693) (-424.495) [-425.713] (-429.673) * (-431.385) [-428.206] (-427.431) (-426.962) -- 0:00:57
122500 -- (-428.805) (-426.275) (-426.406) [-425.601] * [-425.168] (-427.442) (-426.184) (-426.438) -- 0:00:57
123000 -- (-427.508) [-427.364] (-428.820) (-426.321) * [-426.900] (-425.896) (-433.340) (-425.211) -- 0:00:57
123500 -- (-426.533) (-428.982) (-427.385) [-426.832] * (-426.464) (-428.042) (-426.880) [-425.813] -- 0:00:56
124000 -- [-426.566] (-429.390) (-428.797) (-426.811) * [-425.622] (-427.419) (-427.905) (-426.530) -- 0:00:56
124500 -- (-426.734) (-428.476) [-424.849] (-429.567) * (-431.203) (-428.001) [-432.009] (-425.482) -- 0:00:56
125000 -- (-433.501) (-427.652) [-426.742] (-424.652) * (-433.978) (-428.466) (-428.099) [-426.497] -- 0:00:56
Average standard deviation of split frequencies: 0.027568
125500 -- (-426.869) (-426.503) (-427.634) [-425.486] * [-432.995] (-427.129) (-428.951) (-425.141) -- 0:00:55
126000 -- (-429.683) [-425.500] (-428.176) (-426.324) * (-425.796) [-428.574] (-428.161) (-429.296) -- 0:00:55
126500 -- (-427.170) (-436.027) [-429.645] (-426.732) * (-425.246) (-428.648) (-427.559) [-427.693] -- 0:00:55
127000 -- [-425.016] (-424.969) (-429.344) (-424.833) * (-426.546) (-431.769) (-424.859) [-429.591] -- 0:00:54
127500 -- (-425.576) (-424.809) (-426.533) [-428.584] * (-425.160) [-427.259] (-425.813) (-431.102) -- 0:00:54
128000 -- (-429.052) (-427.843) [-425.999] (-427.364) * [-428.227] (-431.524) (-425.415) (-426.804) -- 0:00:54
128500 -- (-429.675) (-427.985) (-427.173) [-424.768] * (-428.626) (-425.310) [-427.606] (-429.607) -- 0:00:54
129000 -- [-429.691] (-430.454) (-427.747) (-426.799) * (-431.103) (-427.138) [-429.005] (-429.768) -- 0:00:54
129500 -- (-427.748) (-428.613) (-425.931) [-428.030] * (-424.781) (-426.376) (-426.327) [-431.831] -- 0:00:53
130000 -- (-427.751) (-428.679) [-424.722] (-427.319) * (-424.632) (-426.844) (-429.888) [-425.825] -- 0:00:53
Average standard deviation of split frequencies: 0.028102
130500 -- (-426.175) (-426.604) [-428.507] (-429.416) * (-426.917) (-428.150) [-428.481] (-427.125) -- 0:00:53
131000 -- (-426.983) (-426.489) [-427.788] (-427.362) * (-425.478) [-425.658] (-428.526) (-426.559) -- 0:00:53
131500 -- (-426.258) (-426.103) (-427.237) [-425.486] * [-425.689] (-428.023) (-427.368) (-424.520) -- 0:00:52
132000 -- (-426.213) (-428.879) (-426.387) [-426.420] * (-427.613) (-427.311) [-431.728] (-426.947) -- 0:00:52
132500 -- [-425.369] (-428.316) (-428.503) (-425.424) * (-430.027) [-426.802] (-426.436) (-425.862) -- 0:00:52
133000 -- (-428.806) (-427.034) [-427.357] (-424.428) * (-426.519) [-426.811] (-427.731) (-426.036) -- 0:00:52
133500 -- (-429.119) (-426.841) (-427.043) [-426.405] * (-426.286) (-425.644) (-425.365) [-428.986] -- 0:00:58
134000 -- [-427.559] (-426.908) (-427.920) (-425.609) * (-426.667) [-427.254] (-429.251) (-429.323) -- 0:00:58
134500 -- (-430.479) [-425.515] (-427.150) (-426.752) * (-428.110) (-427.076) [-425.880] (-426.179) -- 0:00:57
135000 -- [-427.089] (-424.948) (-426.759) (-429.972) * (-425.696) [-425.821] (-426.465) (-428.160) -- 0:00:57
Average standard deviation of split frequencies: 0.025804
135500 -- (-428.827) [-428.733] (-426.994) (-427.202) * (-429.190) (-427.473) (-427.140) [-431.090] -- 0:00:57
136000 -- [-429.060] (-428.429) (-429.250) (-425.749) * (-426.887) (-427.551) (-428.046) [-426.033] -- 0:00:57
136500 -- (-428.599) [-428.151] (-428.098) (-426.723) * [-427.178] (-427.325) (-426.164) (-426.171) -- 0:00:56
137000 -- (-431.577) (-430.233) [-427.189] (-427.810) * (-425.414) (-430.942) (-425.725) [-428.430] -- 0:00:56
137500 -- (-433.790) (-428.151) [-432.008] (-425.644) * (-425.526) (-426.911) [-424.778] (-427.222) -- 0:00:56
138000 -- (-424.560) (-427.166) [-431.205] (-425.994) * (-427.040) [-430.070] (-426.561) (-426.521) -- 0:00:56
138500 -- (-425.206) (-430.898) (-425.532) [-428.787] * (-428.557) (-428.072) (-425.728) [-427.052] -- 0:00:55
139000 -- [-426.351] (-430.272) (-426.931) (-428.066) * (-426.232) [-425.663] (-425.802) (-430.479) -- 0:00:55
139500 -- [-424.804] (-426.377) (-426.096) (-424.896) * [-426.288] (-427.744) (-424.884) (-428.668) -- 0:00:55
140000 -- (-425.619) (-428.462) [-428.238] (-425.151) * [-426.516] (-427.265) (-428.817) (-425.893) -- 0:00:55
Average standard deviation of split frequencies: 0.026810
140500 -- (-429.897) [-426.813] (-426.504) (-428.721) * (-425.065) [-426.279] (-434.218) (-427.888) -- 0:00:55
141000 -- (-426.878) (-426.696) (-428.894) [-425.153] * (-426.481) (-427.638) (-428.206) [-424.717] -- 0:00:54
141500 -- (-428.299) [-426.807] (-425.054) (-425.493) * (-427.497) (-428.556) (-424.994) [-427.319] -- 0:00:54
142000 -- [-425.166] (-426.353) (-428.363) (-429.358) * [-426.667] (-426.140) (-428.027) (-429.102) -- 0:00:54
142500 -- (-425.381) (-425.008) [-429.081] (-426.250) * [-425.850] (-428.781) (-426.745) (-426.290) -- 0:00:54
143000 -- (-426.444) (-428.551) (-428.881) [-427.949] * (-426.279) [-427.982] (-428.282) (-425.072) -- 0:00:53
143500 -- [-425.857] (-428.866) (-429.766) (-425.602) * (-430.851) (-432.533) (-427.505) [-424.874] -- 0:00:53
144000 -- (-429.272) (-432.328) (-425.728) [-427.022] * (-427.084) [-425.647] (-426.867) (-429.582) -- 0:00:53
144500 -- (-429.316) (-425.360) (-426.699) [-426.039] * [-425.587] (-432.991) (-427.957) (-428.852) -- 0:00:53
145000 -- (-428.052) (-426.708) (-426.384) [-426.781] * (-425.259) (-428.148) (-427.134) [-426.712] -- 0:00:53
Average standard deviation of split frequencies: 0.026727
145500 -- [-425.992] (-426.887) (-430.231) (-425.013) * [-427.401] (-432.254) (-427.360) (-425.348) -- 0:00:52
146000 -- (-426.293) (-425.817) [-426.542] (-425.564) * (-425.604) (-428.796) (-430.039) [-427.134] -- 0:00:52
146500 -- (-431.121) [-426.920] (-428.160) (-426.324) * [-425.980] (-430.117) (-425.322) (-427.579) -- 0:00:52
147000 -- (-426.539) (-426.739) [-426.930] (-428.775) * [-424.985] (-429.490) (-426.118) (-429.344) -- 0:00:52
147500 -- [-425.517] (-427.437) (-426.589) (-427.933) * (-426.173) (-428.027) [-425.942] (-426.022) -- 0:00:52
148000 -- (-426.195) [-425.991] (-430.944) (-427.793) * (-427.240) (-426.871) (-426.302) [-428.645] -- 0:00:51
148500 -- (-426.741) [-426.571] (-427.138) (-426.297) * (-428.663) (-426.753) [-426.987] (-428.553) -- 0:00:51
149000 -- (-425.566) [-425.497] (-439.421) (-429.018) * (-426.509) (-425.230) (-430.071) [-428.331] -- 0:00:51
149500 -- (-425.788) (-426.122) [-424.933] (-427.128) * [-428.642] (-425.561) (-425.214) (-429.660) -- 0:00:51
150000 -- (-424.649) (-428.357) (-429.949) [-427.044] * [-426.609] (-428.542) (-427.292) (-427.218) -- 0:00:56
Average standard deviation of split frequencies: 0.027290
150500 -- (-425.863) (-426.707) (-427.285) [-426.078] * (-427.191) (-428.046) (-427.208) [-428.457] -- 0:00:56
151000 -- [-428.670] (-425.125) (-425.095) (-425.608) * (-424.515) (-429.858) (-427.989) [-430.138] -- 0:00:56
151500 -- (-426.052) (-425.319) [-425.341] (-426.118) * (-427.968) (-429.111) [-425.524] (-427.904) -- 0:00:56
152000 -- (-429.409) [-424.832] (-427.990) (-428.128) * (-428.404) [-427.725] (-428.875) (-427.382) -- 0:00:55
152500 -- (-427.462) (-426.396) [-426.360] (-426.634) * (-425.743) (-430.784) (-430.024) [-425.709] -- 0:00:55
153000 -- (-428.766) [-425.400] (-426.034) (-425.287) * (-425.892) (-427.696) [-427.613] (-429.100) -- 0:00:55
153500 -- (-426.245) (-428.564) [-425.354] (-429.321) * (-425.889) [-424.949] (-427.898) (-427.114) -- 0:00:55
154000 -- (-429.192) [-426.943] (-425.281) (-428.137) * (-427.728) (-429.372) [-426.127] (-425.448) -- 0:00:54
154500 -- (-429.071) (-429.085) [-427.822] (-425.642) * (-428.612) [-426.555] (-425.903) (-425.583) -- 0:00:54
155000 -- (-427.330) (-434.851) [-430.791] (-424.748) * (-429.566) (-424.990) (-425.249) [-427.458] -- 0:00:54
Average standard deviation of split frequencies: 0.027029
155500 -- (-430.038) (-426.789) [-427.887] (-425.036) * [-426.289] (-425.265) (-425.239) (-427.885) -- 0:00:54
156000 -- (-431.384) (-427.634) (-427.551) [-428.710] * (-424.978) (-426.595) (-428.068) [-427.305] -- 0:00:54
156500 -- (-428.833) [-426.762] (-428.740) (-428.918) * [-425.302] (-426.720) (-428.567) (-428.562) -- 0:00:53
157000 -- (-426.671) (-427.929) (-426.893) [-428.703] * (-425.288) (-426.862) [-427.226] (-430.336) -- 0:00:53
157500 -- (-427.295) (-425.772) (-426.398) [-428.099] * (-424.921) [-424.677] (-427.448) (-428.746) -- 0:00:53
158000 -- (-427.094) (-428.096) (-429.219) [-429.175] * (-425.240) (-426.399) [-428.676] (-427.004) -- 0:00:53
158500 -- (-425.230) [-431.488] (-426.618) (-428.952) * (-427.313) (-426.445) [-425.426] (-425.290) -- 0:00:53
159000 -- (-426.060) [-427.974] (-426.380) (-427.171) * (-427.221) (-427.062) (-425.329) [-428.475] -- 0:00:52
159500 -- [-427.536] (-430.850) (-425.803) (-425.128) * (-426.956) [-425.550] (-425.226) (-426.361) -- 0:00:52
160000 -- (-429.065) (-424.676) [-428.632] (-426.133) * (-428.801) (-426.373) [-425.622] (-430.828) -- 0:00:52
Average standard deviation of split frequencies: 0.027615
160500 -- (-428.920) (-426.957) [-427.083] (-425.119) * (-427.759) (-426.415) (-425.692) [-424.946] -- 0:00:52
161000 -- [-427.550] (-426.376) (-428.742) (-430.260) * (-428.220) (-426.239) [-432.035] (-425.885) -- 0:00:52
161500 -- (-427.744) [-426.108] (-427.372) (-426.764) * [-428.145] (-428.247) (-427.584) (-425.744) -- 0:00:51
162000 -- [-426.266] (-426.901) (-425.459) (-426.057) * [-425.187] (-428.134) (-426.050) (-429.415) -- 0:00:51
162500 -- (-425.060) (-425.766) [-426.590] (-425.781) * (-424.449) (-427.861) (-426.300) [-428.419] -- 0:00:51
163000 -- (-425.499) (-427.930) [-428.918] (-427.178) * (-429.215) (-427.940) [-428.519] (-424.685) -- 0:00:51
163500 -- [-425.763] (-429.886) (-426.359) (-426.096) * (-428.031) [-425.307] (-436.715) (-431.003) -- 0:00:51
164000 -- (-426.267) (-427.357) [-425.107] (-425.401) * (-428.690) (-429.952) [-429.995] (-436.456) -- 0:00:50
164500 -- [-425.515] (-426.120) (-425.481) (-427.504) * (-428.765) (-426.440) [-425.913] (-425.564) -- 0:00:50
165000 -- (-424.628) [-429.565] (-427.125) (-428.863) * (-430.036) (-428.633) [-425.957] (-426.278) -- 0:00:50
Average standard deviation of split frequencies: 0.024927
165500 -- [-425.273] (-427.680) (-425.085) (-429.254) * (-425.183) [-426.080] (-426.108) (-425.907) -- 0:00:50
166000 -- [-424.729] (-425.940) (-425.349) (-425.370) * (-428.272) (-432.714) [-425.749] (-427.208) -- 0:00:50
166500 -- [-428.924] (-430.263) (-427.008) (-426.200) * [-426.153] (-426.956) (-426.152) (-429.972) -- 0:00:50
167000 -- (-425.478) (-429.681) (-426.104) [-431.259] * (-425.850) [-426.977] (-427.554) (-427.065) -- 0:00:54
167500 -- (-428.301) (-429.953) (-426.054) [-428.688] * (-427.365) (-428.618) [-424.743] (-426.645) -- 0:00:54
168000 -- [-427.575] (-429.593) (-425.329) (-426.948) * (-426.485) (-428.997) [-427.415] (-428.203) -- 0:00:54
168500 -- [-425.323] (-430.922) (-427.466) (-427.677) * [-425.139] (-425.838) (-424.851) (-428.375) -- 0:00:54
169000 -- (-425.833) (-424.986) [-425.183] (-429.040) * (-425.186) (-426.935) [-425.180] (-429.001) -- 0:00:54
169500 -- (-427.814) [-426.627] (-426.330) (-429.262) * (-425.750) (-427.114) (-427.031) [-427.778] -- 0:00:53
170000 -- (-425.650) (-425.946) (-428.656) [-425.159] * (-426.490) (-425.878) [-426.353] (-429.313) -- 0:00:53
Average standard deviation of split frequencies: 0.023478
170500 -- (-429.051) (-426.827) [-427.223] (-427.025) * (-427.053) [-425.987] (-426.628) (-428.776) -- 0:00:53
171000 -- [-425.197] (-426.573) (-428.474) (-431.408) * (-426.281) [-425.443] (-427.225) (-425.673) -- 0:00:53
171500 -- (-428.959) [-425.197] (-427.430) (-427.753) * (-427.186) (-429.898) [-429.630] (-426.092) -- 0:00:53
172000 -- (-427.044) (-425.949) [-426.088] (-426.925) * (-431.797) (-427.078) [-429.632] (-426.497) -- 0:00:52
172500 -- (-426.886) [-424.712] (-426.467) (-429.735) * (-431.544) (-427.242) [-430.859] (-427.054) -- 0:00:52
173000 -- (-428.520) (-426.336) (-426.334) [-432.760] * [-429.829] (-425.871) (-425.619) (-427.503) -- 0:00:52
173500 -- (-426.460) [-426.506] (-428.782) (-431.780) * (-426.002) (-426.969) (-425.850) [-426.163] -- 0:00:52
174000 -- (-427.348) (-429.320) (-427.163) [-427.719] * [-431.182] (-427.098) (-426.487) (-426.901) -- 0:00:52
174500 -- [-426.039] (-427.653) (-427.514) (-426.678) * [-430.113] (-428.339) (-425.429) (-426.211) -- 0:00:52
175000 -- (-426.099) (-429.003) [-429.192] (-428.827) * (-430.087) (-432.600) (-425.418) [-426.935] -- 0:00:51
Average standard deviation of split frequencies: 0.022058
175500 -- (-428.151) (-427.727) [-425.368] (-427.613) * (-430.402) (-427.857) (-425.890) [-425.812] -- 0:00:51
176000 -- (-425.700) (-428.627) [-429.635] (-427.031) * [-425.924] (-425.634) (-426.038) (-429.141) -- 0:00:51
176500 -- (-428.277) (-429.011) (-425.847) [-428.150] * (-427.901) (-429.717) (-424.557) [-428.345] -- 0:00:51
177000 -- (-427.148) [-430.554] (-425.342) (-426.317) * (-430.526) (-425.611) (-427.055) [-425.573] -- 0:00:51
177500 -- [-428.372] (-427.703) (-425.350) (-426.416) * (-426.654) (-424.928) (-425.985) [-428.028] -- 0:00:50
178000 -- (-425.213) [-424.582] (-426.687) (-425.967) * (-425.126) (-426.152) (-424.852) [-425.538] -- 0:00:50
178500 -- (-427.608) [-425.588] (-425.431) (-426.062) * [-428.250] (-424.990) (-425.218) (-426.303) -- 0:00:50
179000 -- (-426.089) (-425.581) (-428.120) [-427.578] * (-426.031) [-427.527] (-425.797) (-427.321) -- 0:00:50
179500 -- (-427.769) (-426.396) [-425.537] (-426.935) * [-427.455] (-431.324) (-425.804) (-426.374) -- 0:00:50
180000 -- [-425.850] (-426.025) (-426.636) (-426.595) * (-426.429) [-428.581] (-425.357) (-425.525) -- 0:00:50
Average standard deviation of split frequencies: 0.024558
180500 -- (-426.477) (-425.534) [-427.298] (-426.530) * [-429.436] (-426.450) (-427.484) (-427.146) -- 0:00:49
181000 -- [-425.017] (-426.582) (-425.884) (-428.000) * (-431.546) (-429.335) (-427.844) [-429.182] -- 0:00:49
181500 -- (-427.650) (-426.036) (-427.951) [-428.914] * (-427.126) (-425.316) [-426.156] (-425.030) -- 0:00:49
182000 -- (-426.839) [-429.042] (-428.292) (-429.378) * (-426.203) (-425.724) [-427.383] (-425.615) -- 0:00:49
182500 -- [-425.130] (-427.615) (-428.970) (-424.830) * (-427.367) (-425.379) [-429.656] (-427.575) -- 0:00:49
183000 -- (-425.972) (-425.835) [-426.525] (-426.329) * (-427.879) (-424.941) (-424.969) [-427.192] -- 0:00:49
183500 -- (-428.219) [-427.496] (-429.699) (-429.021) * (-431.748) (-431.096) [-424.644] (-426.305) -- 0:00:53
184000 -- (-425.779) (-426.659) [-430.660] (-428.819) * (-426.229) (-427.264) [-424.775] (-426.612) -- 0:00:53
184500 -- [-431.325] (-425.236) (-430.684) (-427.199) * [-429.400] (-427.386) (-427.451) (-426.296) -- 0:00:53
185000 -- (-428.121) [-425.720] (-427.654) (-428.849) * [-427.560] (-427.782) (-434.137) (-425.197) -- 0:00:52
Average standard deviation of split frequencies: 0.023077
185500 -- (-426.850) [-427.267] (-426.630) (-432.321) * [-429.730] (-426.877) (-428.768) (-426.228) -- 0:00:52
186000 -- [-427.189] (-424.773) (-424.725) (-428.979) * (-428.579) (-431.752) [-427.750] (-429.451) -- 0:00:52
186500 -- (-426.282) (-426.524) [-426.831] (-427.740) * [-425.754] (-429.317) (-425.834) (-427.857) -- 0:00:52
187000 -- (-425.305) [-426.878] (-427.463) (-426.062) * (-426.353) [-426.424] (-428.123) (-428.552) -- 0:00:52
187500 -- (-427.787) [-426.905] (-429.616) (-428.144) * (-425.835) (-428.717) (-425.478) [-428.792] -- 0:00:52
188000 -- (-427.380) (-427.748) [-427.629] (-424.651) * (-425.478) [-427.383] (-425.852) (-427.075) -- 0:00:51
188500 -- (-427.041) (-425.629) (-425.177) [-427.927] * (-428.220) [-428.181] (-427.354) (-425.970) -- 0:00:51
189000 -- (-424.996) (-425.304) [-428.652] (-431.604) * (-427.508) (-425.273) (-427.828) [-426.530] -- 0:00:51
189500 -- (-426.425) (-427.978) [-427.028] (-425.404) * (-428.825) [-426.261] (-424.959) (-431.018) -- 0:00:51
190000 -- (-426.677) (-425.496) [-429.851] (-428.030) * (-428.534) (-429.795) [-426.376] (-429.877) -- 0:00:51
Average standard deviation of split frequencies: 0.021379
190500 -- [-427.309] (-426.359) (-426.937) (-425.819) * (-425.047) (-428.970) [-428.524] (-426.941) -- 0:00:50
191000 -- (-426.670) [-426.661] (-427.910) (-425.215) * [-426.758] (-428.314) (-427.150) (-425.445) -- 0:00:50
191500 -- (-426.879) (-427.261) [-428.053] (-425.824) * (-425.984) (-432.067) (-427.081) [-426.081] -- 0:00:50
192000 -- [-427.764] (-427.817) (-425.450) (-427.649) * (-428.371) (-428.882) (-427.434) [-425.348] -- 0:00:50
192500 -- (-425.352) [-427.634] (-427.906) (-427.117) * [-426.510] (-430.849) (-427.951) (-429.962) -- 0:00:50
193000 -- (-426.438) [-426.677] (-430.225) (-429.030) * (-425.855) (-426.617) (-427.811) [-425.923] -- 0:00:50
193500 -- (-430.096) (-427.296) (-430.279) [-425.062] * (-428.051) [-425.154] (-432.054) (-431.177) -- 0:00:50
194000 -- (-428.082) (-427.737) (-426.191) [-427.088] * (-429.362) (-425.361) [-432.449] (-425.111) -- 0:00:49
194500 -- (-424.991) (-427.928) [-426.807] (-427.410) * [-426.987] (-428.242) (-429.331) (-427.703) -- 0:00:49
195000 -- [-426.118] (-428.040) (-426.581) (-429.036) * (-428.055) [-430.991] (-432.417) (-425.783) -- 0:00:49
Average standard deviation of split frequencies: 0.022354
195500 -- (-426.159) (-429.253) (-430.470) [-428.992] * (-426.729) [-428.860] (-429.334) (-428.521) -- 0:00:49
196000 -- [-425.755] (-429.311) (-428.076) (-425.829) * (-429.857) (-428.377) (-429.137) [-426.934] -- 0:00:49
196500 -- (-425.686) (-426.905) [-426.096] (-427.273) * [-427.128] (-428.958) (-427.358) (-427.830) -- 0:00:49
197000 -- (-431.527) [-426.853] (-429.811) (-427.774) * (-427.234) (-425.517) (-426.627) [-427.905] -- 0:00:48
197500 -- (-426.724) [-426.023] (-424.787) (-429.249) * (-427.061) (-426.279) [-427.667] (-425.385) -- 0:00:48
198000 -- [-426.282] (-427.258) (-425.089) (-425.973) * [-424.874] (-433.418) (-432.375) (-427.118) -- 0:00:48
198500 -- [-425.772] (-427.031) (-426.960) (-426.713) * (-425.048) [-426.923] (-425.958) (-426.527) -- 0:00:48
199000 -- (-426.766) [-428.211] (-427.484) (-428.318) * [-426.493] (-430.903) (-424.967) (-427.388) -- 0:00:48
199500 -- (-426.751) (-428.391) (-427.575) [-426.693] * (-425.052) [-429.083] (-425.531) (-427.495) -- 0:00:48
200000 -- (-425.171) [-426.032] (-425.840) (-425.782) * [-427.290] (-425.478) (-426.321) (-429.904) -- 0:00:48
Average standard deviation of split frequencies: 0.021695
200500 -- (-428.013) [-426.759] (-426.495) (-429.209) * [-426.242] (-427.476) (-425.985) (-428.598) -- 0:00:51
201000 -- (-427.486) [-426.700] (-426.168) (-425.194) * (-425.882) (-426.039) [-427.730] (-426.838) -- 0:00:51
201500 -- (-425.684) [-429.106] (-427.682) (-425.486) * [-426.253] (-428.630) (-428.056) (-426.559) -- 0:00:51
202000 -- (-426.893) (-427.816) (-427.484) [-425.720] * [-426.196] (-426.180) (-433.081) (-425.175) -- 0:00:51
202500 -- (-425.347) (-427.316) [-427.743] (-425.970) * (-425.528) (-426.260) (-426.017) [-427.862] -- 0:00:51
203000 -- (-432.432) (-428.821) [-428.573] (-426.087) * (-427.112) (-426.553) [-425.787] (-425.790) -- 0:00:51
203500 -- (-426.789) [-426.853] (-428.169) (-426.686) * (-427.372) (-426.315) (-426.246) [-426.382] -- 0:00:50
204000 -- (-425.596) [-426.968] (-427.485) (-426.658) * [-426.069] (-426.371) (-425.345) (-426.276) -- 0:00:50
204500 -- (-429.569) [-429.925] (-425.712) (-425.887) * (-426.691) [-428.332] (-424.685) (-426.017) -- 0:00:50
205000 -- [-426.238] (-425.554) (-426.855) (-427.895) * (-429.064) [-427.897] (-429.411) (-426.696) -- 0:00:50
Average standard deviation of split frequencies: 0.021994
205500 -- (-425.643) (-427.041) (-425.226) [-427.262] * (-425.289) [-426.058] (-427.318) (-426.275) -- 0:00:50
