--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:47:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplU/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -426.07 -428.78
2 -426.08 -429.88
--------------------------------------
TOTAL -426.08 -429.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890360 0.088058 0.369499 1.487910 0.863325 1428.31 1464.65 1.000
r(A<->C){all} 0.177335 0.021563 0.000022 0.468229 0.139267 241.48 247.15 1.003
r(A<->G){all} 0.162645 0.018597 0.000023 0.446616 0.126906 225.44 229.18 1.013
r(A<->T){all} 0.159084 0.018157 0.000039 0.419760 0.123905 186.29 222.40 1.000
r(C<->G){all} 0.168732 0.019430 0.000017 0.445961 0.133844 167.76 245.67 1.000
r(C<->T){all} 0.176270 0.022272 0.000509 0.483223 0.136686 205.00 206.71 1.001
r(G<->T){all} 0.155935 0.018131 0.000001 0.424579 0.118945 226.10 233.09 1.000
pi(A){all} 0.255775 0.000608 0.208735 0.305712 0.255851 1309.16 1405.08 1.000
pi(C){all} 0.284099 0.000661 0.240210 0.340056 0.283462 1241.33 1340.68 1.000
pi(G){all} 0.274890 0.000612 0.226893 0.322496 0.274518 1369.16 1435.08 1.000
pi(T){all} 0.185235 0.000477 0.143932 0.229971 0.184731 1419.48 1460.24 1.000
alpha{1,2} 0.408928 0.216801 0.000140 1.340468 0.236217 1271.79 1312.80 1.000
alpha{3} 0.459584 0.246332 0.000116 1.486232 0.288680 1202.07 1223.50 1.000
pinvar{all} 0.994659 0.000047 0.981823 0.999999 0.996779 1043.15 1140.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -388.655683
Model 2: PositiveSelection -388.655674
Model 0: one-ratio -388.655743
Model 7: beta -388.655655
Model 8: beta&w>1 -388.65568
Model 0 vs 1 1.199999999244028E-4
Model 2 vs 1 1.8000000068241206E-5
Model 8 vs 7 4.999999998744897E-5
>C1
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C2
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C3
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C4
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C5
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C6
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
C1 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C2 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C3 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C4 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C5 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C6 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
**************************************************
C1 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C2 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C3 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C4 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C5 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C6 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
**************************************************
C1 GIK
C2 GIK
C3 GIK
C4 GIK
C5 GIK
C6 GIK
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3090]--->[3090]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.628 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C2 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C3 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C4 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C5 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
C6 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
**************************************************
C1 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C2 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C3 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C4 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C5 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
C6 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
**************************************************
C1 GIK
C2 GIK
C3 GIK
C4 GIK
C5 GIK
C6 GIK
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C2 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C3 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C4 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C5 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
C6 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
**************************************************
C1 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C2 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C3 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C4 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C5 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
C6 TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
**************************************************
C1 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C2 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C3 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C4 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C5 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
C6 AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
**************************************************
C1 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C2 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C3 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C4 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C5 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
C6 AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
**************************************************
C1 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C2 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C3 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C4 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C5 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
C6 CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
**************************************************
C1 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C2 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C3 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C4 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C5 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
C6 ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
**************************************************
C1 GGCATCAAG
C2 GGCATCAAG
C3 GGCATCAAG
C4 GGCATCAAG
C5 GGCATCAAG
C6 GGCATCAAG
*********
>C1
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C2
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C3
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C4
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C5
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C6
ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC
TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA
AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC
AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA
CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT
ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT
GGCATCAAG
>C1
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C2
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C3
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C4
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C5
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
>C6
MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
GIK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 309 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790802
Setting output file names to "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 464146562
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0897259577
Seed = 694830043
Swapseed = 1579790802
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -691.556816 -- -24.965149
Chain 2 -- -691.556816 -- -24.965149
Chain 3 -- -691.556816 -- -24.965149
Chain 4 -- -691.556816 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -691.556776 -- -24.965149
Chain 2 -- -691.556710 -- -24.965149
Chain 3 -- -691.556776 -- -24.965149
Chain 4 -- -691.556776 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-691.557] (-691.557) (-691.557) (-691.557) * [-691.557] (-691.557) (-691.557) (-691.557)
500 -- (-432.902) (-435.392) (-445.826) [-436.646] * (-439.804) (-433.193) (-434.759) [-438.243] -- 0:00:00
1000 -- (-434.644) [-432.544] (-435.700) (-433.473) * (-438.250) (-434.307) [-432.910] (-435.115) -- 0:00:00
1500 -- (-438.818) [-437.567] (-440.337) (-437.387) * (-445.991) (-435.307) [-431.835] (-431.327) -- 0:00:00
2000 -- (-433.041) (-433.473) [-432.488] (-430.646) * (-446.245) (-438.906) (-436.740) [-432.414] -- 0:00:00