206000 -- [-424.762] (-429.071) (-424.561) (-426.710) * (-426.842) [-427.388] (-424.700) (-426.166) -- 0:00:50
206500 -- (-425.010) [-426.443] (-427.823) (-425.100) * (-426.269) (-429.016) (-426.926) [-428.634] -- 0:00:49
207000 -- (-425.993) (-427.105) [-428.106] (-425.649) * (-426.351) [-427.336] (-433.994) (-427.105) -- 0:00:49
207500 -- [-428.086] (-427.117) (-427.926) (-428.642) * (-427.217) (-427.171) [-427.314] (-426.313) -- 0:00:49
208000 -- (-424.942) [-424.421] (-424.647) (-430.898) * (-429.518) (-428.245) [-425.436] (-426.337) -- 0:00:49
208500 -- [-425.363] (-424.509) (-429.827) (-425.166) * (-431.046) (-428.406) [-428.676] (-425.657) -- 0:00:49
209000 -- (-424.789) [-431.405] (-424.806) (-425.332) * (-427.838) (-426.398) (-431.774) [-428.681] -- 0:00:49
209500 -- (-425.699) (-424.783) (-425.379) [-426.986] * [-426.398] (-428.833) (-436.483) (-427.116) -- 0:00:49
210000 -- [-431.380] (-432.956) (-425.320) (-426.854) * (-426.497) (-430.491) [-427.936] (-427.307) -- 0:00:48
Average standard deviation of split frequencies: 0.021382
210500 -- (-425.965) (-425.698) (-424.835) [-426.314] * (-425.151) [-430.490] (-426.237) (-429.454) -- 0:00:48
211000 -- (-425.978) (-429.462) (-425.428) [-425.146] * (-425.507) (-425.560) [-428.733] (-429.072) -- 0:00:48
211500 -- (-432.868) (-427.693) [-424.875] (-425.517) * (-425.600) (-424.786) [-425.136] (-427.382) -- 0:00:48
212000 -- (-428.141) (-429.123) [-426.838] (-429.199) * (-426.376) (-424.704) (-430.709) [-426.584] -- 0:00:48
212500 -- (-425.822) [-427.320] (-425.897) (-425.052) * (-427.505) [-429.829] (-426.725) (-425.000) -- 0:00:48
213000 -- (-425.307) (-427.644) (-429.762) [-430.394] * [-427.685] (-426.334) (-428.492) (-426.577) -- 0:00:48
213500 -- [-427.317] (-425.211) (-425.631) (-428.765) * [-429.478] (-428.329) (-427.404) (-428.905) -- 0:00:47
214000 -- (-429.065) (-425.864) (-432.407) [-427.187] * [-427.547] (-427.681) (-427.237) (-429.439) -- 0:00:47
214500 -- (-426.160) [-425.280] (-429.596) (-430.585) * (-429.105) [-425.918] (-429.702) (-428.500) -- 0:00:47
215000 -- (-425.749) (-427.655) [-425.089] (-427.210) * (-426.018) [-425.265] (-425.542) (-428.678) -- 0:00:47
Average standard deviation of split frequencies: 0.022338
215500 -- [-426.380] (-428.069) (-429.024) (-427.714) * [-427.132] (-424.926) (-424.968) (-426.705) -- 0:00:47
216000 -- [-427.370] (-429.053) (-427.577) (-425.105) * (-426.913) [-425.793] (-424.526) (-427.523) -- 0:00:47
216500 -- (-426.408) (-428.315) [-425.420] (-424.632) * (-424.805) (-426.909) [-426.849] (-427.439) -- 0:00:47
217000 -- (-424.944) [-426.591] (-427.563) (-425.101) * (-427.559) [-426.215] (-425.679) (-427.351) -- 0:00:46
217500 -- [-429.867] (-430.850) (-427.416) (-425.646) * (-431.337) (-425.651) [-431.286] (-426.220) -- 0:00:50
218000 -- (-427.352) (-425.551) [-426.691] (-425.032) * (-426.868) (-425.449) [-427.907] (-428.598) -- 0:00:50
218500 -- (-425.753) (-425.386) (-425.462) [-424.894] * [-425.626] (-424.658) (-426.893) (-429.729) -- 0:00:50
219000 -- (-425.093) (-426.675) (-427.536) [-426.024] * [-429.029] (-425.989) (-426.031) (-428.004) -- 0:00:49
219500 -- [-425.326] (-425.148) (-425.943) (-425.295) * (-425.664) (-424.943) [-428.628] (-432.255) -- 0:00:49
220000 -- [-426.574] (-427.437) (-427.580) (-424.716) * [-426.881] (-425.578) (-425.988) (-425.630) -- 0:00:49
Average standard deviation of split frequencies: 0.020860
220500 -- (-426.433) (-426.344) [-426.970] (-424.509) * (-425.442) [-425.732] (-426.510) (-425.869) -- 0:00:49
221000 -- (-424.752) (-425.142) [-429.177] (-425.098) * [-426.036] (-427.783) (-426.035) (-427.337) -- 0:00:49
221500 -- (-430.573) (-424.608) [-425.819] (-424.569) * (-426.739) (-427.402) (-426.653) [-430.507] -- 0:00:49
222000 -- (-425.227) (-429.128) (-426.203) [-425.886] * (-426.241) [-428.930] (-425.344) (-426.104) -- 0:00:49
222500 -- (-428.775) (-427.736) (-425.819) [-426.524] * [-429.172] (-424.687) (-424.921) (-426.568) -- 0:00:48
223000 -- [-425.037] (-425.526) (-428.409) (-426.381) * [-430.522] (-425.660) (-426.034) (-425.644) -- 0:00:48
223500 -- [-425.039] (-425.526) (-429.111) (-427.816) * (-428.162) (-428.923) [-425.757] (-425.273) -- 0:00:48
224000 -- (-427.563) (-431.754) [-428.064] (-425.698) * (-425.582) (-426.610) (-426.194) [-426.854] -- 0:00:48
224500 -- (-428.907) (-428.202) [-426.072] (-427.265) * (-425.720) (-430.232) (-426.859) [-425.372] -- 0:00:48
225000 -- [-427.068] (-425.904) (-425.938) (-424.880) * [-428.647] (-425.925) (-428.811) (-430.578) -- 0:00:48
Average standard deviation of split frequencies: 0.020368
225500 -- (-426.282) (-425.317) (-427.130) [-425.479] * (-429.255) [-424.689] (-432.950) (-428.795) -- 0:00:48
226000 -- (-425.738) (-428.094) (-427.587) [-428.570] * (-429.091) (-427.000) (-429.312) [-428.788] -- 0:00:47
226500 -- (-426.533) (-427.567) (-429.402) [-425.335] * (-426.191) [-426.925] (-427.067) (-425.775) -- 0:00:47
227000 -- (-427.150) [-430.399] (-431.959) (-425.613) * (-426.449) (-429.684) (-427.940) [-425.512] -- 0:00:47
227500 -- (-427.546) (-429.045) (-432.423) [-427.531] * [-424.552] (-427.226) (-426.936) (-425.828) -- 0:00:47
228000 -- (-425.386) [-425.152] (-424.769) (-427.485) * [-427.349] (-425.394) (-425.953) (-426.342) -- 0:00:47
228500 -- [-428.579] (-426.280) (-425.512) (-427.650) * (-428.382) (-430.091) [-428.026] (-425.924) -- 0:00:47
229000 -- (-427.554) [-426.059] (-429.287) (-426.974) * (-426.547) [-425.911] (-425.102) (-425.455) -- 0:00:47
229500 -- (-428.648) (-426.510) [-426.019] (-428.283) * (-426.373) (-426.143) [-425.469] (-428.145) -- 0:00:47
230000 -- (-428.459) (-424.900) (-428.627) [-427.329] * (-426.838) [-426.018] (-427.582) (-426.721) -- 0:00:46
Average standard deviation of split frequencies: 0.019715
230500 -- [-427.788] (-427.928) (-427.063) (-424.983) * [-427.494] (-425.081) (-425.153) (-425.991) -- 0:00:46
231000 -- [-425.253] (-426.169) (-428.187) (-425.021) * (-427.052) [-424.702] (-430.709) (-424.847) -- 0:00:46
231500 -- [-425.879] (-427.434) (-425.726) (-426.132) * (-425.917) [-425.405] (-426.270) (-425.077) -- 0:00:46
232000 -- [-426.802] (-426.870) (-429.185) (-427.275) * (-425.882) (-425.878) (-426.312) [-425.634] -- 0:00:46
232500 -- (-430.943) (-428.344) [-424.979] (-425.674) * (-427.901) [-427.425] (-426.802) (-427.632) -- 0:00:46
233000 -- (-426.701) (-426.764) (-425.080) [-425.917] * (-427.553) (-428.406) [-427.091] (-426.302) -- 0:00:46
233500 -- (-431.081) (-426.065) [-427.565] (-424.881) * [-428.517] (-425.495) (-427.248) (-427.029) -- 0:00:45
234000 -- (-427.882) [-426.933] (-426.416) (-427.608) * [-424.502] (-425.419) (-426.084) (-430.682) -- 0:00:49
234500 -- (-428.719) (-426.455) (-429.823) [-424.921] * (-426.823) [-430.309] (-427.798) (-425.865) -- 0:00:48
235000 -- (-430.405) (-427.562) (-427.149) [-425.321] * [-426.253] (-430.111) (-426.120) (-425.478) -- 0:00:48
Average standard deviation of split frequencies: 0.019864
235500 -- (-428.180) (-427.922) (-430.147) [-425.290] * (-427.997) [-425.632] (-425.680) (-426.836) -- 0:00:48
236000 -- (-426.688) (-426.636) (-425.961) [-426.451] * [-426.593] (-428.126) (-426.512) (-425.486) -- 0:00:48
236500 -- (-425.322) [-427.944] (-430.106) (-430.808) * (-427.309) (-426.865) [-427.790] (-427.020) -- 0:00:48
237000 -- [-426.187] (-426.199) (-428.700) (-427.331) * (-426.497) (-427.140) [-429.627] (-427.622) -- 0:00:48
237500 -- (-429.048) [-426.661] (-426.755) (-426.214) * (-427.409) (-428.370) [-427.869] (-428.283) -- 0:00:48
238000 -- (-427.324) [-426.757] (-425.925) (-425.465) * (-427.966) [-425.532] (-427.965) (-425.965) -- 0:00:48
238500 -- [-424.528] (-425.508) (-426.387) (-424.962) * (-427.369) (-431.025) (-428.658) [-425.161] -- 0:00:47
239000 -- [-427.290] (-427.056) (-426.443) (-425.075) * (-427.172) (-428.992) (-425.370) [-425.946] -- 0:00:47
239500 -- (-428.127) (-425.844) (-427.376) [-425.368] * [-427.279] (-427.709) (-432.362) (-428.637) -- 0:00:47
240000 -- [-427.326] (-427.086) (-425.716) (-425.652) * (-429.015) (-425.814) (-431.332) [-424.995] -- 0:00:47
Average standard deviation of split frequencies: 0.019043
240500 -- (-426.911) [-427.629] (-425.888) (-427.090) * [-426.265] (-425.418) (-424.794) (-427.659) -- 0:00:47
241000 -- (-427.532) (-429.093) (-428.699) [-425.157] * (-427.305) (-427.145) (-428.587) [-427.039] -- 0:00:47
241500 -- (-426.950) (-425.837) (-428.046) [-426.190] * (-426.218) (-426.535) (-426.772) [-429.764] -- 0:00:47
242000 -- (-429.338) (-429.775) [-427.240] (-429.870) * (-429.345) [-425.291] (-430.257) (-428.839) -- 0:00:46
242500 -- (-426.220) (-430.026) [-428.942] (-426.608) * (-429.267) [-425.668] (-426.452) (-428.394) -- 0:00:46
243000 -- [-427.638] (-430.432) (-427.386) (-430.405) * (-427.592) (-426.139) (-426.072) [-429.024] -- 0:00:46
243500 -- (-428.266) (-431.798) [-428.725] (-427.664) * (-426.092) (-427.468) (-430.980) [-425.685] -- 0:00:46
244000 -- (-426.225) (-429.315) [-427.130] (-426.069) * (-427.484) [-426.862] (-431.998) (-425.417) -- 0:00:46
244500 -- (-427.132) (-426.386) [-425.342] (-429.530) * (-427.367) [-425.552] (-428.768) (-428.909) -- 0:00:46
245000 -- (-429.618) (-429.015) (-428.199) [-432.516] * (-428.496) (-428.510) [-427.896] (-426.244) -- 0:00:46
Average standard deviation of split frequencies: 0.019264
245500 -- (-424.848) (-425.317) [-425.366] (-426.539) * (-425.902) (-428.489) [-426.325] (-427.877) -- 0:00:46
246000 -- (-425.935) (-428.273) (-427.542) [-425.826] * (-425.916) [-431.006] (-426.421) (-431.086) -- 0:00:45
246500 -- (-425.922) (-426.982) [-425.987] (-429.395) * (-426.723) (-425.545) [-425.745] (-427.902) -- 0:00:45
247000 -- (-425.849) (-426.153) (-426.113) [-425.785] * [-425.461] (-427.991) (-428.707) (-427.604) -- 0:00:45
247500 -- (-426.708) (-429.039) (-430.206) [-426.591] * (-427.040) [-425.545] (-427.919) (-426.662) -- 0:00:45
248000 -- (-427.126) (-430.758) (-425.819) [-427.032] * (-430.558) [-426.272] (-426.178) (-428.019) -- 0:00:45
248500 -- (-431.240) (-431.518) [-426.458] (-425.898) * (-428.327) (-427.261) [-426.410] (-425.572) -- 0:00:45
249000 -- [-425.433] (-427.314) (-428.178) (-429.925) * (-428.937) (-425.685) [-424.671] (-427.025) -- 0:00:45
249500 -- (-427.764) (-426.530) [-425.975] (-427.866) * (-425.564) (-426.165) (-426.001) [-427.832] -- 0:00:45
250000 -- [-429.121] (-424.999) (-427.585) (-426.302) * [-424.679] (-428.159) (-425.012) (-425.643) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-425.635) (-427.189) [-426.660] (-426.046) * (-425.773) (-426.334) [-425.177] (-429.504) -- 0:00:44
251000 -- [-425.452] (-425.732) (-425.601) (-431.421) * (-425.226) (-426.785) [-428.318] (-428.581) -- 0:00:47
251500 -- [-424.846] (-431.099) (-427.189) (-428.131) * (-426.671) [-429.460] (-427.473) (-426.862) -- 0:00:47
252000 -- (-426.161) [-425.738] (-426.052) (-426.727) * (-425.475) (-428.226) (-425.312) [-426.439] -- 0:00:47
252500 -- [-425.851] (-427.642) (-426.103) (-426.175) * [-426.029] (-424.936) (-425.585) (-427.378) -- 0:00:47
253000 -- (-425.670) (-427.248) (-426.041) [-426.402] * [-430.216] (-426.812) (-427.532) (-427.817) -- 0:00:47
253500 -- (-426.006) [-427.808] (-427.104) (-427.186) * (-428.997) (-427.825) [-431.247] (-428.234) -- 0:00:47
254000 -- (-428.053) [-425.969] (-427.105) (-426.800) * [-425.127] (-425.131) (-431.657) (-425.301) -- 0:00:46
254500 -- (-431.802) (-425.693) [-426.846] (-426.748) * (-424.657) (-426.200) [-427.404] (-425.656) -- 0:00:46
255000 -- [-425.572] (-429.384) (-430.232) (-428.298) * (-425.626) [-426.304] (-426.200) (-425.915) -- 0:00:46
Average standard deviation of split frequencies: 0.016880
255500 -- (-427.119) (-432.675) [-425.350] (-427.932) * (-430.981) [-428.060] (-425.422) (-426.630) -- 0:00:46
256000 -- (-426.702) (-427.286) [-427.717] (-426.243) * (-425.303) (-426.214) [-429.670] (-430.382) -- 0:00:46
256500 -- (-426.004) (-426.677) (-430.204) [-426.738] * [-425.162] (-429.176) (-427.304) (-430.749) -- 0:00:46
257000 -- (-426.256) (-427.051) [-427.084] (-426.538) * (-426.697) [-425.875] (-425.602) (-428.167) -- 0:00:46
257500 -- (-426.730) [-425.913] (-425.909) (-426.033) * (-425.752) [-426.427] (-426.115) (-427.246) -- 0:00:46
258000 -- (-426.492) (-425.661) (-425.971) [-425.311] * (-427.362) (-425.715) [-426.396] (-431.718) -- 0:00:46
258500 -- (-427.591) (-427.943) (-429.670) [-427.435] * [-427.587] (-429.387) (-426.253) (-429.492) -- 0:00:45
259000 -- (-425.554) (-425.258) [-427.496] (-427.402) * [-426.717] (-426.222) (-432.703) (-430.165) -- 0:00:45
259500 -- (-429.352) [-426.308] (-430.794) (-427.315) * (-430.308) (-426.677) (-430.810) [-426.984] -- 0:00:45
260000 -- [-426.685] (-425.893) (-427.700) (-426.399) * [-429.601] (-429.180) (-430.844) (-428.287) -- 0:00:45
Average standard deviation of split frequencies: 0.016778
260500 -- [-425.426] (-426.259) (-427.486) (-427.225) * (-429.010) [-427.194] (-434.541) (-428.237) -- 0:00:45
261000 -- (-425.468) [-429.594] (-425.024) (-427.749) * (-426.726) [-424.705] (-426.099) (-426.818) -- 0:00:45
261500 -- (-426.269) [-424.989] (-427.122) (-429.836) * (-428.902) (-425.323) (-426.921) [-425.671] -- 0:00:45
262000 -- (-429.852) [-426.738] (-433.663) (-427.580) * (-426.001) (-427.488) [-429.114] (-426.009) -- 0:00:45
262500 -- (-428.342) (-428.115) [-425.216] (-432.167) * (-425.956) [-431.495] (-426.946) (-428.936) -- 0:00:44
263000 -- (-426.823) [-426.501] (-428.535) (-426.663) * [-425.415] (-426.412) (-427.195) (-425.365) -- 0:00:44
263500 -- (-425.681) [-425.673] (-432.860) (-427.595) * (-427.554) (-427.928) [-427.378] (-426.238) -- 0:00:44
264000 -- (-426.206) (-426.217) (-433.458) [-425.537] * (-426.426) [-429.303] (-424.611) (-426.149) -- 0:00:44
264500 -- [-429.215] (-425.870) (-425.676) (-426.205) * (-425.532) (-430.495) [-427.269] (-425.648) -- 0:00:44
265000 -- [-426.030] (-426.929) (-428.841) (-425.006) * [-425.336] (-426.947) (-430.344) (-431.223) -- 0:00:44
Average standard deviation of split frequencies: 0.017328
265500 -- (-427.199) [-425.492] (-426.941) (-424.997) * (-432.803) (-425.051) [-426.903] (-425.205) -- 0:00:44
266000 -- (-427.137) [-425.146] (-427.334) (-426.384) * (-431.575) (-427.804) (-429.631) [-428.155] -- 0:00:44
266500 -- (-428.938) [-426.709] (-426.191) (-426.045) * (-427.971) (-428.854) [-425.435] (-428.580) -- 0:00:44
267000 -- (-428.342) (-427.378) (-426.321) [-425.960] * (-426.172) (-425.089) [-426.042] (-426.325) -- 0:00:43
267500 -- (-426.182) [-426.579] (-427.258) (-426.753) * [-428.455] (-427.625) (-425.799) (-426.090) -- 0:00:43
268000 -- (-424.709) (-425.583) [-427.432] (-428.468) * (-425.611) (-425.587) [-426.861] (-429.097) -- 0:00:46
268500 -- (-427.169) (-425.837) [-429.254] (-430.132) * (-428.979) (-426.103) (-426.996) [-430.295] -- 0:00:46
269000 -- (-426.257) (-428.878) (-425.495) [-429.661] * (-426.930) [-426.485] (-428.110) (-430.261) -- 0:00:46
269500 -- (-425.065) (-425.418) (-426.478) [-431.134] * (-425.326) (-427.403) [-426.016] (-428.574) -- 0:00:46
270000 -- (-426.672) (-428.178) (-428.718) [-427.037] * [-425.023] (-427.766) (-424.881) (-426.841) -- 0:00:45
Average standard deviation of split frequencies: 0.016904
270500 -- (-425.971) (-424.400) [-427.156] (-425.565) * (-426.068) (-427.670) (-425.040) [-427.790] -- 0:00:45
271000 -- [-426.052] (-426.589) (-428.734) (-427.258) * (-428.312) (-427.834) [-424.742] (-426.390) -- 0:00:45
271500 -- (-430.213) (-426.660) [-425.239] (-427.267) * [-431.074] (-426.995) (-427.291) (-424.756) -- 0:00:45
272000 -- [-424.939] (-425.466) (-428.459) (-425.890) * (-428.590) [-426.853] (-429.833) (-425.348) -- 0:00:45
272500 -- [-427.711] (-427.930) (-437.272) (-425.526) * (-426.451) (-428.032) (-426.670) [-426.136] -- 0:00:45
273000 -- (-428.652) (-429.155) [-431.150] (-426.345) * [-425.489] (-427.803) (-426.027) (-428.452) -- 0:00:45
273500 -- [-424.721] (-426.949) (-426.805) (-430.028) * [-425.012] (-428.632) (-425.879) (-430.043) -- 0:00:45
274000 -- [-425.574] (-427.284) (-428.310) (-426.760) * [-425.408] (-425.840) (-426.905) (-427.033) -- 0:00:45
274500 -- (-426.288) (-428.831) (-425.385) [-426.541] * [-427.093] (-425.435) (-428.548) (-428.244) -- 0:00:44
275000 -- (-427.190) (-430.454) [-426.576] (-429.373) * (-429.991) (-425.770) [-426.452] (-425.573) -- 0:00:44
Average standard deviation of split frequencies: 0.016176
275500 -- (-426.196) (-429.946) [-426.445] (-427.532) * [-426.290] (-428.537) (-427.264) (-426.947) -- 0:00:44
276000 -- (-426.521) (-426.849) [-427.723] (-424.940) * [-426.010] (-427.452) (-426.299) (-428.364) -- 0:00:44
276500 -- [-426.665] (-426.344) (-430.070) (-425.818) * (-427.339) [-424.750] (-431.449) (-426.927) -- 0:00:44
277000 -- [-427.178] (-428.158) (-429.782) (-429.879) * (-424.974) (-425.356) (-425.189) [-428.025] -- 0:00:44
277500 -- (-425.259) (-426.339) (-425.903) [-427.516] * [-426.721] (-430.625) (-428.736) (-425.632) -- 0:00:44
278000 -- (-425.260) (-426.613) [-430.483] (-426.892) * (-427.103) (-428.224) [-426.125] (-425.214) -- 0:00:44
278500 -- (-427.443) [-426.688] (-425.049) (-427.064) * [-431.369] (-429.536) (-426.990) (-425.840) -- 0:00:44
279000 -- [-425.799] (-429.315) (-426.574) (-428.117) * (-429.356) (-425.629) [-426.541] (-425.402) -- 0:00:43
279500 -- (-428.222) (-429.440) [-429.512] (-426.964) * [-425.846] (-426.115) (-427.994) (-425.561) -- 0:00:43
280000 -- (-427.064) (-428.805) (-427.309) [-427.517] * [-430.349] (-426.596) (-427.953) (-425.818) -- 0:00:43
Average standard deviation of split frequencies: 0.015907
280500 -- (-428.367) (-428.203) (-428.547) [-426.055] * [-431.377] (-425.514) (-427.309) (-426.396) -- 0:00:43
281000 -- (-425.179) (-425.013) [-428.632] (-425.400) * (-426.323) [-425.661] (-428.206) (-426.191) -- 0:00:43
281500 -- (-426.321) [-425.737] (-426.730) (-424.635) * [-425.132] (-426.498) (-427.381) (-426.821) -- 0:00:43
282000 -- (-426.414) (-425.396) (-428.216) [-428.423] * (-426.358) (-424.948) (-426.424) [-426.417] -- 0:00:43
282500 -- (-425.764) (-425.862) [-428.728] (-426.045) * (-425.445) (-424.834) (-426.513) [-427.014] -- 0:00:43
283000 -- (-426.220) [-426.441] (-426.387) (-427.250) * (-426.275) (-427.971) (-426.308) [-428.037] -- 0:00:43
283500 -- [-426.365] (-425.057) (-428.648) (-425.801) * (-424.496) [-426.299] (-426.779) (-426.757) -- 0:00:42
284000 -- (-428.434) (-427.474) [-425.902] (-426.245) * [-424.684] (-427.336) (-425.064) (-425.887) -- 0:00:42
284500 -- (-427.202) (-425.365) (-426.147) [-425.751] * (-427.595) [-429.645] (-425.626) (-428.322) -- 0:00:45
285000 -- (-425.573) [-426.653] (-426.856) (-427.630) * (-425.389) (-426.704) [-426.069] (-425.957) -- 0:00:45
Average standard deviation of split frequencies: 0.017258
285500 -- (-427.438) (-427.173) (-428.350) [-426.598] * (-424.932) (-427.574) [-425.011] (-429.117) -- 0:00:45
286000 -- (-426.819) (-426.487) (-425.069) [-425.643] * [-427.608] (-431.007) (-427.872) (-426.463) -- 0:00:44
286500 -- [-425.325] (-427.032) (-424.974) (-425.920) * (-427.651) (-425.766) (-426.242) [-428.939] -- 0:00:44
287000 -- [-426.059] (-426.817) (-429.125) (-426.211) * [-428.179] (-426.754) (-426.729) (-426.038) -- 0:00:44
287500 -- (-427.234) (-430.754) (-424.693) [-425.242] * (-428.739) (-429.605) [-429.714] (-426.312) -- 0:00:44
288000 -- (-429.822) (-427.104) (-427.449) [-427.451] * (-425.995) (-426.076) (-430.696) [-425.543] -- 0:00:44
288500 -- [-425.427] (-426.268) (-429.436) (-425.892) * (-424.987) [-426.149] (-429.787) (-425.058) -- 0:00:44
289000 -- (-426.534) (-425.050) [-428.618] (-429.241) * [-425.078] (-426.562) (-426.060) (-425.612) -- 0:00:44
289500 -- (-426.390) (-425.475) (-425.971) [-426.950] * (-427.991) (-427.157) (-426.753) [-424.678] -- 0:00:44
290000 -- (-429.239) (-426.040) (-425.536) [-427.147] * (-426.508) (-426.088) [-428.281] (-424.408) -- 0:00:44