2500 -- (-446.168) [-436.187] (-441.270) (-438.211) * (-430.240) (-445.195) [-435.933] (-436.016) -- 0:00:00
3000 -- (-436.094) (-440.753) [-440.929] (-431.701) * [-433.097] (-432.830) (-435.401) (-451.608) -- 0:00:00
3500 -- (-430.524) (-438.572) (-439.520) [-431.075] * (-443.358) [-435.297] (-431.930) (-431.933) -- 0:04:44
4000 -- (-435.339) (-428.953) [-437.107] (-438.706) * [-436.783] (-432.412) (-435.902) (-434.274) -- 0:04:09
4500 -- (-434.419) [-433.456] (-431.075) (-438.211) * (-433.414) (-437.790) (-442.189) [-432.685] -- 0:03:41
5000 -- (-441.895) (-435.800) (-432.193) [-431.453] * [-437.512] (-454.048) (-439.945) (-443.529) -- 0:03:19
Average standard deviation of split frequencies: 0.074826
5500 -- (-444.101) (-440.962) [-433.035] (-434.321) * (-431.983) (-445.389) [-438.972] (-435.679) -- 0:03:00
6000 -- [-433.525] (-438.303) (-433.092) (-438.604) * [-431.396] (-434.990) (-440.235) (-438.157) -- 0:02:45
6500 -- [-436.326] (-439.926) (-433.333) (-450.140) * [-436.640] (-433.982) (-436.943) (-442.331) -- 0:02:32
7000 -- (-436.894) [-436.077] (-443.773) (-434.885) * (-439.220) [-425.461] (-437.104) (-439.553) -- 0:02:21
7500 -- [-435.491] (-434.842) (-434.863) (-429.303) * (-431.475) (-425.818) (-442.212) [-434.837] -- 0:02:12
8000 -- [-428.366] (-445.908) (-440.290) (-431.526) * (-435.592) (-424.841) (-438.247) [-435.493] -- 0:02:04
8500 -- (-431.147) [-435.619] (-434.318) (-427.365) * (-431.184) (-430.253) (-430.472) [-430.868] -- 0:01:56
9000 -- (-435.672) (-456.631) (-445.197) [-427.905] * (-435.386) [-425.613] (-442.519) (-437.937) -- 0:01:50
9500 -- (-434.811) (-451.998) (-435.067) [-428.734] * (-438.151) (-425.896) (-432.529) [-432.628] -- 0:01:44
10000 -- [-439.171] (-439.558) (-430.791) (-426.185) * (-439.234) (-426.793) [-432.289] (-443.954) -- 0:01:39
Average standard deviation of split frequencies: 0.061381
10500 -- (-432.585) [-430.087] (-433.103) (-427.102) * (-435.576) (-427.109) [-433.631] (-445.788) -- 0:01:34
11000 -- [-435.137] (-429.364) (-434.864) (-426.869) * (-440.691) [-428.715] (-438.446) (-430.843) -- 0:01:29
11500 -- (-443.919) (-425.262) [-442.923] (-424.911) * [-441.943] (-429.205) (-436.646) (-426.157) -- 0:01:25
12000 -- (-437.166) (-425.903) (-440.191) [-429.543] * (-435.652) (-430.505) [-435.835] (-429.926) -- 0:01:22
12500 -- (-447.554) [-425.602] (-447.531) (-425.854) * [-431.275] (-425.140) (-431.217) (-425.139) -- 0:01:19
13000 -- [-437.346] (-428.836) (-438.022) (-427.867) * (-435.232) (-428.389) (-436.714) [-427.138] -- 0:01:15
13500 -- [-437.229] (-431.399) (-433.253) (-425.595) * (-435.021) (-427.730) (-439.354) [-427.394] -- 0:01:13
14000 -- (-443.960) [-425.546] (-438.370) (-425.493) * [-434.551] (-431.804) (-440.418) (-426.492) -- 0:01:10
14500 -- (-432.079) (-431.943) [-438.087] (-427.264) * (-441.341) (-429.001) (-440.952) [-426.550] -- 0:01:07
15000 -- (-437.818) [-427.940] (-440.425) (-428.429) * (-433.226) (-430.427) (-437.187) [-427.423] -- 0:01:05
Average standard deviation of split frequencies: 0.050741
15500 -- (-437.571) (-427.552) (-436.957) [-425.133] * (-434.668) (-432.124) (-440.361) [-430.009] -- 0:01:03
16000 -- (-440.579) (-429.237) (-438.947) [-425.684] * (-438.509) [-428.079] (-434.152) (-426.318) -- 0:01:01
16500 -- (-439.846) [-426.380] (-444.481) (-429.183) * (-431.755) (-425.434) (-443.339) [-426.523] -- 0:00:59
17000 -- (-439.757) (-427.728) [-433.309] (-429.720) * (-445.772) (-429.388) (-438.297) [-426.087] -- 0:00:57
17500 -- (-445.921) (-429.504) (-436.352) [-428.350] * (-439.583) (-430.306) [-431.252] (-435.975) -- 0:00:56
18000 -- [-435.969] (-426.557) (-438.606) (-431.778) * (-440.369) (-429.612) (-445.197) [-425.540] -- 0:00:54
18500 -- (-443.344) [-425.785] (-435.151) (-425.980) * (-440.645) (-426.344) (-442.143) [-424.842] -- 0:00:53
19000 -- (-435.141) (-428.689) (-438.760) [-425.880] * (-440.658) (-427.401) [-439.746] (-428.984) -- 0:01:43
19500 -- (-442.923) (-428.877) (-437.648) [-425.917] * [-433.041] (-428.133) (-438.722) (-425.611) -- 0:01:40
20000 -- [-444.668] (-428.650) (-436.251) (-425.510) * [-433.977] (-425.687) (-435.698) (-426.070) -- 0:01:38
Average standard deviation of split frequencies: 0.063361