Average standard deviation of split frequencies: 0.018698
290500 -- (-429.742) (-425.131) (-426.406) [-427.618] * [-425.032] (-426.939) (-425.856) (-426.669) -- 0:00:43
291000 -- (-428.151) (-426.454) (-427.534) [-426.388] * (-427.873) [-425.676] (-428.828) (-424.740) -- 0:00:43
291500 -- (-426.636) [-427.688] (-426.733) (-425.197) * [-426.865] (-427.479) (-425.884) (-427.222) -- 0:00:43
292000 -- [-425.517] (-427.687) (-425.242) (-426.765) * (-426.971) [-426.585] (-427.219) (-427.782) -- 0:00:43
292500 -- (-427.340) (-427.764) [-424.941] (-428.174) * (-426.004) (-426.061) [-425.566] (-428.998) -- 0:00:43
293000 -- (-426.702) (-426.105) [-425.975] (-426.284) * (-426.732) (-424.457) (-425.435) [-428.487] -- 0:00:43
293500 -- (-429.531) (-426.461) (-432.515) [-426.432] * (-425.457) (-427.454) (-425.175) [-427.128] -- 0:00:43
294000 -- (-427.826) (-424.863) [-427.603] (-429.889) * (-425.808) [-427.504] (-426.491) (-430.559) -- 0:00:43
294500 -- [-426.256] (-427.112) (-426.789) (-425.086) * (-427.667) (-425.925) (-429.580) [-424.876] -- 0:00:43
295000 -- [-430.302] (-425.109) (-429.027) (-425.516) * (-425.991) [-429.059] (-426.590) (-425.669) -- 0:00:43
Average standard deviation of split frequencies: 0.018736
295500 -- (-427.272) (-426.023) [-428.065] (-426.609) * (-434.402) [-427.717] (-431.031) (-425.840) -- 0:00:42
296000 -- (-428.530) [-426.068] (-427.305) (-428.913) * [-426.339] (-426.766) (-427.317) (-426.877) -- 0:00:42
296500 -- (-425.847) [-425.398] (-429.154) (-427.243) * (-424.825) (-425.600) [-428.179] (-426.318) -- 0:00:42
297000 -- (-426.822) (-425.530) [-426.341] (-436.527) * (-425.477) (-429.022) [-425.310] (-428.166) -- 0:00:42
297500 -- (-427.817) [-432.243] (-426.523) (-426.728) * (-427.829) [-429.907] (-426.532) (-427.834) -- 0:00:42
298000 -- [-424.757] (-426.379) (-430.345) (-426.278) * [-428.297] (-432.378) (-425.567) (-428.656) -- 0:00:42
298500 -- (-428.818) [-427.416] (-426.748) (-426.359) * [-427.626] (-430.873) (-425.554) (-427.285) -- 0:00:42
299000 -- [-428.307] (-426.117) (-424.836) (-426.891) * [-428.380] (-426.939) (-428.680) (-426.281) -- 0:00:42
299500 -- (-428.161) (-429.804) (-426.195) [-428.034] * [-428.877] (-427.160) (-425.633) (-426.290) -- 0:00:42
300000 -- (-426.940) (-427.373) [-426.501] (-425.488) * (-425.817) (-426.822) [-426.604] (-425.351) -- 0:00:42
Average standard deviation of split frequencies: 0.017431
300500 -- (-428.750) (-426.575) [-425.595] (-425.433) * (-424.622) (-431.869) (-425.877) [-428.056] -- 0:00:41
301000 -- [-428.540] (-425.620) (-426.133) (-426.084) * (-425.634) (-429.212) (-432.938) [-428.570] -- 0:00:41
301500 -- (-427.167) (-426.765) [-425.811] (-426.463) * (-425.736) (-425.387) [-424.912] (-425.886) -- 0:00:44
302000 -- (-426.383) (-425.435) (-427.495) [-425.431] * (-425.525) (-428.353) (-427.570) [-426.512] -- 0:00:43
302500 -- (-429.414) [-425.804] (-427.620) (-426.523) * (-426.235) (-429.980) (-428.797) [-429.515] -- 0:00:43
303000 -- (-426.791) (-425.360) [-424.778] (-426.020) * (-425.341) (-425.230) (-426.307) [-430.532] -- 0:00:43
303500 -- (-428.429) (-428.211) [-426.639] (-429.201) * [-425.478] (-425.245) (-428.725) (-427.692) -- 0:00:43
304000 -- [-424.638] (-426.508) (-427.381) (-427.347) * (-425.481) (-427.080) (-429.197) [-433.291] -- 0:00:43
304500 -- (-424.700) (-429.136) (-426.734) [-425.234] * (-424.579) (-428.110) [-425.635] (-429.286) -- 0:00:43
305000 -- (-424.830) (-429.384) [-426.409] (-425.129) * (-426.181) (-426.956) (-426.979) [-429.820] -- 0:00:43
Average standard deviation of split frequencies: 0.016946
305500 -- (-427.713) (-430.105) (-429.028) [-433.070] * [-427.096] (-427.681) (-427.121) (-427.715) -- 0:00:43
306000 -- (-433.048) (-429.076) [-427.559] (-426.979) * [-427.495] (-429.989) (-427.400) (-426.097) -- 0:00:43
306500 -- (-430.307) (-431.151) (-427.159) [-427.237] * (-429.282) (-425.879) (-425.371) [-424.699] -- 0:00:42
307000 -- (-430.558) (-425.324) (-425.476) [-426.962] * [-430.759] (-428.966) (-428.134) (-424.965) -- 0:00:42
307500 -- [-429.910] (-424.867) (-426.478) (-425.918) * (-424.829) (-429.360) [-426.392] (-425.737) -- 0:00:42
308000 -- (-425.710) [-425.979] (-428.997) (-427.906) * [-429.394] (-426.271) (-426.925) (-426.785) -- 0:00:42
308500 -- (-428.739) (-427.634) [-427.795] (-426.401) * (-424.690) [-429.058] (-427.287) (-425.941) -- 0:00:42
309000 -- [-425.691] (-427.658) (-427.627) (-427.179) * (-425.656) (-432.954) (-428.946) [-429.253] -- 0:00:42
309500 -- (-427.059) (-426.126) [-426.771] (-424.704) * [-426.209] (-427.457) (-426.281) (-428.879) -- 0:00:42
310000 -- (-432.118) (-424.710) [-429.024] (-430.093) * (-426.618) (-426.123) [-427.682] (-426.392) -- 0:00:42
Average standard deviation of split frequencies: 0.017405
310500 -- [-427.745] (-424.900) (-428.550) (-430.380) * (-425.592) (-428.885) (-426.155) [-427.249] -- 0:00:42
311000 -- (-428.740) [-428.758] (-426.898) (-427.672) * [-427.700] (-427.469) (-426.793) (-427.339) -- 0:00:42
311500 -- (-427.741) (-426.137) (-426.445) [-428.252] * (-426.007) [-429.658] (-429.363) (-426.014) -- 0:00:41
312000 -- (-425.720) (-425.158) (-426.875) [-427.138] * (-427.783) [-426.839] (-425.273) (-429.190) -- 0:00:41
312500 -- (-426.746) (-426.006) [-426.587] (-426.441) * (-427.351) [-425.267] (-430.809) (-428.965) -- 0:00:41
313000 -- (-426.154) (-425.686) (-426.008) [-427.538] * (-427.787) (-426.549) [-425.075] (-428.116) -- 0:00:41
313500 -- (-425.603) (-426.373) (-427.179) [-427.437] * (-427.552) (-425.045) (-426.888) [-426.690] -- 0:00:41
314000 -- [-425.631] (-428.572) (-426.124) (-425.504) * [-426.208] (-425.934) (-424.616) (-427.028) -- 0:00:41
314500 -- (-426.743) (-431.145) (-425.472) [-425.571] * (-426.517) (-426.331) [-425.951] (-427.247) -- 0:00:41
315000 -- (-426.200) (-432.742) (-428.371) [-426.440] * (-428.861) (-427.279) [-426.685] (-439.792) -- 0:00:41
Average standard deviation of split frequencies: 0.017463
315500 -- (-424.767) (-426.115) (-430.377) [-431.104] * (-428.444) (-427.782) [-424.656] (-426.134) -- 0:00:41
316000 -- (-426.926) (-425.246) (-427.531) [-426.218] * (-427.519) [-428.126] (-425.217) (-431.268) -- 0:00:41
316500 -- [-425.786] (-424.959) (-428.187) (-428.947) * [-426.940] (-426.739) (-424.775) (-426.556) -- 0:00:41
317000 -- (-424.739) (-426.012) (-428.803) [-425.560] * (-431.368) (-427.948) (-431.298) [-429.414] -- 0:00:40
317500 -- (-428.054) (-428.288) (-426.882) [-424.643] * (-427.742) (-430.310) (-426.806) [-424.762] -- 0:00:40
318000 -- (-426.645) [-429.705] (-426.970) (-431.783) * (-428.882) (-425.930) (-427.480) [-424.771] -- 0:00:42
318500 -- (-426.233) (-430.502) [-427.439] (-425.776) * (-430.840) [-426.148] (-427.064) (-426.438) -- 0:00:42
319000 -- (-425.537) (-426.125) [-427.542] (-427.366) * (-428.095) (-426.864) (-425.915) [-428.825] -- 0:00:42
319500 -- (-426.096) [-425.861] (-426.851) (-427.509) * [-428.979] (-427.787) (-425.656) (-429.017) -- 0:00:42
320000 -- [-425.146] (-426.938) (-429.160) (-425.679) * [-426.452] (-426.974) (-427.102) (-428.210) -- 0:00:42
Average standard deviation of split frequencies: 0.016517
320500 -- (-427.651) (-426.294) (-426.147) [-426.554] * (-425.561) (-424.777) (-424.840) [-427.575] -- 0:00:42
321000 -- (-426.647) (-425.212) (-427.337) [-426.746] * (-430.044) (-426.154) [-426.753] (-428.234) -- 0:00:42
321500 -- (-426.886) (-427.499) (-430.612) [-424.608] * (-425.470) (-425.347) (-428.491) [-429.642] -- 0:00:42
322000 -- (-424.881) [-427.526] (-427.078) (-427.547) * [-429.054] (-427.191) (-426.346) (-425.211) -- 0:00:42
322500 -- (-427.546) [-425.037] (-426.936) (-430.493) * (-425.212) [-427.774] (-434.320) (-431.027) -- 0:00:42
323000 -- (-429.666) (-426.357) [-425.845] (-430.308) * (-425.934) [-426.068] (-426.419) (-430.728) -- 0:00:41
323500 -- (-428.324) [-426.807] (-429.453) (-425.527) * [-425.712] (-428.394) (-427.261) (-427.511) -- 0:00:41
324000 -- (-425.259) [-425.728] (-428.579) (-431.656) * (-426.506) (-430.117) (-433.584) [-427.138] -- 0:00:41
324500 -- [-427.937] (-427.471) (-425.867) (-431.542) * (-425.627) (-427.390) (-426.606) [-427.644] -- 0:00:41
325000 -- [-433.197] (-425.375) (-426.800) (-428.060) * [-425.949] (-425.626) (-425.486) (-428.255) -- 0:00:41
Average standard deviation of split frequencies: 0.016161
325500 -- (-429.628) (-428.286) (-429.831) [-425.757] * (-426.079) (-425.660) [-425.857] (-426.275) -- 0:00:41
326000 -- (-428.857) (-426.584) (-426.970) [-425.400] * [-426.192] (-429.811) (-427.299) (-429.889) -- 0:00:41
326500 -- (-429.576) [-426.375] (-425.311) (-427.025) * (-427.627) (-426.064) [-428.022] (-426.809) -- 0:00:41
327000 -- [-425.749] (-426.057) (-426.103) (-426.908) * [-427.379] (-425.850) (-428.562) (-427.708) -- 0:00:41
327500 -- (-429.292) (-427.644) [-427.655] (-425.076) * (-431.299) (-428.061) (-425.590) [-430.777] -- 0:00:41
328000 -- (-428.886) (-426.128) (-425.674) [-427.202] * (-427.971) (-426.589) (-434.277) [-425.696] -- 0:00:40
328500 -- (-427.696) (-425.662) [-427.754] (-428.825) * [-427.746] (-426.619) (-436.666) (-429.002) -- 0:00:40
329000 -- [-427.610] (-426.974) (-428.841) (-428.977) * (-426.141) [-426.474] (-425.730) (-425.175) -- 0:00:40
329500 -- (-425.523) (-428.082) [-426.630] (-429.255) * (-425.593) (-426.423) (-429.000) [-427.353] -- 0:00:40
330000 -- (-427.164) (-427.539) [-425.847] (-426.333) * (-427.117) [-426.275] (-428.349) (-426.694) -- 0:00:40
Average standard deviation of split frequencies: 0.015346
330500 -- [-426.071] (-425.834) (-426.754) (-428.330) * (-424.820) (-424.873) (-426.354) [-425.516] -- 0:00:40
331000 -- (-427.103) (-428.493) [-428.671] (-428.520) * [-425.755] (-425.759) (-429.970) (-425.392) -- 0:00:40
331500 -- (-429.164) (-428.569) (-427.415) [-425.119] * (-424.927) [-425.629] (-428.675) (-425.867) -- 0:00:40
332000 -- (-431.593) [-425.802] (-429.027) (-427.103) * [-425.462] (-425.984) (-425.937) (-425.291) -- 0:00:40
332500 -- (-426.823) [-426.142] (-426.099) (-430.962) * (-426.222) (-426.411) (-425.017) [-428.068] -- 0:00:40
333000 -- [-427.047] (-428.398) (-427.428) (-429.889) * [-426.923] (-428.983) (-425.497) (-428.187) -- 0:00:40
333500 -- (-429.349) [-430.545] (-426.521) (-426.877) * (-429.013) (-426.445) (-427.025) [-426.108] -- 0:00:39
334000 -- (-430.271) (-425.247) [-426.310] (-427.361) * [-425.127] (-427.375) (-425.707) (-424.440) -- 0:00:39
334500 -- (-425.307) (-427.284) [-428.011] (-432.910) * [-426.167] (-429.752) (-426.497) (-428.717) -- 0:00:41
335000 -- (-425.862) (-427.437) [-425.948] (-429.817) * (-428.289) (-425.909) [-429.343] (-427.362) -- 0:00:41
Average standard deviation of split frequencies: 0.014938
335500 -- [-427.986] (-424.725) (-433.377) (-427.799) * [-427.965] (-427.990) (-427.130) (-425.928) -- 0:00:41
336000 -- (-428.249) [-428.773] (-426.427) (-429.869) * (-426.990) (-428.654) [-428.016] (-424.866) -- 0:00:41
336500 -- (-427.998) (-427.043) [-426.230] (-426.211) * (-425.754) (-427.443) [-429.665] (-426.936) -- 0:00:41
337000 -- (-428.307) [-427.639] (-424.946) (-426.428) * (-425.949) (-429.219) (-426.481) [-425.584] -- 0:00:41
337500 -- (-426.633) (-429.814) [-426.629] (-425.654) * (-425.357) (-427.072) [-426.000] (-425.392) -- 0:00:41
338000 -- (-427.851) [-425.304] (-425.033) (-427.418) * (-431.344) (-427.715) (-428.085) [-427.755] -- 0:00:41
338500 -- (-432.953) [-426.238] (-429.751) (-426.869) * (-429.328) [-425.418] (-424.681) (-428.091) -- 0:00:41
339000 -- [-425.109] (-427.458) (-428.954) (-424.852) * (-428.417) (-425.563) (-425.129) [-427.518] -- 0:00:40
339500 -- [-425.582] (-426.245) (-427.011) (-426.218) * (-424.739) [-428.660] (-424.849) (-429.944) -- 0:00:40
340000 -- [-427.693] (-429.022) (-425.891) (-430.831) * (-425.194) (-429.254) [-426.310] (-427.272) -- 0:00:40
Average standard deviation of split frequencies: 0.013838
340500 -- (-427.076) [-425.780] (-425.760) (-429.899) * [-425.763] (-428.688) (-426.774) (-426.072) -- 0:00:40
341000 -- (-426.441) [-425.622] (-430.915) (-426.828) * (-428.482) [-426.489] (-430.468) (-427.277) -- 0:00:40
341500 -- (-427.011) (-425.071) (-428.000) [-430.933] * (-425.462) [-426.301] (-427.552) (-427.214) -- 0:00:40
342000 -- (-426.158) (-425.508) [-427.918] (-427.414) * (-424.931) (-425.598) (-426.199) [-428.527] -- 0:00:40
342500 -- (-428.435) (-425.136) [-426.755] (-426.568) * (-425.169) (-425.491) (-427.707) [-426.704] -- 0:00:40
343000 -- (-425.895) (-428.193) [-426.535] (-428.270) * (-425.803) [-425.243] (-429.895) (-426.110) -- 0:00:40
343500 -- (-428.437) [-426.905] (-427.076) (-425.519) * (-426.720) [-427.373] (-425.381) (-427.848) -- 0:00:40
344000 -- [-425.315] (-432.482) (-426.653) (-424.420) * (-428.935) (-428.845) (-426.834) [-426.407] -- 0:00:40
344500 -- [-425.183] (-429.487) (-425.727) (-429.004) * (-429.171) (-427.120) (-426.706) [-426.475] -- 0:00:39
345000 -- (-428.455) (-427.718) [-426.684] (-430.485) * (-428.014) (-428.809) (-425.284) [-428.155] -- 0:00:39
Average standard deviation of split frequencies: 0.013144
345500 -- (-429.958) (-430.469) [-425.797] (-431.629) * [-427.264] (-425.071) (-427.575) (-428.707) -- 0:00:39
346000 -- [-427.273] (-433.694) (-426.842) (-428.577) * (-429.018) [-428.172] (-425.593) (-428.033) -- 0:00:39
346500 -- (-426.778) [-427.734] (-436.528) (-425.419) * (-430.931) (-427.027) (-430.455) [-428.312] -- 0:00:39
347000 -- (-429.889) (-424.938) (-429.172) [-426.359] * [-425.088] (-427.486) (-431.970) (-425.974) -- 0:00:39
347500 -- [-428.454] (-427.042) (-428.089) (-424.828) * [-425.158] (-427.113) (-430.365) (-426.784) -- 0:00:39
348000 -- (-431.480) (-426.041) (-425.789) [-426.677] * (-426.569) (-426.711) [-425.339] (-426.615) -- 0:00:39
348500 -- (-427.672) (-428.423) [-427.403] (-424.912) * [-425.968] (-429.313) (-424.601) (-426.649) -- 0:00:39
349000 -- [-426.979] (-429.663) (-428.284) (-427.804) * (-425.483) (-428.930) [-427.317] (-426.614) -- 0:00:39
349500 -- (-429.683) (-426.740) [-428.256] (-428.827) * [-426.275] (-426.841) (-429.807) (-427.479) -- 0:00:39
350000 -- (-429.727) (-427.504) [-425.067] (-427.310) * (-427.356) (-426.992) (-431.225) [-426.243] -- 0:00:39
Average standard deviation of split frequencies: 0.013443
350500 -- [-429.361] (-425.964) (-432.711) (-425.979) * [-426.572] (-427.256) (-426.893) (-426.532) -- 0:00:38
351000 -- [-426.560] (-426.172) (-429.940) (-425.820) * (-427.134) [-425.579] (-427.532) (-426.942) -- 0:00:38
351500 -- (-427.651) (-429.627) (-427.639) [-425.528] * (-429.152) (-425.487) [-424.871] (-424.917) -- 0:00:40
352000 -- (-431.379) [-433.185] (-428.329) (-426.959) * (-426.434) [-426.213] (-425.301) (-430.510) -- 0:00:40
352500 -- (-431.120) (-425.834) [-426.467] (-426.167) * (-427.143) (-426.800) (-424.957) [-426.043] -- 0:00:40
353000 -- (-425.309) (-431.592) [-427.977] (-425.829) * (-424.834) (-425.913) (-425.917) [-428.638] -- 0:00:40
353500 -- (-427.200) [-426.046] (-427.113) (-426.526) * [-425.163] (-431.782) (-429.143) (-429.537) -- 0:00:40
354000 -- [-428.128] (-428.074) (-426.465) (-427.767) * (-424.581) (-427.138) (-426.421) [-430.899] -- 0:00:40
354500 -- (-425.154) [-425.493] (-425.502) (-426.798) * [-424.745] (-428.611) (-427.045) (-427.618) -- 0:00:40
355000 -- (-428.073) [-425.427] (-433.748) (-425.641) * (-424.952) [-428.609] (-429.040) (-427.693) -- 0:00:39
Average standard deviation of split frequencies: 0.013242
355500 -- (-427.379) [-424.557] (-425.971) (-427.371) * (-427.671) [-425.806] (-428.182) (-426.171) -- 0:00:39
356000 -- (-434.351) [-426.181] (-432.309) (-429.989) * (-429.436) [-426.710] (-427.991) (-429.024) -- 0:00:39
356500 -- (-427.545) [-426.370] (-427.740) (-426.452) * [-427.052] (-425.467) (-425.120) (-425.040) -- 0:00:39
357000 -- [-425.774] (-425.780) (-427.322) (-428.443) * [-426.781] (-427.268) (-425.444) (-430.493) -- 0:00:39
357500 -- [-425.555] (-425.316) (-427.608) (-425.182) * (-425.529) [-426.000] (-424.780) (-426.406) -- 0:00:39
358000 -- (-427.547) (-429.558) [-432.754] (-426.124) * (-426.890) [-428.184] (-427.644) (-426.768) -- 0:00:39
358500 -- (-426.882) (-429.534) [-425.526] (-424.726) * [-425.055] (-426.483) (-426.604) (-424.641) -- 0:00:39
359000 -- [-425.994] (-431.412) (-426.810) (-425.099) * (-427.299) (-429.337) [-426.953] (-425.703) -- 0:00:39
359500 -- [-426.015] (-431.232) (-426.358) (-430.264) * (-428.629) (-427.303) (-425.288) [-429.968] -- 0:00:39
360000 -- [-429.362] (-426.280) (-427.360) (-428.099) * (-425.219) (-427.979) [-426.842] (-427.340) -- 0:00:39
Average standard deviation of split frequencies: 0.013224
360500 -- (-427.654) (-427.478) [-428.291] (-426.882) * [-427.588] (-428.413) (-428.451) (-428.711) -- 0:00:39
361000 -- (-426.864) [-425.340] (-425.129) (-430.251) * (-427.610) [-426.691] (-429.861) (-425.097) -- 0:00:38
361500 -- (-425.409) [-426.089] (-426.299) (-428.294) * (-425.781) (-425.247) [-426.403] (-426.241) -- 0:00:38
362000 -- [-425.326] (-427.291) (-425.545) (-429.501) * (-428.049) (-427.156) (-428.224) [-426.209] -- 0:00:38
362500 -- (-425.796) [-429.097] (-427.391) (-426.785) * (-426.802) (-425.851) (-426.034) [-426.410] -- 0:00:38
363000 -- (-425.319) (-427.505) (-425.491) [-426.015] * (-426.661) (-426.233) (-429.076) [-424.866] -- 0:00:38
363500 -- (-425.592) (-427.900) [-427.441] (-426.032) * [-426.200] (-427.000) (-427.949) (-429.651) -- 0:00:38
364000 -- (-428.011) (-427.694) (-430.822) [-426.706] * (-426.889) (-438.951) [-424.697] (-430.667) -- 0:00:38
364500 -- (-427.085) (-429.985) (-425.756) [-426.087] * (-428.253) (-425.434) (-426.177) [-425.381] -- 0:00:38
365000 -- (-427.255) (-425.680) (-428.906) [-425.947] * (-428.779) (-426.038) (-425.172) [-428.067] -- 0:00:38
Average standard deviation of split frequencies: 0.012728
365500 -- (-427.854) [-424.673] (-429.937) (-425.912) * (-426.400) (-428.367) (-425.476) [-425.085] -- 0:00:38
366000 -- (-427.429) (-427.709) [-427.508] (-426.060) * (-431.949) (-426.507) [-426.147] (-427.138) -- 0:00:38
366500 -- (-427.994) (-430.919) (-425.182) [-427.273] * (-425.639) [-425.702] (-425.888) (-428.091) -- 0:00:38
367000 -- (-427.856) [-429.032] (-428.499) (-432.152) * (-429.368) (-427.318) [-426.055] (-428.754) -- 0:00:37
367500 -- (-428.275) [-427.044] (-430.924) (-424.701) * (-427.928) (-429.683) [-425.938] (-428.542) -- 0:00:37
368000 -- [-426.725] (-426.500) (-428.776) (-432.171) * (-428.735) (-427.644) [-427.403] (-426.221) -- 0:00:37
368500 -- [-425.528] (-426.972) (-426.962) (-425.393) * (-434.976) (-424.824) [-426.150] (-424.840) -- 0:00:39
369000 -- (-426.055) (-430.122) [-426.019] (-427.840) * (-427.326) (-425.186) (-425.246) [-432.860] -- 0:00:39
369500 -- [-427.634] (-427.172) (-427.443) (-428.639) * (-425.076) (-425.215) [-430.842] (-427.141) -- 0:00:39
370000 -- (-426.318) (-427.690) (-427.881) [-426.567] * (-426.427) (-427.353) (-425.856) [-425.543] -- 0:00:39
Average standard deviation of split frequencies: 0.011970
370500 -- (-427.727) (-434.222) [-425.458] (-426.369) * (-429.034) (-428.845) (-428.241) [-426.228] -- 0:00:39
371000 -- (-427.991) (-426.532) (-427.365) [-428.846] * (-426.306) (-426.788) (-429.385) [-424.842] -- 0:00:38
371500 -- (-429.833) (-426.899) (-427.281) [-430.953] * (-427.151) (-426.702) [-429.095] (-426.403) -- 0:00:38
372000 -- (-427.988) [-425.844] (-424.844) (-426.156) * [-428.250] (-424.796) (-428.791) (-427.017) -- 0:00:38
372500 -- [-428.556] (-428.399) (-425.962) (-426.425) * (-427.807) (-426.050) [-428.154] (-428.692) -- 0:00:38
373000 -- (-426.251) [-430.914] (-429.341) (-426.528) * (-425.780) (-426.581) (-429.385) [-426.415] -- 0:00:38
373500 -- (-426.816) (-428.738) (-424.779) [-425.468] * [-425.534] (-427.204) (-428.573) (-425.742) -- 0:00:38
374000 -- (-428.974) [-427.524] (-424.703) (-430.144) * (-425.662) (-427.228) (-430.828) [-425.560] -- 0:00:38
374500 -- (-429.560) (-425.883) [-426.008] (-430.811) * (-426.366) [-425.029] (-430.665) (-425.649) -- 0:00:38
375000 -- [-426.379] (-427.390) (-425.461) (-432.216) * (-427.304) (-425.044) (-425.672) [-426.459] -- 0:00:38
Average standard deviation of split frequencies: 0.011579
375500 -- (-427.883) (-426.874) (-426.901) [-425.187] * (-424.514) (-427.173) (-426.563) [-425.074] -- 0:00:38
376000 -- [-427.793] (-429.909) (-426.690) (-426.403) * (-424.413) [-431.824] (-427.268) (-426.955) -- 0:00:38
376500 -- (-425.986) (-432.526) (-428.391) [-426.117] * [-426.954] (-428.324) (-425.197) (-425.497) -- 0:00:38
377000 -- (-426.936) (-433.465) [-426.342] (-427.481) * (-428.263) (-426.322) [-426.823] (-424.857) -- 0:00:38
377500 -- (-427.148) (-429.826) (-428.469) [-425.135] * [-425.558] (-426.205) (-426.509) (-427.784) -- 0:00:37
378000 -- (-425.701) (-428.171) (-427.658) [-427.549] * (-426.098) (-428.416) [-428.637] (-425.735) -- 0:00:37
378500 -- (-425.874) (-427.194) [-424.678] (-426.642) * (-425.992) (-426.267) [-426.075] (-425.868) -- 0:00:37
379000 -- (-430.694) (-426.267) (-427.658) [-426.274] * [-426.408] (-428.445) (-427.656) (-428.025) -- 0:00:37
379500 -- (-427.999) [-425.892] (-429.182) (-425.695) * (-426.436) (-427.506) (-428.032) [-425.251] -- 0:00:37
380000 -- (-427.733) (-429.279) [-424.941] (-427.107) * [-426.484] (-425.582) (-432.260) (-427.027) -- 0:00:37
Average standard deviation of split frequencies: 0.011655
380500 -- (-429.831) (-431.513) (-425.363) [-424.949] * (-426.550) (-426.062) [-426.666] (-425.047) -- 0:00:37
381000 -- (-427.911) (-427.444) [-425.541] (-425.420) * (-426.117) [-426.239] (-426.104) (-427.604) -- 0:00:37
381500 -- (-431.907) (-425.685) (-429.348) [-429.048] * [-431.528] (-429.846) (-426.335) (-429.841) -- 0:00:37
382000 -- [-425.247] (-426.060) (-427.665) (-425.894) * [-428.648] (-432.309) (-432.412) (-428.255) -- 0:00:37
382500 -- (-426.314) (-426.791) [-425.910] (-425.352) * (-427.578) (-425.976) (-430.388) [-428.019] -- 0:00:37
383000 -- (-428.899) [-427.832] (-426.827) (-425.279) * (-429.793) (-425.451) [-429.022] (-428.181) -- 0:00:37
383500 -- [-428.296] (-429.557) (-431.755) (-430.089) * (-430.003) (-426.139) (-427.474) [-425.457] -- 0:00:36
384000 -- (-427.389) (-428.249) [-426.297] (-431.154) * [-428.428] (-425.540) (-427.497) (-424.955) -- 0:00:36
384500 -- [-427.403] (-426.228) (-428.699) (-432.471) * (-434.013) [-426.770] (-427.194) (-426.345) -- 0:00:36
385000 -- (-426.455) (-428.347) [-425.565] (-428.235) * (-429.031) (-426.757) (-426.832) [-425.796] -- 0:00:38
Average standard deviation of split frequencies: 0.010991
385500 -- (-427.698) (-428.650) [-426.020] (-425.657) * (-425.492) (-426.645) [-426.532] (-426.150) -- 0:00:38
386000 -- (-429.530) [-428.808] (-425.181) (-425.843) * [-425.567] (-427.819) (-426.099) (-426.933) -- 0:00:38
386500 -- (-425.047) [-427.016] (-428.569) (-425.899) * [-425.020] (-424.875) (-426.118) (-426.221) -- 0:00:38
387000 -- (-428.489) (-428.109) [-426.219] (-425.609) * (-428.535) (-426.369) (-432.000) [-427.893] -- 0:00:38
387500 -- (-427.416) (-426.372) [-424.898] (-429.223) * (-426.611) (-425.746) (-426.503) [-428.776] -- 0:00:37
388000 -- [-428.563] (-429.701) (-431.754) (-426.405) * [-426.980] (-430.753) (-427.558) (-427.271) -- 0:00:37
388500 -- [-430.776] (-426.158) (-425.826) (-428.409) * [-427.652] (-427.403) (-424.975) (-429.961) -- 0:00:37
389000 -- (-425.545) (-425.625) (-426.325) [-426.246] * (-428.304) (-427.374) [-427.709] (-429.235) -- 0:00:37
389500 -- (-430.252) (-427.556) (-425.261) [-425.706] * (-427.949) (-426.657) (-425.637) [-428.534] -- 0:00:37
390000 -- [-427.938] (-426.487) (-425.241) (-426.432) * (-431.996) [-427.776] (-425.671) (-428.762) -- 0:00:37
Average standard deviation of split frequencies: 0.010257
390500 -- (-425.003) (-429.826) (-424.833) [-425.672] * (-427.553) (-425.352) (-425.769) [-425.829] -- 0:00:37
391000 -- [-427.926] (-428.675) (-425.553) (-429.056) * [-425.651] (-427.022) (-429.757) (-427.532) -- 0:00:37
391500 -- [-425.291] (-426.395) (-425.395) (-429.239) * [-426.942] (-426.275) (-427.408) (-426.672) -- 0:00:37
392000 -- (-425.452) (-425.981) (-426.125) [-424.857] * (-429.295) (-426.016) (-426.506) [-428.059] -- 0:00:37
392500 -- (-425.316) (-425.752) (-427.010) [-425.278] * (-431.919) [-426.810] (-425.295) (-428.513) -- 0:00:37
393000 -- [-427.296] (-430.265) (-430.017) (-427.615) * (-428.630) (-426.609) (-425.461) [-426.056] -- 0:00:37
393500 -- (-426.336) (-429.349) [-425.639] (-430.357) * (-426.812) [-429.578] (-428.010) (-426.341) -- 0:00:36
394000 -- (-435.860) (-434.004) (-426.321) [-425.977] * (-427.376) [-428.900] (-428.817) (-427.054) -- 0:00:36
394500 -- (-427.352) (-428.818) [-425.972] (-428.506) * (-426.615) (-429.484) (-425.795) [-429.560] -- 0:00:36
395000 -- (-428.214) (-426.000) (-428.665) [-433.344] * (-428.434) (-428.390) (-428.686) [-425.607] -- 0:00:36
Average standard deviation of split frequencies: 0.009873
395500 -- (-427.292) (-426.211) [-427.346] (-426.653) * (-426.843) (-426.049) (-428.424) [-428.316] -- 0:00:36
396000 -- [-428.643] (-426.304) (-426.884) (-428.780) * (-428.038) [-425.701] (-427.894) (-431.019) -- 0:00:36
396500 -- (-425.476) (-427.552) [-427.783] (-424.961) * (-427.783) (-428.210) (-426.112) [-427.115] -- 0:00:36
397000 -- (-427.272) (-430.368) [-428.159] (-425.346) * (-425.977) (-429.065) [-424.890] (-426.051) -- 0:00:36
397500 -- (-425.289) (-427.741) [-427.610] (-425.693) * (-426.650) [-426.900] (-430.321) (-429.679) -- 0:00:36
398000 -- [-425.471] (-427.315) (-426.681) (-427.837) * (-425.951) [-425.334] (-433.993) (-425.131) -- 0:00:36
398500 -- (-427.980) (-426.750) (-427.213) [-424.847] * (-425.539) (-426.671) (-429.237) [-426.102] -- 0:00:36
399000 -- [-426.901] (-426.899) (-425.168) (-426.684) * (-425.677) [-426.091] (-426.952) (-428.668) -- 0:00:36
399500 -- (-426.077) (-428.366) [-426.620] (-426.982) * (-425.322) (-425.405) [-425.881] (-426.285) -- 0:00:36
400000 -- (-425.512) [-429.253] (-425.984) (-431.543) * (-426.029) (-427.061) (-427.230) [-427.205] -- 0:00:36
Average standard deviation of split frequencies: 0.008997
400500 -- (-426.872) (-428.701) [-425.180] (-430.044) * (-425.988) (-428.164) (-427.806) [-426.050] -- 0:00:35
401000 -- (-425.692) [-425.585] (-426.201) (-429.136) * (-425.962) [-426.755] (-428.218) (-426.730) -- 0:00:35
401500 -- [-425.926] (-425.162) (-424.865) (-427.210) * (-437.964) [-429.557] (-427.318) (-427.663) -- 0:00:37
402000 -- (-427.643) [-425.787] (-427.338) (-425.016) * (-431.765) (-427.318) (-428.302) [-426.090] -- 0:00:37
402500 -- (-428.849) (-431.071) [-425.205] (-426.537) * (-427.765) (-426.118) (-426.660) [-429.136] -- 0:00:37
403000 -- (-425.558) (-426.654) [-425.828] (-427.210) * (-425.297) (-427.983) [-426.875] (-429.315) -- 0:00:37
403500 -- (-429.565) (-427.915) (-426.669) [-426.203] * [-426.506] (-425.628) (-427.567) (-427.223) -- 0:00:36
404000 -- (-425.233) (-426.860) (-426.524) [-431.263] * (-426.004) (-428.274) [-426.531] (-426.978) -- 0:00:36
404500 -- (-424.880) [-426.193] (-427.673) (-426.471) * (-426.268) (-429.698) [-427.034] (-425.534) -- 0:00:36
405000 -- (-429.296) (-428.129) (-424.972) [-425.669] * (-427.332) (-425.269) (-426.187) [-426.174] -- 0:00:36
Average standard deviation of split frequencies: 0.007923
405500 -- (-425.804) (-425.483) [-432.867] (-424.947) * (-431.379) (-426.265) [-425.402] (-428.669) -- 0:00:36
406000 -- (-425.680) [-427.197] (-431.914) (-429.745) * (-425.348) (-427.340) [-428.140] (-427.216) -- 0:00:36
406500 -- (-429.733) (-427.367) [-425.944] (-427.038) * (-426.013) (-426.213) (-431.016) [-433.737] -- 0:00:36
407000 -- (-430.658) (-428.590) (-427.364) [-426.249] * (-427.109) (-427.336) (-426.209) [-424.817] -- 0:00:36
407500 -- [-429.329] (-427.013) (-426.358) (-427.938) * (-427.549) (-425.819) (-428.560) [-426.732] -- 0:00:36
408000 -- (-427.466) [-428.756] (-426.809) (-426.545) * (-427.995) (-429.220) [-424.633] (-426.179) -- 0:00:36
408500 -- (-426.029) (-425.362) (-426.369) [-426.120] * (-428.072) (-425.508) [-426.319] (-430.083) -- 0:00:36
409000 -- (-425.585) (-424.913) (-426.561) [-426.556] * (-428.834) (-426.114) [-428.667] (-432.115) -- 0:00:36
409500 -- [-426.056] (-426.085) (-425.646) (-425.386) * (-425.582) (-425.465) (-429.069) [-429.059] -- 0:00:36
410000 -- (-428.267) [-425.264] (-425.884) (-426.219) * (-427.354) (-425.019) (-427.780) [-425.833] -- 0:00:35
Average standard deviation of split frequencies: 0.007563
410500 -- [-426.744] (-425.553) (-426.909) (-425.175) * [-425.673] (-425.150) (-426.676) (-426.658) -- 0:00:35
411000 -- (-428.474) [-425.999] (-426.112) (-425.108) * (-425.840) (-425.294) (-426.376) [-426.621] -- 0:00:35
411500 -- (-428.153) (-426.467) (-427.827) [-426.054] * (-427.008) [-426.483] (-425.631) (-429.791) -- 0:00:35
412000 -- (-429.782) (-425.850) (-431.043) [-427.411] * (-426.456) (-428.323) (-425.141) [-425.347] -- 0:00:35
412500 -- (-427.941) (-426.060) (-425.456) [-426.841] * [-426.452] (-426.431) (-426.521) (-430.693) -- 0:00:35
413000 -- (-427.721) (-429.052) [-427.129] (-432.099) * (-425.533) (-426.899) [-429.337] (-425.503) -- 0:00:35
413500 -- (-426.631) (-425.119) (-428.720) [-426.563] * (-426.300) (-426.687) (-426.002) [-426.877] -- 0:00:35
414000 -- (-426.621) (-427.032) (-425.641) [-428.364] * (-427.011) [-425.832] (-426.273) (-425.209) -- 0:00:35
414500 -- (-425.149) (-426.801) (-426.484) [-425.710] * (-426.294) (-425.416) [-432.021] (-425.510) -- 0:00:35
415000 -- [-426.613] (-427.931) (-427.372) (-424.914) * (-427.615) (-427.417) [-429.058] (-425.797) -- 0:00:35
Average standard deviation of split frequencies: 0.007932
415500 -- (-427.183) (-429.033) [-428.638] (-425.376) * [-427.458] (-427.527) (-427.492) (-428.424) -- 0:00:35
416000 -- (-428.258) [-425.591] (-429.487) (-425.492) * (-426.893) (-427.939) [-425.103] (-425.122) -- 0:00:35
416500 -- (-431.468) [-425.708] (-426.754) (-425.322) * (-429.213) [-429.407] (-426.784) (-428.871) -- 0:00:35
417000 -- [-428.125] (-426.918) (-425.095) (-425.973) * (-426.639) [-426.680] (-426.604) (-427.782) -- 0:00:34
417500 -- [-426.074] (-427.748) (-425.589) (-425.655) * (-427.617) (-428.319) [-426.296] (-428.089) -- 0:00:34
418000 -- (-426.666) (-427.329) (-426.636) [-426.196] * [-425.776] (-430.675) (-429.165) (-431.066) -- 0:00:34
418500 -- [-429.281] (-428.491) (-425.595) (-426.729) * (-426.540) (-425.116) (-430.528) [-427.251] -- 0:00:36
419000 -- (-429.994) (-427.657) (-425.453) [-425.985] * (-428.158) (-425.715) [-425.436] (-427.310) -- 0:00:36
419500 -- [-426.298] (-426.113) (-428.065) (-427.709) * (-427.389) (-426.685) [-428.608] (-427.093) -- 0:00:35
420000 -- (-426.240) (-425.746) [-426.528] (-429.577) * [-427.702] (-426.238) (-427.129) (-427.148) -- 0:00:35
Average standard deviation of split frequencies: 0.008240
420500 -- (-426.539) (-425.398) (-425.908) [-430.056] * (-426.634) [-425.785] (-429.973) (-426.695) -- 0:00:35
421000 -- (-428.559) [-426.877] (-426.216) (-427.157) * [-425.104] (-425.771) (-425.836) (-426.472) -- 0:00:35
421500 -- (-426.049) (-426.420) [-424.520] (-427.391) * (-424.916) (-424.957) (-426.994) [-426.948] -- 0:00:35
422000 -- [-424.817] (-429.910) (-429.003) (-429.404) * (-425.770) (-426.580) (-427.567) [-425.935] -- 0:00:35
422500 -- (-425.246) [-429.400] (-430.809) (-429.009) * (-431.005) (-430.362) [-427.191] (-426.110) -- 0:00:35
423000 -- (-425.780) (-427.277) [-424.905] (-429.154) * [-426.140] (-428.488) (-428.758) (-426.628) -- 0:00:35
423500 -- (-428.464) [-427.676] (-427.062) (-432.385) * (-425.167) (-426.538) [-428.747] (-428.381) -- 0:00:35
424000 -- (-431.972) [-427.093] (-426.790) (-429.147) * (-424.720) (-426.020) [-425.543] (-426.146) -- 0:00:35
424500 -- (-429.427) [-428.816] (-429.006) (-429.080) * [-424.702] (-426.413) (-425.470) (-429.834) -- 0:00:35
425000 -- [-431.785] (-427.191) (-428.495) (-426.647) * [-425.349] (-428.564) (-428.167) (-427.763) -- 0:00:35
Average standard deviation of split frequencies: 0.008722
425500 -- (-428.119) (-427.569) (-430.160) [-428.173] * [-425.504] (-425.788) (-425.557) (-429.281) -- 0:00:35
426000 -- (-424.849) (-426.231) [-425.792] (-427.218) * [-426.903] (-426.452) (-427.750) (-426.063) -- 0:00:35
426500 -- (-424.922) (-431.181) [-426.574] (-426.755) * [-425.335] (-427.421) (-425.840) (-426.543) -- 0:00:34
427000 -- (-427.845) [-428.803] (-424.851) (-426.717) * (-425.356) [-426.545] (-428.667) (-425.567) -- 0:00:34
427500 -- [-426.421] (-424.889) (-429.335) (-427.809) * (-426.017) (-426.619) (-426.081) [-425.099] -- 0:00:34
428000 -- (-429.968) [-425.090] (-425.942) (-426.471) * (-426.451) [-427.369] (-426.877) (-426.309) -- 0:00:34
428500 -- [-425.911] (-425.380) (-426.899) (-427.675) * (-426.458) (-430.143) (-426.490) [-427.523] -- 0:00:34
429000 -- [-426.338] (-427.715) (-428.349) (-427.012) * (-427.657) (-426.519) [-426.171] (-426.697) -- 0:00:34
429500 -- [-426.981] (-427.035) (-425.731) (-427.810) * (-426.578) (-426.584) [-431.175] (-426.397) -- 0:00:34
430000 -- (-426.212) [-426.831] (-425.058) (-426.443) * [-426.186] (-429.331) (-430.154) (-427.856) -- 0:00:34
Average standard deviation of split frequencies: 0.008435
430500 -- (-427.564) [-425.865] (-426.114) (-427.055) * (-425.804) (-426.371) [-431.001] (-428.654) -- 0:00:34
431000 -- [-424.758] (-427.049) (-424.673) (-426.148) * (-428.735) (-425.071) [-424.911] (-431.473) -- 0:00:34
431500 -- (-428.273) (-425.035) [-424.926] (-426.362) * (-427.592) (-426.708) [-428.591] (-429.008) -- 0:00:34
432000 -- (-427.130) (-432.417) [-425.042] (-425.426) * [-425.271] (-425.775) (-425.453) (-427.146) -- 0:00:34
432500 -- (-431.102) [-425.689] (-425.657) (-425.349) * [-425.292] (-429.770) (-430.635) (-428.658) -- 0:00:34
433000 -- (-427.504) (-432.352) (-426.954) [-426.307] * (-425.101) (-425.985) (-425.231) [-430.857] -- 0:00:34
433500 -- (-425.482) (-428.597) [-427.213] (-425.255) * (-426.108) (-426.875) (-424.951) [-426.072] -- 0:00:33
434000 -- (-425.642) [-425.983] (-428.536) (-428.545) * (-426.605) (-427.188) [-426.051] (-427.606) -- 0:00:33
434500 -- [-425.863] (-428.007) (-427.219) (-426.356) * (-424.865) (-428.903) (-429.335) [-428.392] -- 0:00:33
435000 -- (-426.012) (-425.661) (-426.087) [-425.528] * (-426.647) [-426.175] (-426.432) (-430.696) -- 0:00:33
Average standard deviation of split frequencies: 0.008332
435500 -- (-424.729) [-425.795] (-426.759) (-426.362) * (-425.822) (-428.363) (-434.251) [-427.060] -- 0:00:34
436000 -- (-424.783) (-424.847) [-426.692] (-424.602) * (-425.519) (-426.416) (-425.366) [-425.252] -- 0:00:34
436500 -- [-426.154] (-427.657) (-426.541) (-430.040) * (-425.974) [-426.347] (-426.702) (-426.575) -- 0:00:34
437000 -- (-424.624) (-425.717) [-427.662] (-428.693) * (-424.718) [-426.748] (-425.642) (-426.982) -- 0:00:34
437500 -- (-425.802) (-426.357) [-429.115] (-429.097) * (-426.281) (-427.348) (-425.852) [-425.978] -- 0:00:34
438000 -- (-429.181) (-425.144) (-427.228) [-426.262] * (-427.672) (-427.834) [-427.756] (-426.087) -- 0:00:34
438500 -- (-430.954) [-425.408] (-425.265) (-427.948) * (-426.687) [-427.334] (-430.020) (-426.114) -- 0:00:34
439000 -- (-429.266) (-426.245) (-427.308) [-426.422] * [-427.034] (-428.044) (-427.719) (-426.753) -- 0:00:34
439500 -- (-426.336) (-427.047) (-425.690) [-427.633] * [-425.884] (-426.423) (-425.658) (-427.991) -- 0:00:34
440000 -- (-426.900) (-426.139) (-426.860) [-427.800] * (-426.285) (-428.316) (-426.060) [-426.453] -- 0:00:34
Average standard deviation of split frequencies: 0.008810
440500 -- (-425.211) [-428.741] (-424.577) (-427.891) * (-426.885) (-428.152) [-426.295] (-427.562) -- 0:00:34
441000 -- (-426.506) (-426.485) (-427.131) [-427.001] * [-429.560] (-426.158) (-426.155) (-425.048) -- 0:00:34
441500 -- (-425.407) [-426.140] (-428.224) (-425.735) * (-429.871) (-426.108) (-425.587) [-426.952] -- 0:00:34
442000 -- (-427.039) (-426.072) [-427.505] (-426.246) * (-427.231) (-425.099) [-426.900] (-428.179) -- 0:00:34
442500 -- [-425.636] (-428.469) (-426.680) (-426.312) * (-430.078) [-426.162] (-425.909) (-428.938) -- 0:00:34
443000 -- (-425.098) (-426.006) [-425.586] (-427.180) * (-425.709) [-426.169] (-428.364) (-428.314) -- 0:00:33
443500 -- (-427.735) [-425.936] (-425.561) (-427.923) * (-427.178) (-433.446) [-426.610] (-427.447) -- 0:00:33
444000 -- [-429.423] (-429.570) (-426.141) (-426.834) * (-426.287) (-427.408) [-425.996] (-427.089) -- 0:00:33
444500 -- [-425.102] (-432.010) (-426.058) (-426.729) * (-426.548) (-427.065) (-425.888) [-427.511] -- 0:00:33
445000 -- (-426.185) (-425.763) [-426.221] (-425.711) * (-424.909) (-429.155) [-426.417] (-425.662) -- 0:00:33
Average standard deviation of split frequencies: 0.008020
445500 -- (-432.457) [-425.660] (-426.482) (-428.750) * (-426.807) (-426.842) [-427.511] (-428.335) -- 0:00:33
446000 -- (-431.357) (-425.646) [-428.183] (-427.739) * [-427.533] (-426.315) (-427.181) (-425.164) -- 0:00:33
446500 -- (-434.086) (-425.277) [-425.415] (-427.883) * (-425.723) (-425.190) [-426.749] (-427.437) -- 0:00:33
447000 -- (-426.869) (-428.234) (-425.731) [-426.391] * (-431.732) [-424.737] (-427.378) (-427.532) -- 0:00:33
447500 -- (-425.203) [-425.672] (-426.055) (-427.908) * (-428.026) (-425.673) [-425.834] (-428.036) -- 0:00:33
448000 -- (-428.815) (-426.788) [-425.347] (-426.676) * [-426.783] (-425.222) (-426.229) (-428.013) -- 0:00:33
448500 -- (-430.538) (-429.818) (-425.866) [-425.740] * [-426.215] (-426.608) (-426.740) (-425.779) -- 0:00:33
449000 -- (-426.959) (-431.807) (-427.503) [-425.240] * (-426.832) (-427.838) [-426.059] (-425.977) -- 0:00:33
449500 -- (-426.452) (-426.519) [-425.655] (-427.244) * (-426.154) [-424.995] (-425.014) (-424.992) -- 0:00:33
450000 -- [-425.034] (-426.378) (-425.266) (-427.512) * (-426.689) (-425.216) [-427.152] (-431.363) -- 0:00:33
Average standard deviation of split frequencies: 0.007507
450500 -- (-427.935) [-430.027] (-427.142) (-428.052) * (-425.638) [-427.783] (-428.338) (-427.784) -- 0:00:32
451000 -- [-427.871] (-428.987) (-427.833) (-426.085) * (-429.822) (-426.248) (-426.254) [-426.654] -- 0:00:32
451500 -- (-426.092) (-427.687) [-425.031] (-426.966) * (-425.381) (-431.840) [-425.836] (-425.934) -- 0:00:32
452000 -- [-426.814] (-426.125) (-425.911) (-430.419) * [-425.629] (-430.946) (-428.493) (-426.728) -- 0:00:32
452500 -- (-426.861) [-425.862] (-426.598) (-430.821) * [-424.766] (-427.860) (-426.641) (-426.051) -- 0:00:33
453000 -- (-434.593) [-426.326] (-428.810) (-427.755) * (-427.667) [-425.429] (-425.769) (-426.162) -- 0:00:33
453500 -- (-428.110) (-425.359) (-427.539) [-430.571] * (-428.702) (-426.682) [-424.949] (-432.289) -- 0:00:33
454000 -- [-426.170] (-426.527) (-425.358) (-426.742) * (-427.283) (-426.588) [-426.074] (-426.676) -- 0:00:33
454500 -- (-427.848) [-428.202] (-425.792) (-425.119) * (-425.682) (-428.153) (-428.948) [-425.713] -- 0:00:33
455000 -- (-425.589) [-426.374] (-427.026) (-430.446) * (-426.965) [-426.557] (-426.587) (-427.245) -- 0:00:33
Average standard deviation of split frequencies: 0.007480
455500 -- (-426.594) (-425.736) (-425.558) [-425.204] * [-425.333] (-429.233) (-425.790) (-426.697) -- 0:00:33
456000 -- (-425.342) (-427.239) (-427.562) [-425.051] * (-425.489) (-428.206) (-427.143) [-425.439] -- 0:00:33
456500 -- (-432.961) (-425.239) [-425.244] (-427.547) * (-427.015) [-427.037] (-426.494) (-426.380) -- 0:00:33
457000 -- (-426.376) (-427.074) (-426.014) [-426.911] * (-426.091) [-426.492] (-428.539) (-425.429) -- 0:00:33
457500 -- (-427.977) [-425.474] (-427.085) (-430.479) * (-428.192) (-427.085) [-429.234] (-426.553) -- 0:00:33
458000 -- (-428.892) (-425.087) (-426.617) [-428.915] * (-428.205) (-427.795) (-431.419) [-426.405] -- 0:00:33