20500 -- [-434.926] (-426.469) (-434.076) (-433.684) * [-436.706] (-427.683) (-439.974) (-427.456) -- 0:01:35
21000 -- (-438.292) (-426.763) (-435.904) [-427.721] * (-432.480) (-427.009) (-439.361) [-426.754] -- 0:01:33
21500 -- (-443.903) (-425.203) (-435.769) [-425.828] * (-437.403) (-428.075) [-435.900] (-427.181) -- 0:01:31
22000 -- (-442.453) (-427.793) [-430.754] (-435.227) * (-434.524) (-426.124) (-435.504) [-427.350] -- 0:01:28
22500 -- (-433.414) (-428.010) (-440.380) [-425.694] * (-434.077) (-424.451) [-425.224] (-428.228) -- 0:01:26
23000 -- (-435.082) (-426.429) [-431.455] (-425.259) * (-434.632) (-427.311) (-425.377) [-426.948] -- 0:01:24
23500 -- (-428.859) (-426.488) (-437.445) [-425.445] * (-437.486) (-427.673) (-426.854) [-427.805] -- 0:01:23
24000 -- (-425.828) (-425.134) (-455.237) [-426.426] * (-438.561) (-429.105) [-426.178] (-428.201) -- 0:01:21
24500 -- [-426.701] (-425.279) (-439.344) (-425.250) * [-432.443] (-428.817) (-425.748) (-426.401) -- 0:01:19
25000 -- [-427.339] (-431.645) (-435.577) (-426.347) * (-433.184) (-424.687) (-426.214) [-427.768] -- 0:01:18
Average standard deviation of split frequencies: 0.056301
25500 -- [-427.474] (-426.895) (-433.524) (-426.503) * [-429.179] (-428.307) (-426.573) (-425.478) -- 0:01:16
26000 -- (-426.984) (-427.057) (-430.782) [-425.435] * (-427.017) [-429.599] (-429.781) (-426.009) -- 0:01:14
26500 -- [-427.629] (-425.298) (-434.197) (-425.701) * [-428.998] (-425.874) (-436.789) (-425.684) -- 0:01:13
27000 -- (-425.555) [-425.437] (-434.610) (-432.315) * (-430.613) (-424.872) [-428.335] (-425.782) -- 0:01:12
27500 -- (-428.909) [-429.599] (-440.885) (-427.341) * (-426.022) [-427.448] (-427.675) (-425.079) -- 0:01:10
28000 -- (-426.554) [-429.020] (-441.200) (-430.922) * [-427.775] (-426.686) (-426.835) (-426.210) -- 0:01:09
28500 -- (-425.748) [-427.209] (-438.493) (-431.956) * (-426.335) [-427.889] (-428.044) (-429.926) -- 0:01:08
29000 -- (-425.855) [-425.823] (-440.670) (-426.762) * (-426.851) [-425.277] (-428.445) (-426.823) -- 0:01:06
29500 -- (-426.346) (-427.017) (-433.093) [-425.875] * (-424.926) [-426.278] (-431.955) (-426.651) -- 0:01:05
30000 -- (-425.552) (-428.132) (-433.504) [-424.842] * (-426.892) (-428.034) [-426.030] (-427.192) -- 0:01:04
Average standard deviation of split frequencies: 0.051240
30500 -- (-429.223) (-425.231) [-433.130] (-428.965) * (-426.122) (-425.166) [-425.929] (-425.447) -- 0:01:03
31000 -- (-427.020) [-426.354] (-434.595) (-425.693) * (-427.628) (-428.136) [-426.588] (-428.027) -- 0:01:02
31500 -- [-426.469] (-425.076) (-434.863) (-425.304) * (-426.282) [-425.031] (-427.119) (-430.321) -- 0:01:01
32000 -- (-426.817) (-426.355) [-433.125] (-426.946) * (-426.674) [-427.606] (-426.207) (-429.369) -- 0:01:00
32500 -- (-426.379) [-427.947] (-437.787) (-430.431) * [-425.217] (-427.609) (-427.986) (-425.439) -- 0:00:59
33000 -- [-427.806] (-426.884) (-435.401) (-431.143) * [-427.380] (-427.035) (-424.791) (-425.363) -- 0:00:58
33500 -- (-429.279) (-425.853) [-435.390] (-425.534) * (-427.049) (-429.965) (-432.347) [-425.304] -- 0:00:57
34000 -- (-426.772) (-431.627) (-432.265) [-427.286] * (-426.292) (-432.383) (-425.832) [-426.970] -- 0:00:56
34500 -- (-427.360) (-428.015) [-432.824] (-426.450) * (-426.526) (-428.327) (-427.307) [-433.614] -- 0:00:55
35000 -- (-427.000) (-426.104) [-436.421] (-427.064) * [-424.823] (-429.677) (-425.742) (-427.627) -- 0:01:22
Average standard deviation of split frequencies: 0.041351
35500 -- (-425.813) (-426.636) [-438.137] (-429.154) * (-424.723) [-427.666] (-434.824) (-425.873) -- 0:01:21
36000 -- (-428.475) (-427.286) [-434.929] (-426.968) * (-424.946) (-429.748) (-428.058) [-426.043] -- 0:01:20
36500 -- (-425.595) (-425.687) [-435.964] (-426.515) * [-429.268] (-427.196) (-425.537) (-429.089) -- 0:01:19
37000 -- [-426.503] (-426.137) (-432.439) (-432.364) * [-425.584] (-428.848) (-424.975) (-427.487) -- 0:01:18
37500 -- (-428.291) (-428.162) [-434.482] (-428.892) * (-425.243) (-426.363) [-425.862] (-428.266) -- 0:01:17
38000 -- [-425.813] (-428.996) (-433.544) (-430.067) * [-429.578] (-429.212) (-428.140) (-425.642) -- 0:01:15
38500 -- [-426.847] (-427.254) (-433.845) (-430.448) * (-428.149) [-428.753] (-426.389) (-425.905) -- 0:01:14