458500 -- [-427.612] (-425.224) (-426.061) (-429.877) * (-428.157) (-430.891) [-428.595] (-427.302) -- 0:00:33
459000 -- (-428.723) (-428.844) [-424.735] (-425.911) * (-428.954) (-426.465) [-426.222] (-426.160) -- 0:00:33
459500 -- [-426.224] (-429.429) (-425.710) (-427.137) * [-428.273] (-426.052) (-426.252) (-432.978) -- 0:00:32
460000 -- [-427.086] (-430.145) (-425.801) (-425.777) * (-428.319) (-425.848) [-428.451] (-427.175) -- 0:00:32
Average standard deviation of split frequencies: 0.008006
460500 -- (-428.658) (-426.882) [-428.457] (-428.445) * (-427.355) (-431.125) [-425.652] (-426.197) -- 0:00:32
461000 -- [-429.078] (-427.625) (-427.496) (-428.283) * (-425.939) (-432.185) (-425.766) [-427.671] -- 0:00:32
461500 -- [-427.397] (-426.734) (-424.868) (-425.279) * (-426.655) (-427.587) (-429.323) [-426.277] -- 0:00:32
462000 -- (-426.682) [-426.306] (-426.540) (-427.124) * (-426.355) [-426.424] (-425.919) (-426.379) -- 0:00:32
462500 -- (-428.287) [-426.609] (-426.282) (-428.475) * (-427.971) (-429.947) [-425.607] (-426.977) -- 0:00:32
463000 -- (-425.505) (-431.553) (-428.166) [-427.427] * (-425.769) [-424.697] (-425.171) (-427.050) -- 0:00:32
463500 -- (-427.797) (-430.706) (-429.927) [-425.360] * (-426.039) (-428.010) [-436.011] (-426.469) -- 0:00:32
464000 -- [-426.222] (-431.280) (-430.468) (-425.093) * [-427.617] (-425.661) (-426.347) (-424.773) -- 0:00:32
464500 -- (-428.577) [-426.295] (-426.279) (-426.791) * (-430.805) (-428.822) [-428.282] (-425.315) -- 0:00:32
465000 -- (-426.901) [-425.849] (-426.269) (-428.114) * (-426.954) [-427.497] (-426.902) (-425.481) -- 0:00:32
Average standard deviation of split frequencies: 0.007438
465500 -- (-426.189) (-426.759) [-427.853] (-425.869) * (-429.714) (-430.341) [-428.990] (-425.830) -- 0:00:32
466000 -- (-425.200) [-427.660] (-429.190) (-425.999) * [-427.580] (-429.279) (-424.774) (-427.675) -- 0:00:32
466500 -- (-428.246) (-425.632) [-427.150] (-425.608) * (-426.202) [-425.467] (-429.501) (-428.035) -- 0:00:32
467000 -- (-427.154) (-426.300) (-425.533) [-426.430] * (-427.566) (-429.199) [-425.288] (-431.843) -- 0:00:31
467500 -- (-426.445) (-426.085) [-425.927] (-426.868) * (-430.236) [-427.819] (-424.638) (-425.919) -- 0:00:31
468000 -- (-425.943) (-428.049) (-425.675) [-426.878] * (-426.663) [-428.349] (-427.247) (-426.456) -- 0:00:31
468500 -- (-426.350) [-426.758] (-425.997) (-428.577) * (-426.683) [-426.415] (-426.647) (-425.281) -- 0:00:31
469000 -- (-426.042) (-431.096) (-426.680) [-429.946] * (-426.068) [-427.523] (-427.390) (-428.358) -- 0:00:31
469500 -- (-425.011) (-427.981) (-427.376) [-426.483] * (-429.468) [-424.961] (-425.272) (-425.440) -- 0:00:32
470000 -- [-426.092] (-426.175) (-427.958) (-426.822) * (-427.429) (-425.900) [-426.322] (-431.568) -- 0:00:32
Average standard deviation of split frequencies: 0.006834
470500 -- (-425.677) (-427.147) [-428.385] (-429.356) * [-427.038] (-430.555) (-425.787) (-427.270) -- 0:00:32
471000 -- [-429.926] (-428.586) (-428.448) (-425.899) * [-426.130] (-427.731) (-428.161) (-425.911) -- 0:00:32
471500 -- (-428.382) (-429.491) [-425.085] (-429.046) * (-425.420) [-426.182] (-425.931) (-427.448) -- 0:00:32
472000 -- (-428.004) [-428.542] (-425.173) (-432.626) * [-425.097] (-427.691) (-428.159) (-425.963) -- 0:00:32
472500 -- (-427.933) [-428.656] (-428.522) (-425.262) * [-426.098] (-425.569) (-427.589) (-427.392) -- 0:00:32
473000 -- (-427.949) (-425.226) [-426.025] (-425.057) * (-425.956) [-428.693] (-425.671) (-427.455) -- 0:00:32
473500 -- (-427.388) (-425.585) (-425.320) [-426.697] * (-424.759) (-430.035) [-425.318] (-427.090) -- 0:00:32
474000 -- (-425.524) [-425.184] (-424.674) (-425.657) * [-425.544] (-428.700) (-426.005) (-426.942) -- 0:00:32
474500 -- (-424.579) (-431.333) (-424.654) [-426.038] * (-424.842) (-424.745) (-426.112) [-427.321] -- 0:00:32
475000 -- (-425.313) (-430.524) [-426.683] (-427.824) * (-430.080) [-430.161] (-426.583) (-427.248) -- 0:00:32
Average standard deviation of split frequencies: 0.006292
475500 -- (-424.853) (-425.894) (-425.383) [-428.016] * (-430.091) [-428.213] (-425.818) (-428.963) -- 0:00:31
476000 -- [-425.501] (-428.836) (-425.013) (-427.536) * (-425.999) [-425.916] (-429.651) (-426.137) -- 0:00:31
476500 -- [-426.947] (-425.457) (-428.280) (-428.699) * (-431.407) (-426.056) [-425.888] (-426.577) -- 0:00:31
477000 -- [-426.090] (-425.164) (-432.891) (-425.442) * (-427.272) (-425.556) (-427.865) [-425.599] -- 0:00:31
477500 -- [-429.336] (-425.226) (-425.553) (-425.533) * [-427.488] (-425.077) (-425.853) (-424.744) -- 0:00:31
478000 -- [-426.536] (-428.200) (-424.916) (-425.545) * [-425.489] (-427.303) (-427.406) (-427.379) -- 0:00:31
478500 -- [-427.766] (-425.079) (-425.710) (-425.267) * (-425.748) [-431.580] (-426.116) (-426.099) -- 0:00:31
479000 -- (-425.864) (-425.567) [-425.028] (-426.680) * [-430.110] (-426.000) (-429.301) (-426.064) -- 0:00:31
479500 -- (-426.611) (-426.904) [-426.641] (-426.346) * (-426.113) (-426.616) [-425.894] (-426.057) -- 0:00:31
480000 -- (-427.295) (-425.720) (-425.534) [-425.887] * (-425.814) (-428.226) (-425.029) [-425.885] -- 0:00:31
Average standard deviation of split frequencies: 0.005827
480500 -- (-426.701) [-426.050] (-425.311) (-425.231) * (-425.757) [-428.113] (-425.599) (-425.618) -- 0:00:31
481000 -- (-426.853) (-426.289) [-425.261] (-427.541) * (-428.055) (-426.883) [-425.964] (-425.935) -- 0:00:31
481500 -- (-428.365) (-425.400) (-425.801) [-428.753] * (-426.622) [-428.111] (-424.970) (-426.693) -- 0:00:31
482000 -- (-427.176) (-426.761) (-424.506) [-430.236] * (-428.270) (-426.074) [-425.503] (-426.811) -- 0:00:31
482500 -- (-426.394) (-426.405) [-425.267] (-428.407) * (-428.461) [-428.915] (-425.905) (-424.404) -- 0:00:31
483000 -- (-425.647) (-429.115) (-429.638) [-426.997] * [-425.983] (-426.060) (-427.148) (-430.955) -- 0:00:31
483500 -- (-426.757) (-425.237) [-427.428] (-431.438) * (-425.778) [-425.876] (-429.351) (-426.310) -- 0:00:30
484000 -- (-424.781) [-424.564] (-425.106) (-426.184) * (-429.625) (-428.509) [-429.471] (-425.493) -- 0:00:30
484500 -- (-426.799) [-425.889] (-427.742) (-426.414) * (-426.477) (-425.339) (-426.811) [-425.677] -- 0:00:30
485000 -- (-426.331) (-428.600) [-430.532] (-429.462) * [-430.674] (-425.581) (-426.836) (-426.243) -- 0:00:30
Average standard deviation of split frequencies: 0.005420
485500 -- (-425.649) (-425.196) (-424.817) [-427.530] * (-429.551) [-425.173] (-426.327) (-426.116) -- 0:00:30
486000 -- (-428.830) (-425.923) [-427.543] (-428.277) * (-432.830) (-426.648) [-426.351] (-427.476) -- 0:00:30
486500 -- (-427.486) (-425.900) [-431.097] (-429.002) * [-426.087] (-426.751) (-425.712) (-427.711) -- 0:00:31
487000 -- [-426.405] (-428.439) (-425.426) (-427.343) * (-426.985) (-427.584) [-425.685] (-426.012) -- 0:00:31
487500 -- (-427.434) (-426.879) (-426.384) [-425.515] * (-425.534) (-430.119) [-426.160] (-426.467) -- 0:00:31
488000 -- [-427.150] (-428.048) (-425.864) (-427.403) * [-426.832] (-426.320) (-428.093) (-430.330) -- 0:00:31
488500 -- (-428.928) [-427.211] (-427.939) (-425.215) * (-427.052) (-425.349) [-426.251] (-426.833) -- 0:00:31
489000 -- (-426.235) [-429.283] (-427.154) (-426.540) * [-428.334] (-432.577) (-425.618) (-429.048) -- 0:00:31
489500 -- (-427.260) (-429.308) [-427.778] (-429.224) * (-428.889) (-428.309) (-426.751) [-427.786] -- 0:00:31
490000 -- [-425.994] (-427.187) (-425.531) (-427.521) * [-427.283] (-428.244) (-426.875) (-427.706) -- 0:00:31
Average standard deviation of split frequencies: 0.005595
490500 -- (-427.145) (-429.188) [-427.271] (-426.187) * (-429.684) (-425.037) [-427.204] (-428.004) -- 0:00:31
491000 -- (-427.173) [-428.058] (-426.193) (-425.740) * (-427.766) (-426.893) (-429.319) [-425.560] -- 0:00:31
491500 -- (-426.303) [-427.087] (-429.095) (-425.701) * (-428.257) (-426.941) (-425.144) [-425.165] -- 0:00:31
492000 -- [-426.780] (-425.758) (-426.595) (-425.252) * (-431.494) (-426.229) [-427.784] (-428.696) -- 0:00:30
492500 -- (-427.829) (-426.778) (-427.617) [-427.428] * (-428.269) (-427.241) (-428.486) [-427.037] -- 0:00:30
493000 -- (-427.034) [-428.332] (-427.256) (-431.088) * (-424.997) [-426.174] (-428.489) (-425.867) -- 0:00:30
493500 -- [-425.177] (-427.182) (-427.966) (-428.913) * [-426.172] (-426.643) (-429.205) (-428.659) -- 0:00:30
494000 -- (-425.458) (-426.262) (-425.825) [-425.963] * (-425.424) (-427.609) (-426.187) [-428.029] -- 0:00:30
494500 -- (-429.085) (-425.343) [-425.058] (-425.862) * (-428.448) (-426.495) (-426.769) [-426.551] -- 0:00:30
495000 -- (-426.650) [-425.008] (-426.237) (-427.689) * (-428.634) [-429.445] (-428.197) (-427.979) -- 0:00:30
Average standard deviation of split frequencies: 0.006038
495500 -- (-425.776) (-426.122) [-429.045] (-427.032) * [-425.282] (-430.534) (-429.092) (-425.388) -- 0:00:30
496000 -- (-427.529) (-428.533) [-425.964] (-426.540) * (-427.341) [-426.017] (-424.874) (-425.901) -- 0:00:30
496500 -- (-428.002) (-428.275) [-425.678] (-428.768) * (-429.294) (-425.940) [-430.266] (-425.628) -- 0:00:30
497000 -- (-424.723) (-426.278) [-426.898] (-425.178) * [-429.075] (-425.247) (-429.739) (-425.037) -- 0:00:30
497500 -- (-426.481) (-426.754) [-425.318] (-425.794) * (-427.294) (-426.503) (-427.205) [-425.106] -- 0:00:30
498000 -- (-426.256) [-425.990] (-428.649) (-427.223) * (-430.640) (-426.568) (-425.495) [-429.424] -- 0:00:30
498500 -- (-430.144) [-425.795] (-428.408) (-427.895) * [-426.843] (-425.834) (-426.397) (-428.058) -- 0:00:30
499000 -- (-428.118) [-425.187] (-426.133) (-425.004) * (-425.097) (-427.162) (-426.609) [-426.155] -- 0:00:30
499500 -- (-428.151) [-428.616] (-427.679) (-425.640) * (-425.814) [-429.114] (-427.195) (-426.848) -- 0:00:30
500000 -- [-432.490] (-429.209) (-425.167) (-425.041) * [-425.667] (-428.161) (-429.723) (-430.071) -- 0:00:30
Average standard deviation of split frequencies: 0.005296
500500 -- (-424.927) (-428.211) [-424.910] (-430.148) * (-427.558) (-427.776) [-425.010] (-431.295) -- 0:00:29
501000 -- (-425.649) [-426.242] (-427.743) (-425.654) * (-427.753) (-427.446) (-427.327) [-426.791] -- 0:00:29
501500 -- (-425.416) [-428.098] (-427.573) (-428.582) * [-424.742] (-428.246) (-425.708) (-425.302) -- 0:00:29
502000 -- [-430.034] (-429.485) (-427.925) (-428.210) * (-425.219) (-426.113) [-425.918] (-425.964) -- 0:00:29
502500 -- (-427.658) (-425.162) [-427.126] (-429.262) * (-427.245) (-425.146) [-425.125] (-425.744) -- 0:00:29
503000 -- [-430.530] (-425.490) (-425.460) (-426.025) * (-425.552) [-425.279] (-427.270) (-426.070) -- 0:00:30
503500 -- (-427.766) [-426.267] (-424.904) (-426.342) * [-424.869] (-425.982) (-426.036) (-427.830) -- 0:00:30
504000 -- (-427.256) [-425.346] (-428.802) (-426.471) * (-426.815) (-426.461) (-426.373) [-425.672] -- 0:00:30
504500 -- (-429.984) [-427.251] (-430.373) (-426.500) * (-427.231) (-424.717) [-426.025] (-425.701) -- 0:00:30
505000 -- (-428.680) (-426.402) (-427.055) [-427.392] * [-429.334] (-428.330) (-429.246) (-425.240) -- 0:00:30
Average standard deviation of split frequencies: 0.005357
505500 -- (-432.972) [-425.844] (-429.606) (-425.688) * (-429.105) (-428.548) (-429.588) [-426.204] -- 0:00:30
506000 -- (-425.156) (-429.138) [-428.306] (-425.416) * (-425.307) [-426.751] (-426.166) (-425.424) -- 0:00:30
506500 -- [-426.714] (-427.790) (-428.648) (-426.999) * (-427.106) (-429.300) (-424.927) [-424.978] -- 0:00:30
507000 -- (-426.428) (-427.411) (-428.027) [-428.173] * (-425.954) (-427.099) (-427.007) [-427.328] -- 0:00:30
507500 -- (-425.646) [-425.362] (-426.090) (-428.591) * [-428.404] (-428.407) (-428.081) (-427.222) -- 0:00:30
508000 -- (-425.276) (-425.281) [-431.545] (-427.071) * [-424.854] (-431.791) (-426.778) (-430.517) -- 0:00:30
508500 -- (-426.711) [-425.573] (-427.521) (-424.876) * (-425.226) [-428.464] (-428.936) (-434.185) -- 0:00:29
509000 -- (-426.449) (-431.382) [-426.782] (-426.459) * (-426.104) (-427.076) (-430.819) [-429.669] -- 0:00:29
509500 -- [-427.441] (-428.109) (-424.822) (-427.447) * (-426.171) [-426.140] (-429.126) (-426.907) -- 0:00:29
510000 -- (-430.804) (-429.954) [-425.279] (-431.324) * [-427.651] (-425.645) (-428.812) (-428.095) -- 0:00:29
Average standard deviation of split frequencies: 0.005654
510500 -- (-425.699) (-427.642) (-425.812) [-427.012] * [-426.856] (-427.006) (-424.656) (-425.584) -- 0:00:29
511000 -- (-425.917) (-427.873) [-425.817] (-425.735) * (-430.832) [-426.259] (-425.133) (-431.524) -- 0:00:29
511500 -- (-424.791) (-427.793) (-426.568) [-426.749] * (-429.921) [-425.102] (-425.334) (-432.080) -- 0:00:29
512000 -- [-426.989] (-431.415) (-426.843) (-426.951) * (-431.454) [-427.370] (-425.533) (-428.739) -- 0:00:29
512500 -- [-425.754] (-425.773) (-426.724) (-428.973) * (-425.721) (-425.322) [-427.080] (-428.072) -- 0:00:29
513000 -- (-426.900) (-425.999) [-425.219] (-425.636) * [-425.395] (-427.112) (-425.394) (-426.738) -- 0:00:29
513500 -- [-425.275] (-425.255) (-425.480) (-431.797) * (-426.076) [-428.667] (-426.606) (-425.865) -- 0:00:29
514000 -- [-425.875] (-427.184) (-428.438) (-430.177) * (-425.432) [-429.891] (-426.231) (-428.910) -- 0:00:29
514500 -- (-427.448) [-424.799] (-430.314) (-428.578) * [-425.601] (-430.350) (-424.916) (-426.500) -- 0:00:29
515000 -- (-426.089) [-425.625] (-428.697) (-426.701) * [-429.143] (-427.716) (-426.388) (-426.974) -- 0:00:29
Average standard deviation of split frequencies: 0.006224
515500 -- [-425.217] (-426.043) (-425.255) (-427.965) * (-427.495) [-425.564] (-426.569) (-427.749) -- 0:00:29
516000 -- [-425.304] (-425.437) (-430.596) (-427.743) * (-426.982) (-426.592) (-427.686) [-427.591] -- 0:00:29
516500 -- (-428.367) [-428.718] (-425.590) (-428.958) * (-425.597) [-425.769] (-427.901) (-427.998) -- 0:00:29
517000 -- [-425.225] (-425.923) (-429.848) (-429.121) * [-427.165] (-426.368) (-426.364) (-426.289) -- 0:00:28
517500 -- [-428.040] (-427.093) (-432.041) (-429.320) * [-427.521] (-427.474) (-431.304) (-426.178) -- 0:00:28
518000 -- (-426.672) (-426.923) [-425.284] (-426.619) * (-427.952) [-431.101] (-431.518) (-426.693) -- 0:00:28
518500 -- (-426.249) (-430.259) (-425.578) [-426.059] * (-424.866) [-425.296] (-428.984) (-427.106) -- 0:00:28
519000 -- (-425.043) [-427.432] (-426.795) (-427.401) * (-426.166) [-425.512] (-425.863) (-426.958) -- 0:00:28
519500 -- [-428.308] (-429.548) (-425.137) (-427.869) * [-427.234] (-430.257) (-428.189) (-424.633) -- 0:00:29
520000 -- [-425.893] (-424.813) (-427.035) (-429.203) * (-426.284) (-425.107) (-425.760) [-425.102] -- 0:00:29
Average standard deviation of split frequencies: 0.006338
520500 -- [-425.753] (-428.473) (-426.952) (-426.204) * (-426.618) (-424.764) (-427.084) [-425.428] -- 0:00:29
521000 -- [-426.581] (-429.299) (-430.719) (-425.104) * (-426.077) (-425.277) [-426.390] (-426.385) -- 0:00:29
521500 -- [-426.537] (-424.959) (-428.854) (-425.415) * (-432.766) (-428.557) (-430.012) [-428.467] -- 0:00:29
522000 -- (-427.099) [-425.822] (-426.713) (-427.135) * [-425.908] (-424.811) (-429.481) (-426.406) -- 0:00:29
522500 -- [-425.916] (-426.541) (-425.303) (-428.448) * (-424.881) [-427.571] (-426.670) (-427.656) -- 0:00:29
523000 -- [-426.712] (-426.748) (-426.425) (-425.443) * (-428.364) (-429.380) [-428.549] (-425.001) -- 0:00:29
523500 -- (-428.273) [-424.980] (-428.119) (-430.274) * (-427.895) (-425.016) (-429.106) [-427.279] -- 0:00:29
524000 -- (-426.937) (-426.700) (-427.114) [-426.571] * (-424.649) (-431.078) (-427.811) [-425.717] -- 0:00:29
524500 -- (-430.490) (-427.194) (-428.308) [-425.458] * (-425.560) (-431.651) (-427.464) [-424.380] -- 0:00:29
525000 -- [-427.420] (-427.104) (-427.922) (-425.576) * [-425.573] (-431.432) (-426.182) (-427.763) -- 0:00:28
Average standard deviation of split frequencies: 0.006610
525500 -- [-431.269] (-429.663) (-428.308) (-426.203) * (-425.988) [-429.144] (-427.762) (-426.809) -- 0:00:28
526000 -- (-425.680) (-424.854) [-429.562] (-428.476) * (-428.183) (-431.268) [-424.624] (-426.703) -- 0:00:28
526500 -- (-429.463) [-426.304] (-427.476) (-429.971) * (-426.608) [-428.917] (-425.024) (-426.181) -- 0:00:28
527000 -- [-427.367] (-427.399) (-427.017) (-430.290) * (-427.442) [-426.953] (-424.911) (-425.642) -- 0:00:28
527500 -- (-426.351) (-428.979) [-426.040] (-428.000) * (-428.391) [-425.793] (-424.484) (-425.963) -- 0:00:28
528000 -- (-429.258) (-428.514) (-426.624) [-425.585] * (-430.681) [-425.411] (-424.945) (-425.947) -- 0:00:28
528500 -- (-430.506) (-428.705) (-427.942) [-426.515] * (-430.588) (-426.530) [-428.893] (-424.981) -- 0:00:28
529000 -- (-429.281) (-431.360) (-425.727) [-425.837] * (-428.734) (-427.063) [-425.358] (-424.889) -- 0:00:28
529500 -- [-426.303] (-426.809) (-426.633) (-430.052) * (-425.799) (-427.046) [-427.124] (-425.564) -- 0:00:28
530000 -- [-425.166] (-425.935) (-429.319) (-425.234) * (-425.391) [-426.484] (-424.443) (-425.898) -- 0:00:28
Average standard deviation of split frequencies: 0.006551
530500 -- (-428.781) [-424.726] (-425.558) (-426.757) * [-426.136] (-427.026) (-426.192) (-427.769) -- 0:00:28
531000 -- (-429.432) [-425.620] (-426.225) (-427.041) * (-428.522) (-427.144) (-426.278) [-425.726] -- 0:00:28
531500 -- (-424.910) (-429.871) [-425.213] (-425.935) * (-429.728) (-427.043) (-426.264) [-425.887] -- 0:00:28
532000 -- [-425.469] (-426.781) (-428.238) (-425.857) * [-426.043] (-425.035) (-428.843) (-428.329) -- 0:00:28
532500 -- (-425.197) (-424.651) [-425.957] (-426.751) * (-425.139) (-428.274) [-426.364] (-427.178) -- 0:00:28
533000 -- (-426.442) (-428.088) (-426.753) [-426.228] * (-429.144) [-427.116] (-426.917) (-431.097) -- 0:00:28
533500 -- (-425.158) (-426.151) [-428.506] (-427.053) * (-429.723) (-427.569) (-424.818) [-425.383] -- 0:00:27
534000 -- [-425.751] (-425.196) (-434.348) (-425.820) * [-427.257] (-428.240) (-426.944) (-426.125) -- 0:00:27
534500 -- [-428.212] (-429.093) (-429.418) (-425.415) * (-425.524) (-426.358) [-426.025] (-426.205) -- 0:00:27
535000 -- (-428.066) [-428.349] (-428.716) (-426.260) * (-427.240) (-426.369) [-427.608] (-427.744) -- 0:00:27
Average standard deviation of split frequencies: 0.006541
535500 -- (-425.024) [-427.465] (-426.341) (-425.841) * [-426.949] (-426.010) (-426.957) (-425.318) -- 0:00:27
536000 -- (-426.119) (-424.770) [-427.240] (-426.235) * (-425.015) (-433.320) (-425.623) [-425.831] -- 0:00:27
536500 -- (-427.835) (-428.183) (-427.692) [-429.233] * (-427.456) [-430.389] (-427.257) (-427.864) -- 0:00:28
537000 -- (-427.131) (-426.086) [-425.385] (-426.637) * (-424.839) (-433.243) [-428.563] (-427.830) -- 0:00:28
537500 -- (-428.670) (-426.244) [-427.708] (-427.530) * [-427.382] (-425.030) (-430.451) (-426.069) -- 0:00:28
538000 -- (-427.150) (-425.161) (-425.519) [-427.212] * (-426.750) [-424.610] (-426.746) (-428.463) -- 0:00:28
538500 -- (-428.013) (-427.347) (-425.597) [-425.703] * (-426.300) (-428.083) (-428.757) [-425.014] -- 0:00:28
539000 -- (-426.420) (-425.383) (-431.148) [-426.736] * (-428.316) [-425.553] (-427.225) (-430.904) -- 0:00:28
539500 -- (-425.326) (-427.393) [-427.188] (-426.268) * (-427.774) [-426.018] (-425.880) (-425.632) -- 0:00:28
540000 -- [-425.363] (-428.119) (-430.493) (-429.356) * (-425.706) (-427.071) [-426.847] (-429.932) -- 0:00:28
Average standard deviation of split frequencies: 0.006103
540500 -- (-430.245) (-428.440) (-425.591) [-426.199] * (-426.290) (-425.486) [-427.913] (-425.368) -- 0:00:28
541000 -- (-428.890) (-425.150) [-425.728] (-425.666) * (-426.417) (-426.661) [-431.723] (-425.843) -- 0:00:27
541500 -- (-429.282) (-429.976) [-428.318] (-425.423) * (-427.774) (-427.199) [-427.175] (-427.025) -- 0:00:27
542000 -- (-426.708) (-427.276) (-427.995) [-425.692] * (-428.373) [-426.395] (-426.506) (-425.824) -- 0:00:27