39000 -- [-426.728] (-427.380) (-446.836) (-430.741) * [-433.100] (-425.521) (-426.585) (-429.021) -- 0:01:13
39500 -- (-426.574) [-425.310] (-441.234) (-425.703) * [-426.829] (-426.059) (-426.098) (-426.257) -- 0:01:12
40000 -- (-427.005) (-426.842) [-433.581] (-427.203) * (-429.762) (-425.440) [-426.361] (-425.129) -- 0:01:12
Average standard deviation of split frequencies: 0.035996
40500 -- [-426.532] (-424.929) (-436.144) (-425.905) * (-426.661) [-425.222] (-426.580) (-427.896) -- 0:01:11
41000 -- (-429.177) (-427.305) (-438.639) [-427.583] * (-425.898) [-426.091] (-425.858) (-427.295) -- 0:01:10
41500 -- (-427.417) (-426.197) (-447.814) [-425.258] * [-426.324] (-427.056) (-425.055) (-428.733) -- 0:01:09
42000 -- (-428.997) [-426.250] (-442.182) (-425.427) * (-426.878) (-428.898) (-427.830) [-429.217] -- 0:01:08
42500 -- [-426.682] (-425.366) (-433.861) (-425.802) * [-427.011] (-433.050) (-426.745) (-426.957) -- 0:01:07
43000 -- (-429.051) [-425.482] (-440.977) (-426.630) * [-426.192] (-428.285) (-425.682) (-438.509) -- 0:01:06
43500 -- [-430.706] (-425.828) (-442.001) (-427.074) * (-434.568) [-425.730] (-425.496) (-427.917) -- 0:01:05
44000 -- (-426.661) (-430.791) [-441.057] (-425.372) * (-428.948) (-426.732) [-427.699] (-428.955) -- 0:01:05
44500 -- (-426.921) [-427.245] (-440.436) (-426.333) * [-426.469] (-426.241) (-425.742) (-427.662) -- 0:01:04
45000 -- (-425.286) (-428.729) [-432.649] (-424.933) * [-424.978] (-428.300) (-427.358) (-426.991) -- 0:01:03
Average standard deviation of split frequencies: 0.032793
45500 -- [-425.550] (-427.732) (-455.136) (-428.333) * (-427.257) [-427.931] (-426.047) (-427.185) -- 0:01:02
46000 -- (-426.649) (-429.990) (-428.792) [-425.322] * [-425.272] (-426.518) (-427.768) (-426.074) -- 0:01:02
46500 -- [-426.491] (-433.392) (-428.856) (-426.270) * (-425.442) (-428.073) (-426.041) [-426.594] -- 0:01:01
47000 -- [-428.528] (-427.170) (-430.953) (-427.464) * [-424.759] (-432.328) (-426.292) (-425.594) -- 0:01:00
47500 -- (-424.766) (-430.620) [-425.865] (-426.343) * (-426.516) (-427.475) (-426.688) [-427.367] -- 0:01:00
48000 -- (-425.481) (-431.320) (-425.672) [-427.216] * (-425.477) (-427.830) [-426.099] (-426.499) -- 0:00:59
48500 -- (-427.010) [-425.753] (-435.042) (-425.077) * (-425.550) [-427.208] (-426.154) (-426.293) -- 0:00:58
49000 -- (-424.791) [-424.507] (-426.081) (-425.606) * [-425.852] (-426.153) (-424.582) (-428.436) -- 0:00:58
49500 -- (-426.553) (-425.204) (-425.638) [-426.931] * [-425.233] (-427.566) (-435.548) (-426.849) -- 0:00:57
50000 -- (-426.470) (-424.988) [-427.812] (-429.547) * [-426.487] (-426.947) (-433.901) (-426.777) -- 0:00:57
Average standard deviation of split frequencies: 0.029773
50500 -- (-428.959) (-424.810) (-426.845) [-425.436] * (-425.959) (-426.399) (-435.225) [-428.329] -- 0:00:56
51000 -- [-429.716] (-428.888) (-427.110) (-428.269) * (-431.195) (-428.780) (-427.498) [-427.764] -- 0:01:14
51500 -- (-426.715) (-427.218) [-427.485] (-425.914) * [-425.710] (-427.132) (-426.839) (-427.668) -- 0:01:13
52000 -- (-426.371) (-426.034) [-424.703] (-427.071) * [-425.393] (-426.824) (-432.344) (-425.996) -- 0:01:12
52500 -- (-427.457) (-425.239) [-425.969] (-429.846) * (-425.066) (-427.191) (-426.033) [-425.940] -- 0:01:12
53000 -- (-427.814) (-424.793) [-427.558] (-426.254) * (-426.637) (-427.154) (-424.751) [-427.658] -- 0:01:11
53500 -- (-425.984) [-425.188] (-425.174) (-425.899) * (-424.993) (-428.004) [-426.347] (-425.302) -- 0:01:10
54000 -- (-425.924) (-425.724) (-427.228) [-426.104] * (-424.631) [-425.334] (-426.632) (-428.443) -- 0:01:10
54500 -- (-425.564) (-429.041) (-425.517) [-424.779] * (-428.340) (-425.480) [-427.294] (-426.949) -- 0:01:09
55000 -- [-425.487] (-427.431) (-425.683) (-427.334) * (-425.901) (-429.426) (-433.922) [-426.166] -- 0:01:08
Average standard deviation of split frequencies: 0.028621
55500 -- (-425.555) [-425.848] (-426.928) (-425.130) * (-428.644) (-425.961) [-428.004] (-426.311) -- 0:01:08
56000 -- [-426.530] (-430.388) (-430.050) (-426.588) * (-426.751) (-426.089) [-426.261] (-425.398) -- 0:01:07
56500 -- [-425.442] (-429.025) (-428.831) (-427.826) * [-427.168] (-431.645) (-429.477) (-427.054) -- 0:01:06