542500 -- [-425.520] (-434.049) (-425.956) (-430.677) * (-431.425) (-428.910) [-425.872] (-424.907) -- 0:00:27
543000 -- (-426.449) (-432.252) [-426.757] (-427.149) * [-424.815] (-428.070) (-427.125) (-434.064) -- 0:00:27
543500 -- (-425.945) [-426.828] (-427.580) (-427.129) * (-426.692) [-428.997] (-426.245) (-429.039) -- 0:00:27
544000 -- [-425.388] (-428.642) (-425.292) (-425.988) * (-427.129) (-426.411) (-426.595) [-430.663] -- 0:00:27
544500 -- (-429.278) (-428.263) [-425.109] (-426.380) * (-426.313) (-428.561) (-426.750) [-426.237] -- 0:00:27
545000 -- (-427.065) (-427.749) (-427.697) [-425.316] * [-429.536] (-428.313) (-430.811) (-425.742) -- 0:00:27
Average standard deviation of split frequencies: 0.006529
545500 -- [-424.977] (-425.001) (-427.600) (-427.544) * (-427.899) (-429.759) (-431.673) [-425.271] -- 0:00:27
546000 -- [-426.284] (-428.647) (-428.632) (-427.344) * (-426.637) (-428.505) (-430.020) [-426.438] -- 0:00:27
546500 -- (-427.853) [-425.772] (-428.468) (-424.777) * (-425.958) (-425.749) (-426.815) [-426.857] -- 0:00:27
547000 -- (-428.284) (-425.850) [-425.126] (-425.361) * (-428.263) (-426.985) [-425.324] (-427.490) -- 0:00:27
547500 -- [-428.646] (-426.242) (-426.765) (-428.352) * (-427.304) (-428.437) [-427.321] (-429.745) -- 0:00:27
548000 -- (-425.397) (-429.285) (-427.133) [-430.151] * (-428.069) (-429.590) [-426.194] (-424.919) -- 0:00:27
548500 -- (-426.895) (-425.410) [-425.001] (-426.634) * (-429.165) (-429.369) [-432.831] (-427.193) -- 0:00:27
549000 -- (-425.882) (-426.718) (-431.325) [-425.503] * (-428.481) (-427.089) (-430.646) [-425.708] -- 0:00:27
549500 -- [-425.726] (-426.465) (-428.191) (-425.235) * [-426.321] (-425.952) (-429.273) (-424.879) -- 0:00:27
550000 -- (-426.816) (-425.747) (-428.772) [-425.145] * [-427.069] (-427.172) (-430.924) (-426.779) -- 0:00:27
Average standard deviation of split frequencies: 0.006902
550500 -- (-427.645) (-427.111) (-429.122) [-424.998] * (-425.336) (-426.511) (-427.407) [-429.857] -- 0:00:26
551000 -- (-427.796) (-427.606) (-428.879) [-425.662] * (-426.511) (-429.022) [-425.062] (-425.515) -- 0:00:26
551500 -- (-429.545) (-429.625) (-425.715) [-425.519] * [-426.891] (-425.803) (-424.975) (-424.879) -- 0:00:26
552000 -- (-428.062) (-428.044) (-428.121) [-425.559] * [-426.341] (-425.804) (-429.113) (-430.115) -- 0:00:26
552500 -- (-426.155) (-427.190) (-428.737) [-427.838] * (-434.196) (-426.945) [-427.837] (-426.676) -- 0:00:26
553000 -- (-425.255) [-425.552] (-429.252) (-428.668) * (-434.521) (-427.465) (-428.012) [-427.364] -- 0:00:27
553500 -- (-429.021) [-426.081] (-427.092) (-427.117) * [-425.995] (-431.652) (-427.702) (-425.423) -- 0:00:27
554000 -- (-426.778) (-426.239) [-425.282] (-427.487) * (-425.881) (-435.414) [-425.838] (-426.448) -- 0:00:27
554500 -- (-426.252) [-426.800] (-427.000) (-426.074) * [-427.141] (-428.871) (-427.101) (-426.985) -- 0:00:27
555000 -- (-427.868) (-427.140) (-424.908) [-426.149] * (-426.742) (-427.401) (-425.268) [-427.187] -- 0:00:27
Average standard deviation of split frequencies: 0.008030
555500 -- (-425.503) (-428.631) [-425.159] (-426.442) * (-424.878) (-427.264) [-427.038] (-426.669) -- 0:00:27
556000 -- (-425.847) [-425.466] (-430.490) (-426.395) * [-424.748] (-429.929) (-427.350) (-425.403) -- 0:00:27
556500 -- [-426.806] (-425.669) (-427.264) (-425.964) * (-427.272) (-426.911) (-428.479) [-426.272] -- 0:00:27
557000 -- [-425.124] (-426.007) (-427.697) (-430.671) * (-424.628) [-428.030] (-429.868) (-427.194) -- 0:00:27
557500 -- [-424.564] (-428.644) (-430.826) (-426.719) * (-424.680) (-425.958) (-426.821) [-425.759] -- 0:00:26
558000 -- (-429.026) (-426.587) (-429.103) [-425.756] * (-430.965) (-428.587) (-426.170) [-426.608] -- 0:00:26
558500 -- [-426.821] (-426.272) (-428.499) (-425.253) * (-427.382) [-426.029] (-425.361) (-426.532) -- 0:00:26
559000 -- (-426.760) (-427.437) (-426.488) [-427.553] * (-427.760) (-428.968) (-427.233) [-425.336] -- 0:00:26
559500 -- (-429.805) (-431.465) (-427.905) [-428.849] * [-425.595] (-428.752) (-430.326) (-427.879) -- 0:00:26
560000 -- [-425.981] (-426.660) (-429.154) (-428.566) * [-426.531] (-426.759) (-427.049) (-426.433) -- 0:00:26
Average standard deviation of split frequencies: 0.008062
560500 -- (-427.157) (-428.259) [-427.548] (-425.283) * (-431.856) (-427.624) [-425.436] (-426.553) -- 0:00:26
561000 -- (-426.671) (-426.182) [-426.872] (-426.644) * (-428.027) [-427.192] (-431.565) (-426.892) -- 0:00:26
561500 -- (-430.229) (-425.400) (-425.438) [-426.654] * (-427.638) (-425.628) [-427.830] (-427.903) -- 0:00:26
562000 -- (-425.415) (-425.244) [-426.456] (-425.443) * (-425.349) [-425.127] (-428.125) (-427.663) -- 0:00:26
562500 -- [-427.540] (-431.543) (-426.500) (-426.537) * (-424.833) [-425.594] (-426.295) (-426.000) -- 0:00:26
563000 -- (-425.606) (-433.892) [-424.933] (-427.598) * [-430.187] (-425.286) (-425.230) (-425.668) -- 0:00:26
563500 -- (-425.890) (-428.700) [-426.439] (-425.576) * (-427.138) (-425.217) (-425.744) [-425.127] -- 0:00:26
564000 -- (-424.673) (-426.938) [-426.983] (-429.719) * (-424.882) [-425.071] (-424.878) (-425.083) -- 0:00:26
564500 -- (-426.578) [-427.444] (-429.596) (-431.556) * (-425.840) [-425.749] (-428.139) (-431.716) -- 0:00:26
565000 -- (-427.071) (-425.378) [-425.654] (-426.678) * (-426.264) [-425.145] (-426.067) (-432.637) -- 0:00:26
Average standard deviation of split frequencies: 0.007937
565500 -- (-425.293) [-424.751] (-429.719) (-427.348) * (-428.147) (-424.949) [-429.642] (-429.702) -- 0:00:26
566000 -- (-427.320) (-426.780) [-430.112] (-426.579) * (-426.107) [-427.801] (-428.370) (-430.399) -- 0:00:26
566500 -- [-426.116] (-428.906) (-427.501) (-424.613) * (-426.923) [-429.504] (-427.841) (-428.211) -- 0:00:26
567000 -- (-425.479) (-427.428) (-426.044) [-425.795] * [-428.180] (-430.497) (-425.377) (-427.647) -- 0:00:25
567500 -- (-426.141) (-426.280) [-426.087] (-426.059) * (-428.782) [-425.612] (-428.788) (-425.022) -- 0:00:25
568000 -- (-429.945) [-427.263] (-428.682) (-428.600) * [-428.547] (-427.273) (-427.384) (-425.339) -- 0:00:25
568500 -- [-428.274] (-425.757) (-428.593) (-425.648) * (-425.559) (-425.674) (-426.812) [-426.790] -- 0:00:25
569000 -- (-430.637) (-424.695) [-426.799] (-426.664) * (-425.479) [-425.159] (-426.618) (-426.343) -- 0:00:25
569500 -- (-424.902) (-427.104) [-428.031] (-429.974) * (-426.787) (-426.790) [-426.179] (-430.310) -- 0:00:26
570000 -- (-426.547) (-428.038) (-427.826) [-427.185] * (-425.591) (-428.554) (-427.763) [-425.859] -- 0:00:26
Average standard deviation of split frequencies: 0.007872
570500 -- (-425.973) (-427.366) (-425.896) [-427.997] * [-426.003] (-431.033) (-425.489) (-426.214) -- 0:00:26
571000 -- [-425.315] (-427.971) (-426.656) (-426.459) * (-425.898) (-431.240) [-427.265] (-427.746) -- 0:00:26
571500 -- (-425.583) (-426.334) [-424.707] (-426.341) * (-427.067) [-427.291] (-429.247) (-425.376) -- 0:00:26
572000 -- (-425.250) (-425.393) [-424.886] (-425.423) * (-424.738) (-424.587) (-428.336) [-425.631] -- 0:00:26
572500 -- (-427.184) [-426.277] (-427.507) (-426.364) * (-425.451) [-426.002] (-425.148) (-427.189) -- 0:00:26
573000 -- (-425.024) (-427.680) (-428.920) [-426.319] * (-425.034) [-426.838] (-426.933) (-430.466) -- 0:00:26
573500 -- (-428.242) (-426.689) (-428.180) [-428.697] * (-426.374) (-426.151) (-425.412) [-424.927] -- 0:00:26
574000 -- [-424.534] (-428.132) (-433.985) (-426.800) * (-428.174) [-426.906] (-428.351) (-426.932) -- 0:00:25
574500 -- (-425.262) (-427.566) [-428.506] (-427.033) * (-424.972) (-426.388) [-428.389] (-427.202) -- 0:00:25
575000 -- (-427.955) (-425.213) [-426.552] (-427.927) * (-424.659) (-426.451) [-426.446] (-426.065) -- 0:00:25
Average standard deviation of split frequencies: 0.007943
575500 -- (-428.240) [-426.518] (-426.435) (-429.247) * (-429.496) (-427.153) (-425.633) [-426.315] -- 0:00:25
576000 -- (-425.726) (-428.816) (-429.161) [-424.768] * [-426.031] (-427.109) (-426.732) (-427.804) -- 0:00:25
576500 -- (-427.552) (-428.837) [-425.715] (-426.377) * (-425.570) [-426.172] (-428.398) (-427.902) -- 0:00:25
577000 -- (-426.506) [-425.073] (-427.415) (-426.700) * (-427.738) (-427.259) [-427.147] (-429.442) -- 0:00:25
577500 -- (-425.017) [-425.132] (-426.441) (-426.658) * (-425.677) (-427.542) (-430.431) [-427.255] -- 0:00:25
578000 -- (-426.096) [-426.125] (-431.460) (-432.610) * (-426.417) (-427.091) (-428.862) [-424.931] -- 0:00:25
578500 -- (-426.427) (-427.243) (-429.024) [-426.558] * (-426.086) [-427.459] (-428.528) (-427.100) -- 0:00:25
579000 -- [-428.042] (-425.789) (-425.921) (-428.203) * (-426.463) (-426.042) [-430.155] (-428.254) -- 0:00:25
579500 -- (-426.635) (-426.523) (-424.875) [-429.643] * [-426.339] (-425.450) (-428.628) (-427.463) -- 0:00:25
580000 -- (-424.974) (-425.941) [-425.466] (-427.686) * [-429.923] (-426.722) (-427.456) (-426.842) -- 0:00:25
Average standard deviation of split frequencies: 0.008118
580500 -- (-429.626) [-428.547] (-425.863) (-427.726) * [-425.825] (-428.173) (-430.513) (-425.665) -- 0:00:25
581000 -- (-427.861) (-430.250) [-425.209] (-425.632) * (-429.740) (-429.010) (-427.152) [-425.241] -- 0:00:25
581500 -- (-426.878) (-426.568) (-426.060) [-425.215] * (-425.767) [-428.548] (-428.773) (-427.038) -- 0:00:25
582000 -- (-427.865) (-426.036) [-424.881] (-426.150) * [-428.327] (-427.849) (-427.232) (-429.544) -- 0:00:25
582500 -- (-425.976) (-426.402) [-430.225] (-426.815) * (-431.179) (-428.847) [-425.699] (-428.343) -- 0:00:25
583000 -- (-426.598) [-427.311] (-428.199) (-425.893) * (-426.989) (-425.335) [-425.468] (-428.725) -- 0:00:25
583500 -- (-429.733) [-424.976] (-428.006) (-426.326) * [-426.172] (-427.048) (-427.105) (-428.048) -- 0:00:24
584000 -- (-428.540) (-427.456) (-426.643) [-427.797] * (-426.786) (-428.434) (-425.798) [-427.186] -- 0:00:24
584500 -- [-425.798] (-428.000) (-427.285) (-425.920) * (-425.377) (-425.626) [-425.329] (-427.394) -- 0:00:24
585000 -- [-426.924] (-425.797) (-427.622) (-431.227) * (-425.509) (-427.585) [-426.082] (-428.573) -- 0:00:24
Average standard deviation of split frequencies: 0.007902
585500 -- (-425.292) [-427.199] (-427.524) (-429.388) * (-428.858) (-424.584) [-425.771] (-425.437) -- 0:00:24
586000 -- (-426.401) (-426.131) (-428.810) [-427.149] * (-426.567) (-424.866) [-426.478] (-426.874) -- 0:00:25
586500 -- [-427.010] (-427.026) (-426.615) (-427.504) * (-425.913) (-425.614) [-425.201] (-425.805) -- 0:00:25
587000 -- [-425.546] (-426.693) (-428.490) (-429.187) * (-428.781) (-425.399) [-425.075] (-431.505) -- 0:00:25
587500 -- (-433.362) (-428.302) (-427.036) [-428.304] * [-428.304] (-429.001) (-426.349) (-426.136) -- 0:00:25
588000 -- (-431.490) [-425.894] (-426.588) (-427.830) * [-426.821] (-428.174) (-426.324) (-433.043) -- 0:00:25
588500 -- (-428.007) (-424.914) (-430.006) [-432.265] * (-427.079) (-426.969) [-424.657] (-426.706) -- 0:00:25
589000 -- (-427.198) (-428.464) (-425.756) [-429.126] * (-426.300) [-425.785] (-425.907) (-429.504) -- 0:00:25
589500 -- (-426.504) [-428.121] (-426.611) (-425.591) * (-427.919) [-427.543] (-425.771) (-427.606) -- 0:00:25
590000 -- (-426.470) (-425.079) (-430.649) [-427.201] * (-426.749) (-431.054) [-425.606] (-425.814) -- 0:00:25
Average standard deviation of split frequencies: 0.007746
590500 -- (-428.818) (-426.771) (-427.615) [-426.059] * (-428.493) (-426.210) (-427.359) [-430.545] -- 0:00:24
591000 -- (-428.448) [-427.515] (-425.922) (-429.557) * (-431.456) [-429.487] (-426.133) (-426.287) -- 0:00:24
591500 -- (-426.255) (-426.765) [-424.624] (-428.687) * (-429.283) (-429.089) [-427.932] (-428.064) -- 0:00:24
592000 -- (-425.696) (-428.642) (-429.452) [-426.219] * (-426.819) (-428.077) (-428.961) [-427.070] -- 0:00:24
592500 -- [-425.664] (-425.367) (-427.031) (-428.571) * (-429.194) (-424.840) [-427.914] (-426.649) -- 0:00:24
593000 -- (-426.067) [-424.870] (-426.279) (-426.811) * [-427.759] (-427.520) (-428.689) (-425.430) -- 0:00:24
593500 -- (-426.028) (-430.218) [-427.257] (-429.592) * (-427.920) [-425.750] (-429.223) (-431.644) -- 0:00:24
594000 -- (-425.924) [-425.491] (-427.495) (-428.240) * (-428.969) [-425.709] (-430.069) (-430.554) -- 0:00:24
594500 -- (-426.694) (-429.431) (-429.356) [-427.356] * (-427.077) (-425.128) [-426.751] (-429.377) -- 0:00:24
595000 -- (-427.478) (-425.234) (-426.240) [-425.523] * [-428.810] (-429.391) (-428.246) (-425.978) -- 0:00:24
Average standard deviation of split frequencies: 0.008096
595500 -- (-430.130) (-425.305) [-425.700] (-424.622) * (-430.714) (-428.052) (-427.516) [-426.508] -- 0:00:24
596000 -- (-428.390) (-425.907) (-426.635) [-425.162] * (-429.842) (-425.113) [-424.657] (-425.514) -- 0:00:24
596500 -- (-427.329) [-424.729] (-426.218) (-429.957) * (-426.315) [-426.740] (-425.040) (-426.482) -- 0:00:24
597000 -- (-424.547) (-428.963) (-430.429) [-425.271] * (-425.557) [-433.233] (-425.067) (-426.198) -- 0:00:24
597500 -- (-426.276) [-425.028] (-425.892) (-426.256) * (-424.494) (-426.425) (-425.704) [-425.466] -- 0:00:24
598000 -- [-426.584] (-427.869) (-425.763) (-425.045) * (-426.567) [-427.657] (-425.779) (-428.151) -- 0:00:24
598500 -- (-426.020) (-425.203) (-428.846) [-428.809] * (-429.057) (-430.370) [-427.752] (-425.452) -- 0:00:24
599000 -- (-426.033) [-424.926] (-434.614) (-425.984) * (-426.452) (-425.579) [-428.383] (-426.906) -- 0:00:24
599500 -- (-426.804) (-427.059) [-426.287] (-428.062) * [-427.700] (-427.320) (-425.742) (-425.544) -- 0:00:24
600000 -- (-425.184) [-426.256] (-427.101) (-426.036) * [-426.511] (-428.371) (-425.874) (-427.733) -- 0:00:24
Average standard deviation of split frequencies: 0.008731
600500 -- (-428.246) [-426.154] (-425.059) (-426.157) * (-427.062) (-430.619) (-425.945) [-425.663] -- 0:00:23
601000 -- [-424.840] (-425.521) (-426.306) (-426.558) * (-426.438) [-425.541] (-425.463) (-425.689) -- 0:00:23
601500 -- (-426.711) [-426.462] (-426.588) (-428.227) * (-428.386) (-427.053) (-431.594) [-425.369] -- 0:00:23
602000 -- (-426.060) (-427.532) (-425.585) [-426.268] * [-427.584] (-429.080) (-428.260) (-426.480) -- 0:00:23
602500 -- (-425.698) (-426.086) [-428.525] (-426.557) * (-430.605) (-431.046) (-428.608) [-426.049] -- 0:00:24
603000 -- [-425.508] (-429.596) (-426.788) (-426.812) * (-426.386) (-426.254) (-428.130) [-426.105] -- 0:00:24
603500 -- (-431.536) (-429.560) (-428.069) [-425.814] * (-425.169) (-428.877) [-424.781] (-428.175) -- 0:00:24
604000 -- (-432.893) (-429.504) [-425.643] (-433.432) * [-428.560] (-432.971) (-425.947) (-428.729) -- 0:00:24
604500 -- (-429.051) (-425.351) (-426.491) [-427.334] * (-427.209) [-425.699] (-425.407) (-427.670) -- 0:00:24
605000 -- (-431.540) (-425.319) [-427.954] (-429.007) * (-425.799) (-426.025) (-427.336) [-425.108] -- 0:00:24
Average standard deviation of split frequencies: 0.008603
605500 -- (-425.690) (-425.510) [-428.085] (-427.576) * (-425.057) (-428.258) (-425.467) [-427.766] -- 0:00:24
606000 -- (-425.844) [-426.219] (-428.777) (-427.385) * [-428.230] (-427.307) (-426.337) (-426.914) -- 0:00:24
606500 -- (-427.331) (-430.378) [-428.532] (-429.763) * (-428.601) (-429.438) [-426.964] (-425.316) -- 0:00:24
607000 -- (-428.251) (-428.189) [-426.216] (-430.797) * (-427.932) [-427.043] (-426.610) (-425.898) -- 0:00:23
607500 -- (-426.508) (-434.553) [-427.944] (-427.278) * (-427.156) [-427.256] (-425.754) (-425.937) -- 0:00:23
608000 -- [-425.116] (-433.872) (-430.501) (-427.093) * (-425.285) (-429.923) (-429.723) [-427.361] -- 0:00:23
608500 -- (-426.659) (-426.041) (-432.022) [-426.188] * (-425.211) (-426.670) [-425.522] (-425.731) -- 0:00:23
609000 -- [-425.634] (-430.973) (-428.397) (-426.305) * (-427.927) (-425.467) [-426.846] (-425.998) -- 0:00:23
609500 -- (-428.970) (-427.989) [-425.863] (-424.843) * (-427.458) (-426.646) [-429.649] (-425.630) -- 0:00:23
610000 -- (-427.938) (-427.967) [-427.292] (-427.740) * (-428.003) [-427.002] (-426.401) (-424.938) -- 0:00:23
Average standard deviation of split frequencies: 0.009354
610500 -- (-425.523) (-432.157) [-427.227] (-430.103) * (-427.365) (-427.608) [-428.223] (-424.674) -- 0:00:23
611000 -- (-428.187) (-435.532) (-427.693) [-425.959] * (-429.055) (-428.963) (-427.794) [-427.494] -- 0:00:23
611500 -- (-426.030) (-426.653) [-425.600] (-426.355) * (-431.401) (-431.535) [-426.013] (-427.397) -- 0:00:23
612000 -- [-428.479] (-427.436) (-425.857) (-429.389) * [-428.120] (-426.847) (-426.745) (-427.758) -- 0:00:23
612500 -- (-431.145) (-424.980) (-426.298) [-428.849] * (-426.465) (-428.362) [-425.555] (-424.827) -- 0:00:23
613000 -- [-425.715] (-430.870) (-424.926) (-424.969) * (-429.876) (-428.311) (-426.894) [-425.788] -- 0:00:23
613500 -- (-426.406) (-425.254) (-426.869) [-426.837] * (-430.561) (-425.698) (-427.153) [-425.409] -- 0:00:23
614000 -- (-427.913) (-426.985) [-426.516] (-430.645) * (-425.806) (-426.163) (-429.092) [-427.806] -- 0:00:23
614500 -- [-426.239] (-426.283) (-426.488) (-431.534) * [-427.714] (-426.838) (-425.941) (-428.681) -- 0:00:23
615000 -- [-426.783] (-426.052) (-426.367) (-429.323) * [-431.180] (-432.439) (-426.274) (-430.547) -- 0:00:23
Average standard deviation of split frequencies: 0.008466
615500 -- (-426.265) (-427.952) (-425.467) [-427.424] * (-428.858) (-427.903) (-428.734) [-427.168] -- 0:00:23
616000 -- (-425.728) (-426.294) (-428.635) [-427.100] * (-426.677) [-431.035] (-427.316) (-427.609) -- 0:00:23
616500 -- (-430.771) (-429.662) (-426.064) [-426.669] * (-426.207) (-426.198) (-426.038) [-429.125] -- 0:00:23
617000 -- [-425.690] (-427.637) (-426.584) (-427.592) * (-426.932) (-424.977) [-425.726] (-427.379) -- 0:00:23
617500 -- (-427.966) (-428.839) (-427.584) [-426.552] * (-424.788) (-432.016) [-426.298] (-429.352) -- 0:00:23
618000 -- [-427.571] (-427.764) (-431.133) (-426.875) * [-424.737] (-428.288) (-426.601) (-428.357) -- 0:00:23
618500 -- [-428.042] (-427.744) (-425.180) (-425.338) * (-424.751) [-425.377] (-428.861) (-428.621) -- 0:00:23
619000 -- [-426.445] (-430.182) (-428.556) (-425.738) * (-424.614) (-425.441) [-425.183] (-426.623) -- 0:00:23
619500 -- (-426.174) (-427.184) [-427.288] (-426.686) * (-425.850) (-426.928) (-428.056) [-428.294] -- 0:00:23
620000 -- (-425.606) (-425.807) [-429.507] (-427.057) * (-425.238) [-426.730] (-424.789) (-427.777) -- 0:00:23
Average standard deviation of split frequencies: 0.008497
620500 -- (-429.004) (-429.068) [-426.354] (-427.980) * (-425.033) [-425.401] (-428.746) (-427.756) -- 0:00:23
621000 -- [-426.953] (-426.066) (-428.283) (-429.758) * [-425.249] (-426.715) (-426.459) (-427.715) -- 0:00:23
621500 -- (-427.190) (-427.349) (-426.867) [-428.977] * (-427.178) [-425.118] (-426.083) (-424.698) -- 0:00:23
622000 -- [-426.139] (-426.059) (-426.300) (-429.130) * [-428.331] (-424.761) (-426.669) (-427.584) -- 0:00:23
622500 -- [-426.117] (-425.613) (-425.143) (-431.894) * (-429.981) [-424.710] (-428.772) (-426.018) -- 0:00:23
623000 -- (-425.728) (-427.907) [-427.731] (-426.686) * (-432.125) (-426.133) (-428.660) [-425.466] -- 0:00:22
623500 -- (-427.640) (-430.532) [-425.857] (-427.350) * (-425.565) (-431.145) [-427.444] (-425.369) -- 0:00:22
624000 -- (-426.636) (-426.491) (-427.186) [-424.701] * (-425.648) [-429.588] (-428.911) (-426.618) -- 0:00:22
624500 -- (-426.071) (-424.722) (-427.058) [-424.949] * (-427.145) (-428.637) (-426.484) [-426.742] -- 0:00:22
625000 -- (-425.309) (-427.317) [-426.145] (-426.903) * [-425.616] (-425.251) (-429.894) (-426.759) -- 0:00:22
Average standard deviation of split frequencies: 0.008594
625500 -- (-425.070) (-426.788) (-432.332) [-425.620] * (-425.963) [-427.511] (-430.998) (-427.884) -- 0:00:22
626000 -- [-427.034] (-428.859) (-428.249) (-428.164) * [-425.255] (-426.223) (-432.817) (-425.014) -- 0:00:22