57000 -- [-426.307] (-426.189) (-426.543) (-426.621) * (-426.815) (-428.319) (-426.549) [-425.828] -- 0:01:06
57500 -- (-427.320) [-425.481] (-426.461) (-425.739) * [-425.443] (-429.583) (-425.100) (-425.386) -- 0:01:05
58000 -- (-429.113) [-426.268] (-428.181) (-425.343) * [-425.489] (-428.850) (-424.855) (-429.696) -- 0:01:04
58500 -- (-428.008) (-425.213) (-424.989) [-425.300] * (-430.810) (-428.413) (-426.354) [-426.665] -- 0:01:04
59000 -- (-428.597) (-429.330) [-427.667] (-425.310) * (-426.117) (-427.825) (-430.764) [-425.618] -- 0:01:03
59500 -- [-427.377] (-432.823) (-427.778) (-425.245) * (-425.470) [-428.406] (-426.939) (-425.304) -- 0:01:03
60000 -- (-426.376) (-427.928) (-427.381) [-425.432] * [-425.246] (-426.713) (-426.129) (-425.694) -- 0:01:02
Average standard deviation of split frequencies: 0.034578
60500 -- [-425.701] (-427.101) (-427.556) (-425.547) * (-425.902) [-425.842] (-428.249) (-425.825) -- 0:01:02
61000 -- (-432.860) [-427.065] (-425.162) (-425.234) * [-426.278] (-429.889) (-428.210) (-427.386) -- 0:01:01
61500 -- (-433.095) (-425.084) (-428.648) [-424.998] * (-425.846) [-429.766] (-425.476) (-428.330) -- 0:01:01
62000 -- (-428.676) [-425.612] (-425.593) (-429.435) * (-429.749) (-429.078) (-427.559) [-426.911] -- 0:01:00
62500 -- (-425.626) (-426.549) (-424.829) [-425.056] * (-426.252) (-426.314) [-427.110] (-426.324) -- 0:01:00
63000 -- (-424.983) [-427.955] (-426.081) (-425.551) * (-426.494) (-427.074) [-427.842] (-427.320) -- 0:00:59
63500 -- (-424.758) (-427.157) [-424.932] (-425.422) * (-428.020) [-426.019] (-425.187) (-427.220) -- 0:00:58
64000 -- (-426.136) (-425.821) [-426.135] (-429.206) * (-425.738) [-427.958] (-426.278) (-425.453) -- 0:00:58
64500 -- (-430.340) (-431.150) (-425.472) [-425.201] * (-429.266) [-426.859] (-433.192) (-425.001) -- 0:00:58
65000 -- (-425.775) [-424.532] (-425.024) (-426.826) * [-426.763] (-428.580) (-429.096) (-425.427) -- 0:00:57
Average standard deviation of split frequencies: 0.029284
65500 -- (-427.613) [-428.484] (-424.631) (-430.423) * (-427.311) (-429.297) [-426.534] (-429.645) -- 0:00:57
66000 -- [-427.601] (-429.035) (-425.839) (-430.259) * [-427.494] (-426.324) (-430.083) (-431.250) -- 0:00:56
66500 -- (-424.935) (-426.585) [-425.920] (-428.090) * (-427.085) (-428.627) [-427.336] (-429.262) -- 0:00:56
67000 -- (-426.162) (-430.590) (-425.936) [-430.510] * (-425.369) [-428.714] (-426.688) (-428.355) -- 0:00:55
67500 -- (-428.012) [-429.623] (-428.018) (-429.956) * (-427.296) (-426.100) (-428.175) [-424.763] -- 0:01:09
68000 -- (-426.088) [-428.403] (-438.038) (-426.708) * (-430.600) (-425.482) [-429.188] (-431.478) -- 0:01:08
68500 -- [-425.009] (-429.354) (-427.592) (-426.102) * (-429.198) [-425.750] (-426.299) (-427.220) -- 0:01:07
69000 -- (-426.951) (-425.878) [-427.570] (-428.866) * (-434.733) (-425.861) [-426.167] (-430.156) -- 0:01:07
69500 -- [-432.374] (-425.325) (-426.856) (-431.564) * [-426.045] (-425.848) (-428.926) (-426.751) -- 0:01:06
70000 -- (-434.560) (-427.642) [-429.686] (-428.769) * (-429.959) (-427.284) [-427.010] (-426.509) -- 0:01:06
Average standard deviation of split frequencies: 0.030178
70500 -- [-426.073] (-427.933) (-428.096) (-424.839) * (-426.430) [-430.583] (-425.493) (-428.274) -- 0:01:05
71000 -- (-425.815) (-425.976) [-425.704] (-425.655) * [-429.835] (-425.445) (-427.457) (-426.676) -- 0:01:05
71500 -- (-426.619) (-428.922) [-431.632] (-425.188) * (-426.628) (-426.770) (-426.157) [-427.995] -- 0:01:04
72000 -- [-424.920] (-427.162) (-425.872) (-425.279) * (-425.928) (-429.588) [-425.783] (-427.570) -- 0:01:04
72500 -- (-424.631) [-429.361] (-427.630) (-424.797) * [-427.957] (-428.051) (-426.244) (-427.593) -- 0:01:03
73000 -- (-428.873) [-424.887] (-431.122) (-425.776) * (-429.854) (-425.492) (-425.388) [-426.032] -- 0:01:03
73500 -- (-428.849) (-426.950) [-425.853] (-425.744) * (-431.853) [-425.601] (-427.008) (-425.662) -- 0:01:03
74000 -- (-427.939) (-425.012) (-426.859) [-426.654] * (-430.431) [-427.986] (-425.885) (-426.082) -- 0:01:02
74500 -- (-427.026) (-432.075) [-425.612] (-427.050) * (-427.384) (-426.091) (-425.784) [-426.909] -- 0:01:02