626500 -- [-427.505] (-432.758) (-428.903) (-427.236) * (-425.715) (-426.651) [-433.084] (-427.125) -- 0:00:22
627000 -- [-427.351] (-428.173) (-430.655) (-425.895) * [-426.230] (-428.552) (-425.724) (-428.248) -- 0:00:22
627500 -- (-428.917) (-429.715) (-426.083) [-426.613] * (-424.985) (-427.506) [-427.306] (-427.456) -- 0:00:22
628000 -- (-425.214) (-431.178) [-426.443] (-425.905) * (-426.438) (-431.442) [-424.912] (-429.866) -- 0:00:22
628500 -- [-428.648] (-428.307) (-424.911) (-425.735) * (-427.676) (-430.404) [-425.391] (-425.402) -- 0:00:22
629000 -- (-428.146) (-426.674) [-428.618] (-428.926) * (-427.071) (-431.317) [-427.919] (-430.779) -- 0:00:22
629500 -- (-427.350) [-427.843] (-429.711) (-426.489) * [-428.307] (-428.364) (-425.381) (-427.097) -- 0:00:22
630000 -- (-427.836) (-427.015) (-428.543) [-428.021] * (-428.525) [-427.775] (-427.189) (-426.049) -- 0:00:22
Average standard deviation of split frequencies: 0.008882
630500 -- (-426.094) [-430.313] (-426.206) (-426.544) * (-428.557) (-427.358) (-425.145) [-425.534] -- 0:00:22
631000 -- (-426.288) (-425.354) (-426.264) [-429.491] * (-428.307) (-430.241) [-425.998] (-428.418) -- 0:00:22
631500 -- (-429.891) (-427.133) [-427.643] (-426.030) * [-426.632] (-427.521) (-425.628) (-429.825) -- 0:00:22
632000 -- (-426.371) (-426.469) (-425.059) [-426.236] * [-428.593] (-430.207) (-424.745) (-427.962) -- 0:00:22
632500 -- [-428.125] (-426.796) (-424.631) (-425.281) * (-428.439) (-426.512) (-426.023) [-427.265] -- 0:00:22
633000 -- (-427.068) (-427.752) (-426.685) [-426.322] * (-426.834) (-424.994) (-425.310) [-425.963] -- 0:00:22
633500 -- [-430.001] (-426.689) (-428.158) (-427.499) * (-427.985) [-426.153] (-426.085) (-429.640) -- 0:00:21
634000 -- (-429.186) [-427.144] (-429.022) (-426.102) * (-425.725) [-431.395] (-426.195) (-425.851) -- 0:00:22
634500 -- [-427.619] (-427.334) (-425.864) (-426.157) * [-425.030] (-428.349) (-427.553) (-426.781) -- 0:00:22
635000 -- (-428.450) (-427.408) [-426.619] (-426.985) * (-426.037) (-428.691) (-426.059) [-426.957] -- 0:00:22
Average standard deviation of split frequencies: 0.008477
635500 -- (-429.932) (-427.457) (-426.584) [-427.164] * (-428.087) (-429.648) (-425.752) [-426.695] -- 0:00:22
636000 -- (-424.865) (-426.754) [-426.373] (-426.865) * (-429.461) [-427.574] (-426.991) (-425.400) -- 0:00:22
636500 -- (-427.238) [-425.812] (-431.008) (-426.604) * (-425.721) (-430.028) (-424.794) [-425.121] -- 0:00:22
637000 -- (-426.916) (-428.028) [-430.618] (-426.718) * [-427.085] (-425.119) (-424.523) (-425.160) -- 0:00:22
637500 -- (-425.781) (-427.545) (-424.917) [-425.584] * [-426.008] (-427.638) (-425.310) (-427.958) -- 0:00:22
638000 -- (-424.683) (-429.860) [-426.799] (-425.460) * (-425.310) [-425.689] (-432.369) (-426.012) -- 0:00:22
638500 -- (-432.264) [-426.968] (-424.899) (-425.387) * [-425.571] (-427.070) (-426.930) (-426.621) -- 0:00:22
639000 -- [-429.024] (-425.089) (-425.161) (-428.195) * (-425.163) (-429.298) (-429.855) [-428.141] -- 0:00:22
639500 -- [-427.858] (-425.006) (-425.199) (-429.012) * (-425.482) (-426.898) [-424.546] (-429.331) -- 0:00:21
640000 -- (-427.073) (-426.335) [-426.942] (-426.012) * (-428.682) (-428.207) [-424.870] (-435.587) -- 0:00:21
Average standard deviation of split frequencies: 0.009014
640500 -- (-428.590) (-425.939) [-427.515] (-424.711) * (-427.194) (-432.044) [-427.083] (-428.263) -- 0:00:21
641000 -- [-424.804] (-428.345) (-428.021) (-428.091) * (-427.072) (-427.546) (-425.233) [-430.175] -- 0:00:21
641500 -- (-425.367) [-426.074] (-429.942) (-429.084) * (-427.258) (-426.572) [-426.637] (-429.651) -- 0:00:21
642000 -- [-425.620] (-426.099) (-426.133) (-426.288) * (-426.520) (-425.501) (-426.116) [-428.001] -- 0:00:21
642500 -- (-427.063) (-427.690) (-426.456) [-426.330] * (-427.620) (-426.746) [-426.489] (-425.973) -- 0:00:21
643000 -- (-426.175) (-429.949) (-425.786) [-430.122] * [-429.518] (-425.519) (-425.456) (-425.970) -- 0:00:21
643500 -- (-427.111) (-427.311) (-426.722) [-428.413] * [-425.083] (-426.828) (-426.446) (-425.582) -- 0:00:21
644000 -- (-426.159) [-426.577] (-426.860) (-426.057) * (-425.777) (-426.140) [-425.831] (-427.562) -- 0:00:21
644500 -- (-426.856) [-428.211] (-426.092) (-427.595) * [-428.850] (-427.799) (-428.541) (-426.321) -- 0:00:21
645000 -- (-427.382) (-426.038) [-425.766] (-427.078) * (-430.197) [-426.291] (-427.436) (-427.889) -- 0:00:21
Average standard deviation of split frequencies: 0.008113
645500 -- (-430.203) (-429.281) (-426.137) [-425.555] * (-425.093) (-425.348) [-426.481] (-428.469) -- 0:00:21
646000 -- (-426.097) [-426.569] (-429.738) (-424.850) * (-427.298) (-427.537) [-429.301] (-425.678) -- 0:00:21
646500 -- (-430.788) (-427.100) (-428.945) [-426.570] * (-428.209) [-428.299] (-425.637) (-426.305) -- 0:00:21
647000 -- (-427.447) (-426.953) (-429.422) [-427.780] * (-429.226) (-428.202) [-424.907] (-430.091) -- 0:00:21
647500 -- (-426.042) (-425.348) [-427.218] (-426.266) * (-431.620) [-425.717] (-428.040) (-428.302) -- 0:00:21
648000 -- (-426.570) (-427.438) (-426.398) [-427.966] * (-426.162) (-425.052) [-425.442] (-426.762) -- 0:00:21
648500 -- (-425.582) (-426.564) (-425.348) [-425.397] * (-428.830) (-427.213) (-426.330) [-426.678] -- 0:00:21
649000 -- (-428.681) (-426.520) (-426.301) [-428.416] * [-427.993] (-426.494) (-428.344) (-427.550) -- 0:00:21
649500 -- (-428.183) (-427.989) (-425.923) [-425.738] * [-427.507] (-426.322) (-431.882) (-432.555) -- 0:00:21
650000 -- (-426.249) (-426.350) (-426.580) [-425.550] * (-431.044) (-425.809) [-432.698] (-428.515) -- 0:00:21
Average standard deviation of split frequencies: 0.007288
650500 -- (-427.038) [-428.120] (-429.257) (-428.713) * (-430.103) (-427.822) (-428.233) [-426.575] -- 0:00:21
651000 -- (-426.139) (-425.332) (-428.719) [-430.077] * (-429.053) (-428.286) (-427.972) [-425.879] -- 0:00:21
651500 -- (-427.664) (-427.806) [-426.097] (-426.311) * [-427.950] (-427.298) (-426.344) (-426.556) -- 0:00:21
652000 -- [-426.825] (-430.092) (-431.221) (-428.434) * (-425.493) [-427.265] (-425.695) (-428.998) -- 0:00:21
652500 -- (-426.397) (-427.582) (-429.148) [-429.651] * [-426.689] (-427.982) (-425.156) (-428.524) -- 0:00:21
653000 -- (-427.822) (-426.964) (-425.820) [-425.422] * (-426.434) (-427.494) (-425.850) [-426.031] -- 0:00:21
653500 -- (-428.654) [-426.269] (-425.325) (-425.990) * (-426.207) [-426.487] (-428.151) (-430.845) -- 0:00:21
654000 -- (-431.174) (-425.511) (-430.024) [-425.654] * (-427.767) (-427.181) [-426.936] (-425.666) -- 0:00:21
654500 -- (-430.860) (-428.172) [-425.288] (-426.400) * (-426.324) (-430.219) [-425.004] (-427.200) -- 0:00:21
655000 -- (-428.190) (-428.069) (-428.633) [-425.618] * (-425.573) [-429.957] (-426.480) (-430.743) -- 0:00:21
Average standard deviation of split frequencies: 0.007609
655500 -- (-427.976) (-428.695) (-426.686) [-425.018] * (-428.619) [-425.652] (-426.853) (-430.242) -- 0:00:21
656000 -- (-431.867) (-427.769) (-425.608) [-425.122] * (-425.750) [-429.191] (-429.054) (-425.155) -- 0:00:20
656500 -- (-425.475) [-427.233] (-432.013) (-426.148) * [-428.545] (-429.886) (-427.278) (-426.959) -- 0:00:20
657000 -- [-426.201] (-428.156) (-425.485) (-426.456) * (-427.820) [-428.484] (-427.221) (-429.491) -- 0:00:20
657500 -- (-430.363) [-428.292] (-426.865) (-427.427) * (-425.645) (-426.927) (-428.385) [-429.789] -- 0:00:20
658000 -- (-428.770) [-426.182] (-428.142) (-424.729) * [-428.194] (-432.260) (-430.215) (-425.099) -- 0:00:20
658500 -- (-427.372) (-425.850) (-438.638) [-427.381] * [-427.937] (-433.599) (-429.720) (-425.400) -- 0:00:20
659000 -- [-428.310] (-426.481) (-431.181) (-425.767) * (-425.902) [-436.062] (-439.156) (-426.116) -- 0:00:20
659500 -- (-427.231) (-425.438) [-427.344] (-424.993) * (-425.927) (-427.311) (-426.333) [-426.025] -- 0:00:20
660000 -- (-426.494) [-425.283] (-426.696) (-425.550) * [-428.868] (-427.554) (-427.654) (-424.495) -- 0:00:20
Average standard deviation of split frequencies: 0.007261
660500 -- (-426.690) [-425.872] (-427.817) (-425.817) * [-425.192] (-426.572) (-424.958) (-424.500) -- 0:00:20
661000 -- (-426.954) (-428.832) (-430.118) [-425.999] * [-427.988] (-427.065) (-424.836) (-424.702) -- 0:00:20
661500 -- (-426.335) [-428.838] (-426.957) (-425.299) * (-426.830) (-426.051) [-426.724] (-427.164) -- 0:00:20
662000 -- (-426.935) [-428.117] (-427.860) (-426.527) * (-426.371) [-427.811] (-427.951) (-428.510) -- 0:00:20
662500 -- (-431.810) (-426.707) (-426.630) [-425.249] * (-427.638) (-426.782) (-428.309) [-425.524] -- 0:00:20
663000 -- (-426.647) (-429.297) [-427.648] (-425.802) * (-428.712) [-425.028] (-426.614) (-435.703) -- 0:00:20
663500 -- (-425.256) (-428.851) (-425.749) [-425.997] * [-428.626] (-425.272) (-430.553) (-425.838) -- 0:00:20
664000 -- (-426.904) [-427.562] (-427.683) (-426.975) * [-426.884] (-428.573) (-426.171) (-425.687) -- 0:00:20
664500 -- (-425.708) (-425.953) (-427.471) [-425.617] * [-427.147] (-426.384) (-426.997) (-425.944) -- 0:00:20
665000 -- [-424.849] (-427.457) (-426.777) (-427.879) * (-425.573) [-425.036] (-429.612) (-428.141) -- 0:00:20
Average standard deviation of split frequencies: 0.007203
665500 -- (-431.155) (-427.857) (-427.295) [-425.991] * (-426.418) [-431.301] (-427.370) (-426.392) -- 0:00:20
666000 -- (-429.624) [-428.469] (-428.268) (-427.305) * [-425.487] (-430.477) (-425.710) (-427.432) -- 0:00:20
666500 -- (-425.881) (-425.560) [-428.342] (-426.152) * [-426.272] (-427.194) (-425.370) (-436.582) -- 0:00:20
667000 -- (-428.148) (-425.172) (-427.456) [-425.085] * (-428.259) (-427.786) [-424.941] (-436.448) -- 0:00:19
667500 -- (-426.063) (-426.222) [-426.271] (-428.728) * (-426.534) (-425.588) (-424.946) [-427.792] -- 0:00:20
668000 -- [-426.906] (-426.092) (-426.375) (-427.689) * (-428.044) (-427.730) (-426.945) [-427.086] -- 0:00:20
668500 -- [-426.232] (-425.446) (-427.514) (-426.613) * (-427.233) [-428.421] (-427.426) (-426.604) -- 0:00:20
669000 -- [-427.551] (-425.621) (-430.382) (-426.564) * [-426.645] (-427.739) (-426.742) (-426.724) -- 0:00:20
669500 -- (-426.587) (-426.727) (-430.198) [-426.927] * (-430.157) (-426.297) [-430.911] (-425.011) -- 0:00:20
670000 -- [-426.828] (-425.044) (-427.163) (-429.196) * [-426.259] (-430.279) (-426.252) (-425.993) -- 0:00:20
Average standard deviation of split frequencies: 0.007292
670500 -- (-428.563) [-425.085] (-428.086) (-428.039) * [-425.745] (-427.388) (-429.225) (-427.835) -- 0:00:20
671000 -- (-428.078) [-426.771] (-427.241) (-430.122) * (-426.477) (-425.697) [-425.463] (-424.820) -- 0:00:20
671500 -- (-425.891) [-425.067] (-426.557) (-428.354) * (-426.399) (-428.378) [-424.552] (-425.659) -- 0:00:20
672000 -- (-426.503) (-424.777) (-425.692) [-424.922] * (-427.197) (-427.255) (-424.944) [-428.375] -- 0:00:20
672500 -- (-426.793) (-429.259) (-425.228) [-425.414] * (-428.087) (-427.608) [-426.833] (-425.961) -- 0:00:19
673000 -- (-428.636) (-425.204) [-425.560] (-425.906) * (-430.780) (-425.699) (-435.170) [-425.600] -- 0:00:19
673500 -- (-426.919) (-425.245) (-426.575) [-428.331] * (-429.110) [-426.502] (-427.957) (-426.428) -- 0:00:19
674000 -- (-425.775) (-426.027) (-426.942) [-426.803] * (-429.021) [-431.482] (-425.547) (-426.115) -- 0:00:19
674500 -- [-424.919] (-430.687) (-425.530) (-425.793) * [-433.373] (-428.784) (-426.129) (-427.844) -- 0:00:19
675000 -- (-425.214) (-430.118) [-426.329] (-426.958) * (-426.755) [-428.112] (-427.596) (-426.642) -- 0:00:19
Average standard deviation of split frequencies: 0.007889
675500 -- (-426.020) [-426.419] (-427.101) (-428.462) * (-426.903) (-426.734) [-425.381] (-428.506) -- 0:00:19
676000 -- (-425.453) (-428.048) (-426.587) [-429.681] * [-430.408] (-426.247) (-429.445) (-428.891) -- 0:00:19
676500 -- (-425.955) (-426.711) [-427.987] (-425.501) * (-427.224) (-425.950) (-425.135) [-428.618] -- 0:00:19
677000 -- (-431.313) (-428.600) [-425.902] (-427.415) * [-425.957] (-425.137) (-427.718) (-430.624) -- 0:00:19
677500 -- (-431.852) (-426.380) (-428.596) [-428.886] * [-429.799] (-427.749) (-426.981) (-429.879) -- 0:00:19
678000 -- (-424.651) [-428.142] (-428.250) (-428.758) * (-426.533) (-426.328) (-426.852) [-424.917] -- 0:00:19
678500 -- [-425.230] (-424.891) (-429.864) (-430.374) * (-426.301) (-425.708) [-429.435] (-426.515) -- 0:00:19
679000 -- [-426.223] (-427.630) (-426.358) (-431.932) * [-425.742] (-431.348) (-425.463) (-427.293) -- 0:00:19
679500 -- (-426.127) [-426.333] (-425.962) (-428.267) * (-426.874) (-428.515) [-425.981] (-426.013) -- 0:00:19
680000 -- (-430.154) [-425.179] (-426.397) (-431.209) * (-425.840) [-425.415] (-425.541) (-430.568) -- 0:00:19
Average standard deviation of split frequencies: 0.007577
680500 -- (-425.525) (-425.735) (-432.150) [-426.640] * (-427.813) [-426.160] (-426.704) (-425.224) -- 0:00:19
681000 -- (-430.204) [-425.299] (-425.509) (-428.749) * [-424.875] (-428.407) (-426.707) (-425.211) -- 0:00:19
681500 -- (-426.529) (-428.505) [-430.466] (-431.120) * (-426.076) [-426.479] (-429.079) (-426.404) -- 0:00:19
682000 -- (-425.902) [-425.771] (-429.318) (-430.397) * (-426.259) [-425.093] (-428.596) (-427.875) -- 0:00:19
682500 -- (-425.788) (-425.805) (-425.843) [-424.938] * (-426.400) [-424.702] (-426.649) (-426.817) -- 0:00:19
683000 -- (-427.394) (-426.070) (-430.405) [-425.859] * [-427.348] (-431.094) (-427.804) (-426.563) -- 0:00:19
683500 -- (-426.910) (-428.630) (-425.926) [-427.589] * (-425.421) (-428.972) (-429.187) [-427.928] -- 0:00:18
684000 -- (-425.974) (-429.510) [-426.449] (-425.254) * (-425.469) [-426.841] (-430.228) (-427.581) -- 0:00:18
684500 -- (-426.380) (-428.017) (-426.848) [-426.803] * [-426.116] (-426.295) (-429.206) (-428.888) -- 0:00:19
685000 -- (-425.019) [-426.411] (-426.868) (-426.537) * [-427.035] (-427.420) (-426.101) (-427.196) -- 0:00:19
Average standard deviation of split frequencies: 0.007215
685500 -- [-429.034] (-427.284) (-429.146) (-425.728) * (-429.339) (-426.306) (-427.620) [-428.887] -- 0:00:19
686000 -- (-428.276) (-426.948) (-427.573) [-425.847] * (-427.546) (-424.901) (-426.512) [-425.454] -- 0:00:19
686500 -- (-426.945) (-425.121) (-429.095) [-424.850] * (-428.026) [-427.723] (-425.488) (-429.757) -- 0:00:19
687000 -- (-425.274) [-426.045] (-426.677) (-431.177) * (-426.280) (-425.515) (-429.858) [-426.103] -- 0:00:19
687500 -- (-426.955) [-425.705] (-426.265) (-425.162) * (-425.069) [-426.455] (-426.935) (-426.727) -- 0:00:19
688000 -- (-427.120) (-428.182) (-428.439) [-426.108] * [-425.785] (-428.013) (-426.821) (-427.543) -- 0:00:19
688500 -- (-428.660) (-425.510) [-426.314] (-425.684) * [-426.602] (-427.494) (-429.304) (-427.890) -- 0:00:19
689000 -- (-428.210) [-425.659] (-428.884) (-425.474) * (-426.275) [-425.756] (-427.319) (-428.611) -- 0:00:18
689500 -- (-432.184) (-429.867) [-427.069] (-425.358) * (-426.078) (-427.115) (-425.902) [-427.611] -- 0:00:18
690000 -- (-425.155) [-427.602] (-425.071) (-430.203) * (-425.450) (-426.795) [-425.811] (-425.840) -- 0:00:18
Average standard deviation of split frequencies: 0.006783
690500 -- [-427.469] (-425.172) (-432.415) (-426.938) * [-425.555] (-425.516) (-426.748) (-426.618) -- 0:00:18
691000 -- (-427.348) [-427.341] (-429.654) (-427.081) * (-430.456) (-426.317) (-424.861) [-426.890] -- 0:00:18
691500 -- [-427.781] (-428.848) (-425.302) (-426.840) * (-425.213) (-425.362) (-424.756) [-425.214] -- 0:00:18
692000 -- [-426.791] (-428.804) (-425.470) (-428.383) * (-425.740) (-425.526) [-424.515] (-425.269) -- 0:00:18
692500 -- (-424.874) (-428.108) (-426.710) [-426.160] * [-424.730] (-426.948) (-426.895) (-426.092) -- 0:00:18
693000 -- [-424.899] (-427.380) (-427.888) (-425.333) * (-425.480) (-426.220) (-430.719) [-426.041] -- 0:00:18
693500 -- (-425.944) [-426.451] (-425.196) (-426.540) * (-426.153) (-426.988) (-426.736) [-424.870] -- 0:00:18
694000 -- (-427.576) (-430.871) [-424.711] (-425.879) * (-425.667) (-425.712) (-425.979) [-424.502] -- 0:00:18
694500 -- (-425.798) (-425.676) [-427.105] (-427.559) * (-425.928) (-428.600) (-429.223) [-424.817] -- 0:00:18
695000 -- [-425.467] (-424.593) (-429.351) (-435.239) * (-426.732) (-424.432) (-434.969) [-426.328] -- 0:00:18
Average standard deviation of split frequencies: 0.007610
695500 -- (-425.885) (-424.967) (-425.084) [-430.379] * (-425.900) (-425.577) (-427.714) [-426.968] -- 0:00:18
696000 -- (-427.032) (-425.932) (-426.611) [-432.097] * (-427.216) [-426.540] (-427.702) (-426.637) -- 0:00:18
696500 -- (-427.019) (-424.605) [-425.117] (-425.835) * [-426.295] (-425.327) (-425.603) (-425.132) -- 0:00:18
697000 -- (-425.125) (-426.353) (-427.626) [-428.070] * (-425.256) (-425.404) (-430.758) [-427.576] -- 0:00:18
697500 -- (-426.797) (-427.514) [-426.224] (-425.434) * [-425.352] (-431.650) (-428.013) (-427.000) -- 0:00:18
698000 -- (-426.576) [-425.324] (-429.764) (-425.878) * (-426.832) [-424.829] (-427.353) (-425.686) -- 0:00:18
698500 -- [-426.997] (-425.680) (-426.525) (-428.353) * (-430.144) (-425.630) [-425.598] (-426.427) -- 0:00:18
699000 -- [-425.953] (-427.714) (-424.667) (-427.504) * (-428.197) [-429.649] (-429.825) (-426.271) -- 0:00:18
699500 -- (-426.708) (-426.762) [-426.787] (-425.663) * (-426.335) [-427.314] (-425.444) (-424.771) -- 0:00:18
700000 -- (-426.878) (-426.755) (-424.528) [-424.585] * (-432.485) [-424.643] (-425.855) (-425.394) -- 0:00:18
Average standard deviation of split frequencies: 0.006728
700500 -- (-425.692) (-425.515) (-426.831) [-428.910] * (-426.371) [-425.857] (-428.133) (-429.050) -- 0:00:17
701000 -- (-424.565) [-427.445] (-425.777) (-429.690) * (-425.363) [-424.985] (-427.584) (-425.436) -- 0:00:18
701500 -- (-424.819) (-429.464) [-425.915] (-426.932) * [-426.855] (-426.164) (-427.075) (-425.496) -- 0:00:18
702000 -- (-425.388) (-429.324) [-426.212] (-425.471) * (-425.239) (-425.643) [-425.687] (-426.254) -- 0:00:18
702500 -- (-428.691) (-430.659) [-424.545] (-426.518) * [-424.699] (-426.460) (-426.287) (-425.885) -- 0:00:18
703000 -- (-427.255) (-426.196) [-424.786] (-426.148) * [-428.265] (-425.178) (-427.040) (-425.487) -- 0:00:18
703500 -- (-428.137) [-428.546] (-425.878) (-428.448) * (-428.202) [-425.013] (-426.662) (-427.305) -- 0:00:18
704000 -- [-427.760] (-427.036) (-427.618) (-428.364) * (-428.589) (-427.523) [-425.997] (-430.150) -- 0:00:18
704500 -- [-425.550] (-424.912) (-429.492) (-426.647) * (-427.629) (-428.805) [-427.354] (-427.543) -- 0:00:18
705000 -- (-426.243) (-426.043) (-427.935) [-427.149] * (-430.625) [-427.358] (-424.862) (-425.793) -- 0:00:17
Average standard deviation of split frequencies: 0.006834
705500 -- [-424.882] (-426.113) (-425.327) (-426.673) * (-428.825) [-428.093] (-427.457) (-426.212) -- 0:00:17
706000 -- (-427.787) [-425.660] (-424.984) (-427.083) * (-428.213) (-428.384) [-427.459] (-433.244) -- 0:00:17
706500 -- (-428.655) (-427.996) [-426.952] (-431.972) * (-425.713) (-427.677) [-425.175] (-426.583) -- 0:00:17
707000 -- (-428.472) (-426.928) (-427.850) [-426.232] * (-427.497) (-430.424) (-428.115) [-427.160] -- 0:00:17
707500 -- [-424.441] (-425.428) (-427.963) (-429.261) * (-425.444) (-431.300) (-425.778) [-426.124] -- 0:00:17
708000 -- (-425.246) [-427.640] (-426.306) (-427.761) * (-425.101) [-426.404] (-429.434) (-427.778) -- 0:00:17
708500 -- (-424.994) (-428.439) (-425.630) [-426.295] * [-425.821] (-426.457) (-431.453) (-428.921) -- 0:00:17
709000 -- (-431.104) [-425.377] (-432.108) (-424.753) * (-427.233) (-428.570) [-427.802] (-426.259) -- 0:00:17
709500 -- (-426.874) (-425.337) [-428.187] (-426.425) * [-429.290] (-427.507) (-425.189) (-425.201) -- 0:00:17
710000 -- (-426.909) (-428.089) (-425.986) [-427.119] * (-427.245) [-428.198] (-424.884) (-427.425) -- 0:00:17