75000 -- (-426.725) (-426.053) (-427.060) [-427.725] * (-424.733) (-425.081) [-425.488] (-424.714) -- 0:01:01
Average standard deviation of split frequencies: 0.025137
75500 -- [-426.304] (-429.754) (-426.855) (-426.885) * (-426.748) (-427.396) [-426.275] (-427.618) -- 0:01:01
76000 -- [-426.055] (-427.690) (-425.199) (-426.222) * (-424.839) (-427.649) (-427.275) [-426.954] -- 0:01:00
76500 -- [-426.028] (-433.015) (-429.400) (-427.326) * [-425.528] (-426.576) (-426.796) (-428.769) -- 0:01:00
77000 -- [-425.508] (-430.336) (-425.886) (-426.432) * (-428.421) (-425.613) (-425.976) [-429.420] -- 0:00:59
77500 -- (-431.115) [-426.058] (-427.438) (-425.164) * (-426.317) (-426.225) [-425.273] (-426.280) -- 0:00:59
78000 -- (-424.689) (-425.904) (-436.462) [-426.028] * (-426.875) (-431.115) [-427.247] (-427.956) -- 0:00:59
78500 -- (-427.743) (-425.496) [-428.991] (-426.326) * [-426.528] (-430.503) (-427.918) (-426.962) -- 0:00:58
79000 -- (-426.291) (-425.271) [-427.915] (-429.928) * (-426.405) (-438.294) (-424.992) [-425.732] -- 0:00:58
79500 -- (-428.173) (-426.107) [-428.131] (-426.127) * [-427.350] (-425.359) (-427.124) (-424.945) -- 0:00:57
80000 -- (-426.251) (-425.337) [-427.384] (-426.386) * (-427.914) (-424.643) [-427.829] (-426.273) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-425.704) (-425.048) (-430.116) [-427.554] * (-434.956) [-429.673] (-426.095) (-426.048) -- 0:00:57
81000 -- (-427.786) [-425.978] (-426.591) (-426.526) * (-425.520) (-426.234) (-426.950) [-428.618] -- 0:00:56
81500 -- (-427.983) (-430.799) (-427.586) [-425.054] * [-428.417] (-425.819) (-425.722) (-426.684) -- 0:00:56
82000 -- (-425.680) (-434.050) (-426.176) [-426.814] * [-429.007] (-426.458) (-426.021) (-426.575) -- 0:00:55
82500 -- (-426.567) [-428.796] (-426.190) (-427.571) * (-430.195) [-429.570] (-428.114) (-427.319) -- 0:00:55
83000 -- (-427.230) (-426.690) [-425.057] (-430.093) * [-426.667] (-429.052) (-427.255) (-425.759) -- 0:00:55
83500 -- (-426.980) (-427.535) (-427.312) [-427.371] * (-426.915) [-430.743] (-425.960) (-426.539) -- 0:00:54
84000 -- (-426.569) [-429.204] (-427.324) (-425.595) * (-429.326) [-426.006] (-424.934) (-428.478) -- 0:01:05
84500 -- (-428.063) [-425.291] (-426.150) (-426.213) * (-426.819) [-426.154] (-430.210) (-430.134) -- 0:01:05
85000 -- (-429.694) (-425.671) [-427.753] (-426.560) * [-425.382] (-426.390) (-425.530) (-431.448) -- 0:01:04
Average standard deviation of split frequencies: 0.026542
85500 -- (-431.594) (-430.114) [-426.280] (-426.371) * (-433.441) (-428.976) [-425.265] (-425.849) -- 0:01:04
86000 -- (-424.417) [-425.717] (-428.069) (-425.768) * (-426.762) (-426.175) [-426.057] (-426.031) -- 0:01:03
86500 -- (-429.459) [-433.570] (-425.756) (-431.832) * (-428.384) [-427.539] (-431.347) (-425.363) -- 0:01:03
87000 -- (-432.787) (-425.881) (-426.122) [-428.105] * (-428.319) (-426.522) [-427.539] (-425.610) -- 0:01:02
87500 -- (-432.664) (-425.459) (-426.876) [-427.320] * (-425.915) (-426.333) [-427.766] (-426.766) -- 0:01:02
88000 -- (-430.682) [-425.560] (-428.590) (-426.884) * (-426.457) (-428.961) [-428.517] (-430.341) -- 0:01:02
88500 -- (-428.103) (-426.781) [-426.380] (-428.111) * (-428.587) (-426.619) [-426.073] (-427.533) -- 0:01:01
89000 -- (-426.162) [-425.371] (-428.951) (-431.304) * (-428.391) [-425.304] (-426.670) (-426.096) -- 0:01:01
89500 -- (-428.443) (-426.912) (-430.282) [-426.475] * (-426.686) [-428.094] (-426.141) (-426.252) -- 0:01:01
90000 -- (-425.947) (-426.542) [-430.156] (-426.674) * (-429.019) (-425.693) (-426.510) [-426.002] -- 0:01:00
Average standard deviation of split frequencies: 0.026270
90500 -- (-427.490) (-425.361) [-430.412] (-429.387) * (-426.518) (-425.529) [-425.540] (-426.289) -- 0:01:00
91000 -- (-429.800) (-427.936) (-427.963) [-425.332] * (-426.937) (-429.492) [-427.519] (-428.133) -- 0:00:59
91500 -- (-426.652) [-426.038] (-426.544) (-425.548) * (-427.920) (-427.383) [-429.021] (-433.984) -- 0:00:59
92000 -- [-427.795] (-424.856) (-428.089) (-429.096) * (-426.923) (-428.065) [-425.560] (-430.540) -- 0:00:59
92500 -- (-430.054) (-426.611) (-431.240) [-426.994] * (-425.563) (-425.929) [-425.642] (-428.226) -- 0:00:58
93000 -- [-427.524] (-427.189) (-429.710) (-427.924) * (-424.920) (-426.679) (-424.602) [-427.358] -- 0:00:58