Average standard deviation of split frequencies: 0.006555
710500 -- (-429.351) (-426.730) (-431.990) [-427.056] * (-425.333) (-431.398) (-425.668) [-425.577] -- 0:00:17
711000 -- (-426.905) (-429.030) (-428.239) [-425.306] * (-426.360) (-431.833) [-424.647] (-428.318) -- 0:00:17
711500 -- [-425.757] (-436.240) (-427.104) (-425.266) * [-424.968] (-425.872) (-427.420) (-428.433) -- 0:00:17
712000 -- (-426.957) (-433.957) (-427.307) [-425.509] * (-429.323) (-431.718) (-427.152) [-427.052] -- 0:00:17
712500 -- (-429.013) (-426.959) (-425.492) [-427.735] * (-427.140) [-425.957] (-428.412) (-425.649) -- 0:00:17
713000 -- [-428.038] (-428.055) (-425.858) (-426.295) * (-427.523) (-427.351) (-427.760) [-425.202] -- 0:00:17
713500 -- (-426.523) (-425.287) [-427.590] (-427.362) * (-428.087) [-426.197] (-426.833) (-428.958) -- 0:00:17
714000 -- (-427.048) (-426.567) [-429.977] (-428.733) * (-426.533) (-425.612) (-427.856) [-427.032] -- 0:00:17
714500 -- (-425.894) [-426.744] (-424.771) (-429.911) * (-427.048) (-425.735) (-428.381) [-426.444] -- 0:00:17
715000 -- [-425.374] (-426.429) (-424.552) (-431.473) * (-427.240) [-426.362] (-427.137) (-432.183) -- 0:00:17
Average standard deviation of split frequencies: 0.006296
715500 -- (-429.276) (-426.006) [-427.345] (-431.104) * (-429.166) (-427.249) [-427.448] (-431.078) -- 0:00:17
716000 -- (-425.165) [-426.234] (-426.408) (-436.507) * (-425.183) (-426.898) (-429.084) [-425.465] -- 0:00:17
716500 -- (-426.100) [-425.988] (-425.069) (-433.562) * (-427.040) (-425.475) [-425.958] (-425.196) -- 0:00:17
717000 -- [-427.837] (-427.014) (-427.418) (-427.873) * (-427.561) (-424.978) [-428.575] (-428.633) -- 0:00:16
717500 -- (-425.862) [-425.484] (-425.753) (-428.151) * (-429.508) (-424.538) [-424.718] (-429.880) -- 0:00:16
718000 -- (-425.425) (-426.740) (-425.618) [-426.182] * (-427.109) (-426.630) (-427.389) [-426.870] -- 0:00:17
718500 -- [-427.957] (-426.390) (-425.440) (-429.675) * (-425.108) (-427.179) (-424.769) [-425.836] -- 0:00:17
719000 -- (-430.112) (-426.518) [-426.378] (-429.167) * (-426.718) (-426.122) [-426.919] (-426.436) -- 0:00:17
719500 -- (-428.461) (-425.680) (-426.624) [-425.847] * (-424.494) [-425.412] (-427.346) (-426.671) -- 0:00:17
720000 -- (-428.434) [-425.274] (-424.795) (-425.658) * (-427.738) (-430.022) [-425.341] (-426.362) -- 0:00:17
Average standard deviation of split frequencies: 0.006541
720500 -- [-428.560] (-425.559) (-427.570) (-425.272) * (-426.239) (-427.041) (-429.221) [-425.426] -- 0:00:17
721000 -- (-426.739) (-426.337) [-426.426] (-426.710) * (-425.744) (-427.678) (-425.304) [-426.156] -- 0:00:17
721500 -- (-427.378) [-429.258] (-427.451) (-426.502) * (-428.045) (-426.232) [-425.669] (-427.506) -- 0:00:16
722000 -- (-430.223) (-426.865) (-425.324) [-430.910] * (-428.832) (-428.937) [-427.625] (-425.693) -- 0:00:16
722500 -- [-426.766] (-430.909) (-428.264) (-425.809) * (-427.905) [-426.613] (-427.706) (-427.600) -- 0:00:16
723000 -- (-430.028) (-427.871) [-429.475] (-427.527) * (-428.624) (-425.082) (-426.859) [-429.168] -- 0:00:16
723500 -- (-428.551) [-426.148] (-427.097) (-425.738) * [-425.535] (-425.256) (-426.604) (-428.759) -- 0:00:16
724000 -- (-429.221) (-426.096) (-429.873) [-427.294] * [-426.891] (-427.982) (-425.100) (-432.484) -- 0:00:16
724500 -- [-426.745] (-426.628) (-434.264) (-427.620) * (-427.596) [-426.692] (-425.281) (-426.698) -- 0:00:16
725000 -- (-428.725) [-424.906] (-428.794) (-427.824) * (-428.839) (-429.555) (-426.605) [-428.217] -- 0:00:16
Average standard deviation of split frequencies: 0.006615
725500 -- (-427.150) [-426.549] (-428.354) (-425.376) * (-428.185) (-427.168) (-425.507) [-427.096] -- 0:00:16
726000 -- (-426.786) (-426.820) [-426.926] (-431.687) * (-427.187) [-428.180] (-425.688) (-426.621) -- 0:00:16
726500 -- (-425.991) (-432.951) [-424.941] (-428.586) * [-426.702] (-426.341) (-425.816) (-426.495) -- 0:00:16
727000 -- (-431.436) (-425.777) (-426.514) [-430.371] * (-426.965) (-431.293) [-424.810] (-425.773) -- 0:00:16
727500 -- (-425.365) [-425.827] (-431.826) (-429.386) * (-428.203) (-428.164) [-426.374] (-426.124) -- 0:00:16
728000 -- (-425.462) [-425.278] (-428.928) (-428.713) * (-427.125) (-426.669) (-425.652) [-427.600] -- 0:00:16
728500 -- (-425.752) (-425.099) [-425.756] (-426.686) * (-426.359) [-429.059] (-425.684) (-424.884) -- 0:00:16
729000 -- (-426.120) (-426.719) [-425.646] (-424.898) * (-428.543) [-428.689] (-424.522) (-427.410) -- 0:00:16
729500 -- [-428.452] (-427.109) (-426.394) (-425.871) * [-425.975] (-425.235) (-425.061) (-427.430) -- 0:00:16
730000 -- (-425.674) (-426.924) (-427.766) [-426.312] * [-425.770] (-424.645) (-426.165) (-427.176) -- 0:00:16
Average standard deviation of split frequencies: 0.006492
730500 -- (-428.063) (-428.147) (-430.078) [-426.132] * (-427.893) (-426.984) [-428.241] (-426.443) -- 0:00:16
731000 -- (-428.122) [-426.281] (-425.215) (-426.884) * [-427.849] (-424.971) (-425.610) (-427.515) -- 0:00:16
731500 -- (-432.347) [-426.706] (-425.223) (-426.984) * (-427.563) (-427.065) (-425.892) [-426.004] -- 0:00:16
732000 -- (-432.367) (-426.713) [-428.115] (-428.202) * [-427.130] (-427.955) (-432.378) (-424.632) -- 0:00:16
732500 -- (-428.689) [-426.284] (-426.022) (-428.666) * (-425.936) [-427.781] (-426.677) (-426.363) -- 0:00:16
733000 -- [-427.610] (-425.864) (-427.585) (-428.476) * (-427.571) (-428.239) [-427.117] (-426.429) -- 0:00:16
733500 -- (-428.354) (-425.457) [-428.502] (-426.758) * (-429.204) (-430.885) (-428.682) [-424.752] -- 0:00:15
734000 -- (-425.784) [-425.267] (-430.028) (-424.766) * (-427.399) (-429.411) [-431.202] (-425.458) -- 0:00:15
734500 -- (-428.639) (-428.090) (-428.902) [-427.902] * (-431.148) (-427.239) (-428.637) [-425.743] -- 0:00:16
735000 -- (-428.244) [-427.746] (-424.968) (-425.690) * (-434.234) (-428.279) [-430.464] (-426.305) -- 0:00:16
Average standard deviation of split frequencies: 0.006485
735500 -- (-429.333) (-427.632) [-424.781] (-430.016) * (-426.259) [-425.396] (-426.010) (-426.785) -- 0:00:16
736000 -- (-428.155) (-425.446) [-426.255] (-426.249) * (-428.398) (-432.167) (-428.543) [-425.259] -- 0:00:16
736500 -- [-424.699] (-426.880) (-426.401) (-427.670) * (-430.915) [-425.602] (-425.976) (-427.276) -- 0:00:16
737000 -- (-427.540) [-426.907] (-430.966) (-425.145) * (-425.098) [-427.986] (-427.676) (-427.259) -- 0:00:16
737500 -- (-427.107) (-426.894) [-429.327] (-427.260) * (-428.332) [-429.571] (-425.030) (-429.026) -- 0:00:16
738000 -- [-426.395] (-426.659) (-427.025) (-430.736) * [-427.161] (-428.896) (-428.270) (-429.220) -- 0:00:15
738500 -- [-428.631] (-427.276) (-428.867) (-425.077) * (-429.540) (-426.521) (-426.305) [-426.676] -- 0:00:15
739000 -- [-426.436] (-426.584) (-426.744) (-428.666) * (-426.839) (-426.020) [-426.313] (-428.482) -- 0:00:15
739500 -- [-427.516] (-426.192) (-429.018) (-426.742) * (-426.675) [-426.012] (-430.729) (-426.926) -- 0:00:15
740000 -- [-427.447] (-427.634) (-427.347) (-428.710) * (-428.458) [-427.440] (-427.182) (-424.852) -- 0:00:15
Average standard deviation of split frequencies: 0.006842
740500 -- [-426.329] (-425.989) (-425.913) (-427.741) * [-427.775] (-427.387) (-428.700) (-426.227) -- 0:00:15
741000 -- (-428.202) [-431.742] (-425.396) (-426.184) * (-426.324) [-425.657] (-425.683) (-434.428) -- 0:00:15
741500 -- (-426.376) [-427.222] (-426.834) (-427.462) * (-430.218) (-424.714) (-429.973) [-427.815] -- 0:00:15
742000 -- (-426.235) [-426.558] (-426.184) (-426.477) * [-427.915] (-426.292) (-426.442) (-429.793) -- 0:00:15
742500 -- (-426.152) (-425.990) (-426.587) [-425.213] * (-427.263) (-426.125) [-425.158] (-427.337) -- 0:00:15
743000 -- (-424.806) (-426.209) (-428.480) [-428.133] * (-427.148) (-429.590) [-425.723] (-425.611) -- 0:00:15
743500 -- (-426.488) (-426.448) (-429.889) [-428.414] * [-424.779] (-425.911) (-425.923) (-427.229) -- 0:00:15
744000 -- [-427.882] (-425.271) (-426.879) (-426.302) * (-424.781) (-427.402) (-426.200) [-427.749] -- 0:00:15
744500 -- (-427.976) (-429.278) [-426.808] (-426.565) * (-425.661) (-426.095) [-426.600] (-429.252) -- 0:00:15
745000 -- (-430.319) (-430.200) [-428.558] (-425.991) * (-429.502) [-425.268] (-425.831) (-427.495) -- 0:00:15
Average standard deviation of split frequencies: 0.006517
745500 -- (-427.694) [-425.147] (-426.578) (-427.806) * (-426.173) (-429.760) [-426.512] (-425.152) -- 0:00:15
746000 -- (-426.793) [-427.799] (-426.298) (-431.016) * (-428.567) [-426.387] (-429.523) (-426.492) -- 0:00:15
746500 -- (-427.660) (-427.175) [-426.132] (-428.185) * (-428.154) [-424.908] (-425.445) (-426.612) -- 0:00:15
747000 -- (-427.039) [-426.775] (-427.742) (-427.227) * (-426.851) (-424.856) [-425.898] (-426.974) -- 0:00:15
747500 -- [-430.663] (-427.518) (-425.751) (-426.211) * (-425.727) (-425.881) [-428.993] (-426.699) -- 0:00:15
748000 -- (-425.435) (-428.194) [-429.315] (-425.694) * (-426.670) [-428.560] (-426.201) (-425.923) -- 0:00:15
748500 -- [-425.479] (-426.937) (-429.766) (-425.499) * [-426.859] (-426.495) (-426.937) (-425.483) -- 0:00:15
749000 -- [-427.774] (-427.984) (-426.069) (-425.408) * (-425.431) (-425.436) [-428.722] (-425.535) -- 0:00:15
749500 -- (-426.294) [-426.849] (-428.683) (-427.814) * (-425.965) [-425.282] (-426.998) (-427.988) -- 0:00:15
750000 -- (-426.171) (-430.027) (-429.268) [-425.982] * (-427.484) [-424.838] (-424.624) (-426.083) -- 0:00:15
Average standard deviation of split frequencies: 0.006672
750500 -- (-425.796) (-428.172) (-425.386) [-426.578] * [-426.951] (-427.071) (-425.711) (-428.021) -- 0:00:15
751000 -- (-427.522) [-426.732] (-426.691) (-428.723) * [-424.788] (-426.127) (-427.652) (-426.744) -- 0:00:15
751500 -- (-430.068) (-433.350) (-426.729) [-429.922] * (-425.909) [-425.428] (-429.444) (-426.356) -- 0:00:15
752000 -- (-425.003) (-427.096) [-427.829] (-424.584) * (-427.140) (-427.104) (-430.459) [-425.978] -- 0:00:15
752500 -- (-426.911) (-429.088) [-425.887] (-424.568) * (-429.811) (-430.310) [-426.005] (-425.091) -- 0:00:15
753000 -- (-425.088) (-428.412) (-425.495) [-426.481] * (-425.815) (-424.850) [-429.672] (-425.999) -- 0:00:15
753500 -- (-424.770) [-428.602] (-425.971) (-426.888) * (-426.085) (-427.448) [-425.457] (-426.135) -- 0:00:15
754000 -- (-431.684) (-426.050) [-425.370] (-431.296) * [-425.382] (-427.477) (-428.702) (-425.574) -- 0:00:15
754500 -- [-426.614] (-426.429) (-426.576) (-425.779) * (-431.178) [-427.038] (-426.930) (-431.345) -- 0:00:14
755000 -- (-427.669) (-426.139) [-424.912] (-426.721) * (-434.193) [-427.477] (-426.857) (-438.451) -- 0:00:14
Average standard deviation of split frequencies: 0.006277
755500 -- [-430.160] (-429.241) (-430.858) (-426.114) * (-426.323) (-425.426) [-427.253] (-434.572) -- 0:00:14
756000 -- (-425.132) [-424.816] (-430.740) (-427.529) * (-427.375) (-426.601) [-425.408] (-427.920) -- 0:00:14
756500 -- (-425.675) [-424.956] (-427.898) (-430.730) * (-427.274) [-426.137] (-425.483) (-425.761) -- 0:00:14
757000 -- [-425.032] (-426.489) (-426.462) (-428.325) * (-428.136) (-426.126) (-424.959) [-425.148] -- 0:00:14
757500 -- [-424.995] (-426.989) (-428.854) (-429.112) * (-427.306) (-424.593) (-426.806) [-428.213] -- 0:00:14
758000 -- (-426.186) (-425.857) (-432.588) [-425.388] * (-428.192) [-426.585] (-426.529) (-427.178) -- 0:00:14
758500 -- (-426.593) (-427.676) [-427.504] (-425.208) * [-425.241] (-432.209) (-428.413) (-427.789) -- 0:00:14
759000 -- (-427.492) (-428.740) [-424.828] (-427.125) * (-424.826) (-428.571) (-429.256) [-426.782] -- 0:00:14
759500 -- (-425.750) [-426.752] (-425.165) (-428.659) * (-427.396) (-428.433) [-427.628] (-425.362) -- 0:00:14
760000 -- (-425.882) (-427.028) [-425.430] (-433.243) * (-424.996) (-426.250) (-430.294) [-425.030] -- 0:00:14
Average standard deviation of split frequencies: 0.006239
760500 -- [-427.653] (-427.042) (-424.971) (-425.369) * (-425.332) (-425.950) [-425.231] (-427.470) -- 0:00:14
761000 -- [-426.911] (-428.896) (-425.793) (-426.682) * (-426.569) (-427.062) (-425.209) [-428.967] -- 0:00:14
761500 -- [-426.192] (-430.852) (-426.174) (-426.598) * (-427.107) [-431.891] (-424.928) (-427.419) -- 0:00:14
762000 -- (-428.292) [-425.925] (-425.857) (-427.845) * [-426.138] (-427.530) (-425.041) (-425.819) -- 0:00:14
762500 -- (-429.320) [-425.782] (-426.432) (-428.839) * (-426.820) (-427.957) (-425.587) [-426.141] -- 0:00:14
763000 -- (-426.322) [-426.442] (-426.455) (-425.653) * (-429.459) (-426.119) (-426.494) [-426.649] -- 0:00:14
763500 -- (-428.766) (-429.308) (-427.449) [-426.065] * [-425.783] (-426.573) (-427.559) (-426.057) -- 0:00:14
764000 -- (-426.912) [-426.283] (-428.019) (-427.649) * (-426.452) (-429.613) (-427.416) [-424.793] -- 0:00:14
764500 -- (-425.632) [-429.300] (-428.488) (-428.717) * (-424.983) (-427.386) (-425.983) [-424.709] -- 0:00:14
765000 -- (-426.545) [-429.039] (-428.727) (-430.579) * [-427.059] (-424.454) (-426.532) (-425.541) -- 0:00:14
Average standard deviation of split frequencies: 0.006423
765500 -- (-425.749) (-430.408) (-426.922) [-428.602] * (-432.401) (-427.653) [-426.172] (-427.580) -- 0:00:14
766000 -- [-424.934] (-430.745) (-427.529) (-425.651) * (-427.808) (-426.232) (-425.565) [-428.158] -- 0:00:14
766500 -- (-425.811) (-427.430) (-426.741) [-425.755] * (-428.535) (-429.271) (-426.688) [-429.186] -- 0:00:14
767000 -- (-428.081) (-428.912) (-427.716) [-425.573] * (-427.144) (-427.677) (-426.134) [-431.709] -- 0:00:14
767500 -- [-429.771] (-426.362) (-430.602) (-427.421) * (-429.444) (-429.789) [-426.645] (-426.827) -- 0:00:14
768000 -- [-429.350] (-428.848) (-427.859) (-427.132) * (-427.764) (-429.154) (-426.739) [-425.641] -- 0:00:14
768500 -- (-425.130) [-424.944] (-427.186) (-425.546) * (-427.044) (-427.615) (-429.179) [-425.413] -- 0:00:14
769000 -- [-425.741] (-425.355) (-429.571) (-426.430) * [-425.721] (-425.959) (-428.024) (-427.606) -- 0:00:14
769500 -- [-426.063] (-425.228) (-424.959) (-426.672) * (-427.905) (-426.263) (-426.003) [-427.386] -- 0:00:14
770000 -- (-428.508) (-424.879) [-425.835] (-425.268) * (-428.998) (-425.798) (-429.030) [-426.474] -- 0:00:14
Average standard deviation of split frequencies: 0.006614
770500 -- (-425.988) (-425.184) [-425.385] (-425.698) * (-428.239) (-427.852) (-429.880) [-426.419] -- 0:00:13
771000 -- (-429.172) (-425.865) (-425.035) [-425.759] * [-427.685] (-428.788) (-427.527) (-426.309) -- 0:00:13
771500 -- (-429.538) (-426.050) (-424.527) [-426.001] * [-428.279] (-425.716) (-425.868) (-427.953) -- 0:00:13
772000 -- (-426.092) [-425.444] (-427.589) (-429.238) * (-428.990) (-428.035) (-429.017) [-428.522] -- 0:00:13
772500 -- [-426.817] (-428.505) (-428.762) (-429.816) * (-425.093) (-427.384) (-428.032) [-426.892] -- 0:00:13
773000 -- (-429.461) [-425.022] (-427.302) (-429.746) * (-425.822) (-424.817) [-426.293] (-425.484) -- 0:00:13
773500 -- (-428.295) (-430.610) [-425.284] (-425.778) * (-427.588) (-426.367) [-427.544] (-428.299) -- 0:00:13
774000 -- (-425.766) (-432.190) (-426.998) [-425.074] * [-427.527] (-425.919) (-429.002) (-430.201) -- 0:00:13
774500 -- (-432.780) [-427.015] (-426.010) (-427.080) * (-428.037) [-424.880] (-430.667) (-429.173) -- 0:00:13
775000 -- (-430.295) (-427.863) [-425.509] (-430.421) * (-425.000) (-426.733) (-430.991) [-425.141] -- 0:00:13
Average standard deviation of split frequencies: 0.006492
775500 -- (-429.532) (-428.836) (-425.387) [-425.209] * (-427.131) (-428.149) (-426.615) [-429.423] -- 0:00:13
776000 -- (-426.687) (-429.315) (-426.707) [-424.779] * (-427.514) (-427.253) [-426.670] (-429.210) -- 0:00:13
776500 -- (-427.325) (-425.708) (-425.039) [-425.515] * (-428.428) (-426.826) (-431.117) [-427.322] -- 0:00:13
777000 -- (-428.097) (-425.781) [-428.586] (-427.861) * (-426.281) (-425.996) (-427.608) [-426.656] -- 0:00:13
777500 -- (-430.397) (-425.230) (-425.429) [-425.817] * (-428.657) [-426.314] (-429.581) (-426.206) -- 0:00:13
778000 -- (-427.258) (-425.344) (-425.243) [-425.106] * (-429.466) (-426.040) [-426.885] (-424.778) -- 0:00:13
778500 -- (-426.687) (-426.009) [-426.009] (-424.443) * (-428.715) (-425.111) (-430.596) [-428.396] -- 0:00:13
779000 -- (-430.665) [-427.343] (-425.846) (-429.480) * (-426.237) [-427.895] (-425.235) (-429.475) -- 0:00:13
779500 -- (-426.189) [-426.522] (-427.411) (-428.987) * (-426.138) (-426.858) [-425.440] (-427.373) -- 0:00:13
780000 -- (-425.231) [-426.578] (-425.030) (-428.612) * (-427.226) (-426.268) [-425.638] (-428.372) -- 0:00:13
Average standard deviation of split frequencies: 0.006378
780500 -- [-424.718] (-428.218) (-429.085) (-432.927) * (-425.881) (-426.368) (-425.506) [-425.805] -- 0:00:13
781000 -- (-428.170) (-428.931) [-428.574] (-426.598) * (-426.011) [-424.650] (-427.325) (-425.473) -- 0:00:13
781500 -- (-431.087) (-427.064) (-426.484) [-425.606] * (-425.852) (-425.082) (-427.883) [-425.673] -- 0:00:13
782000 -- [-429.537] (-433.483) (-425.149) (-428.228) * (-425.665) (-425.275) [-429.918] (-428.093) -- 0:00:13
782500 -- (-426.756) (-427.461) [-428.108] (-429.091) * (-425.068) (-426.105) (-426.621) [-426.330] -- 0:00:13
783000 -- (-426.028) [-429.509] (-429.897) (-427.652) * (-429.691) (-430.763) (-427.733) [-430.992] -- 0:00:13
783500 -- (-429.765) (-425.550) (-427.695) [-424.982] * (-424.765) [-430.607] (-429.588) (-426.678) -- 0:00:13
784000 -- (-426.307) (-426.996) [-426.738] (-425.790) * (-424.812) (-435.244) [-427.919] (-427.994) -- 0:00:13
784500 -- (-428.311) (-425.359) (-428.016) [-426.460] * (-427.102) [-424.412] (-426.335) (-428.439) -- 0:00:13
785000 -- (-427.860) (-427.477) [-427.672] (-427.463) * (-429.934) (-427.569) [-426.605] (-426.519) -- 0:00:13
Average standard deviation of split frequencies: 0.006522
785500 -- (-427.449) (-428.749) (-429.473) [-426.346] * (-427.906) (-426.814) (-427.518) [-427.540] -- 0:00:13
786000 -- (-428.311) [-426.366] (-432.190) (-428.640) * [-426.131] (-427.013) (-427.467) (-428.089) -- 0:00:13
786500 -- [-427.891] (-426.196) (-427.672) (-428.083) * (-427.713) (-427.165) [-427.241] (-429.816) -- 0:00:13
787000 -- (-425.364) (-429.609) [-424.485] (-427.566) * (-426.204) (-426.773) [-427.288] (-427.167) -- 0:00:12
787500 -- (-424.914) (-430.089) (-425.357) [-433.173] * [-427.523] (-426.427) (-426.108) (-426.829) -- 0:00:12
788000 -- (-425.897) [-427.347] (-425.248) (-434.290) * (-424.684) (-426.106) [-424.947] (-425.421) -- 0:00:12
788500 -- (-428.316) (-427.228) (-426.374) [-427.937] * (-424.709) [-427.023] (-427.779) (-429.960) -- 0:00:12
789000 -- [-428.371] (-429.320) (-427.073) (-425.444) * (-425.081) (-429.656) [-428.011] (-429.869) -- 0:00:12
789500 -- (-428.197) [-429.586] (-430.621) (-426.439) * (-425.015) [-427.582] (-427.332) (-426.985) -- 0:00:12
790000 -- (-424.628) (-433.948) [-425.179] (-428.552) * (-426.160) [-426.923] (-428.584) (-427.717) -- 0:00:12
Average standard deviation of split frequencies: 0.006596
790500 -- [-425.621] (-429.198) (-426.500) (-426.048) * (-425.195) [-427.020] (-432.314) (-426.783) -- 0:00:12
791000 -- (-426.391) [-426.350] (-428.643) (-427.081) * [-426.268] (-425.851) (-426.676) (-429.386) -- 0:00:12
791500 -- (-426.429) [-428.943] (-429.274) (-426.376) * [-427.719] (-428.553) (-424.480) (-425.633) -- 0:00:12
792000 -- (-425.113) [-426.058] (-426.804) (-428.523) * (-425.253) (-430.563) [-426.498] (-427.310) -- 0:00:12
792500 -- [-427.420] (-429.505) (-429.080) (-429.522) * (-426.115) (-426.003) (-425.241) [-426.654] -- 0:00:12
793000 -- (-427.236) (-426.828) [-425.440] (-430.446) * (-430.846) (-430.755) [-425.043] (-425.075) -- 0:00:12
793500 -- (-428.819) [-427.937] (-425.429) (-425.980) * [-426.837] (-432.392) (-425.555) (-429.492) -- 0:00:12
794000 -- (-425.183) (-428.717) [-427.011] (-426.445) * (-425.908) (-427.370) [-426.406] (-426.823) -- 0:00:12