93500 -- (-425.473) [-426.351] (-430.901) (-431.167) * (-426.253) (-426.054) (-425.883) [-426.293] -- 0:00:58
94000 -- (-425.724) (-430.164) (-425.307) [-427.276] * (-426.039) (-425.956) (-424.717) [-425.903] -- 0:00:57
94500 -- (-426.180) [-426.157] (-424.925) (-434.556) * (-428.031) (-426.483) [-428.538] (-424.902) -- 0:00:57
95000 -- (-426.896) [-425.871] (-426.126) (-429.425) * (-427.444) [-426.648] (-427.443) (-425.249) -- 0:00:57
Average standard deviation of split frequencies: 0.028946
95500 -- (-424.821) [-425.250] (-427.165) (-425.602) * (-424.665) [-427.175] (-430.023) (-428.314) -- 0:00:56
96000 -- (-424.979) (-425.392) (-426.438) [-426.688] * (-425.716) [-432.036] (-424.745) (-430.032) -- 0:00:56
96500 -- (-424.943) (-429.513) [-426.393] (-426.428) * (-425.467) [-425.785] (-426.419) (-427.211) -- 0:00:56
97000 -- (-425.372) (-429.522) (-427.889) [-425.687] * (-425.987) (-426.083) (-429.343) [-428.466] -- 0:00:55
97500 -- [-426.727] (-429.055) (-428.511) (-427.145) * (-427.184) (-425.748) [-428.325] (-428.594) -- 0:00:55
98000 -- [-429.872] (-426.070) (-425.744) (-430.142) * (-427.481) [-427.809] (-425.379) (-426.586) -- 0:00:55
98500 -- (-426.795) (-425.986) [-425.990] (-427.500) * (-426.357) (-426.206) (-426.212) [-425.722] -- 0:00:54
99000 -- [-424.742] (-425.949) (-425.339) (-427.733) * (-426.119) [-425.289] (-424.752) (-427.897) -- 0:00:54
99500 -- [-425.599] (-426.675) (-428.750) (-426.731) * [-425.099] (-430.481) (-425.458) (-432.261) -- 0:00:54
100000 -- [-425.231] (-427.269) (-427.143) (-425.738) * (-426.639) [-428.036] (-428.114) (-432.374) -- 0:00:54
Average standard deviation of split frequencies: 0.030808
100500 -- (-427.699) (-427.100) [-429.652] (-425.652) * (-427.419) [-429.145] (-434.087) (-425.538) -- 0:01:02
101000 -- (-428.917) [-424.714] (-429.226) (-426.620) * (-425.936) [-428.332] (-428.396) (-425.965) -- 0:01:02
101500 -- [-426.486] (-426.194) (-433.943) (-425.489) * [-426.518] (-427.055) (-426.310) (-426.307) -- 0:01:01
102000 -- (-426.485) (-429.549) (-431.071) [-426.880] * (-424.703) [-426.701] (-426.407) (-428.388) -- 0:01:01
102500 -- (-425.007) (-428.752) [-426.185] (-427.576) * (-426.447) (-426.219) [-426.656] (-427.323) -- 0:01:01
103000 -- (-425.671) (-429.529) (-429.154) [-426.420] * (-428.487) [-426.890] (-431.976) (-425.826) -- 0:01:00
103500 -- [-426.180] (-425.861) (-428.081) (-430.584) * (-430.274) [-426.244] (-426.696) (-425.449) -- 0:01:00
104000 -- [-426.211] (-425.305) (-427.310) (-427.142) * (-428.083) (-427.195) [-428.009] (-426.787) -- 0:01:00
104500 -- (-429.002) (-426.305) [-425.680] (-429.822) * (-427.127) (-429.349) [-427.618] (-426.512) -- 0:00:59
105000 -- (-426.004) (-425.373) [-425.844] (-430.141) * (-425.922) (-424.897) (-427.632) [-427.393] -- 0:00:59
Average standard deviation of split frequencies: 0.031130
105500 -- (-424.793) (-427.531) (-425.544) [-426.881] * (-427.454) (-427.257) [-427.147] (-425.087) -- 0:00:59
106000 -- (-424.827) [-426.301] (-427.246) (-424.891) * (-427.903) (-430.592) (-426.131) [-425.986] -- 0:00:59
106500 -- (-426.964) [-428.664] (-428.356) (-425.536) * [-424.613] (-433.139) (-426.536) (-426.641) -- 0:00:58
107000 -- (-428.576) (-427.874) [-426.591] (-427.082) * [-425.384] (-432.329) (-425.891) (-427.025) -- 0:00:58
107500 -- (-427.324) [-426.303] (-428.274) (-426.174) * (-432.145) [-426.020] (-428.610) (-424.848) -- 0:00:58
108000 -- (-426.071) (-427.571) (-425.025) [-426.607] * (-426.872) (-425.374) (-428.780) [-425.579] -- 0:00:57
108500 -- (-426.276) (-428.472) [-424.991] (-425.949) * (-427.677) [-429.731] (-426.041) (-424.987) -- 0:00:57
109000 -- (-425.539) (-426.751) [-425.702] (-433.842) * [-429.960] (-428.332) (-428.152) (-425.815) -- 0:00:57
109500 -- [-426.631] (-425.313) (-427.472) (-428.760) * (-426.399) [-427.079] (-427.609) (-428.333) -- 0:00:56
110000 -- [-426.818] (-428.185) (-427.582) (-427.303) * (-426.094) (-426.521) [-432.340] (-426.585) -- 0:00:56
Average standard deviation of split frequencies: 0.031835
110500 -- (-428.656) [-425.755] (-428.368) (-426.621) * (-426.070) (-425.669) (-425.812) [-424.807] -- 0:00:56
111000 -- (-426.997) [-426.840] (-427.348) (-428.964) * (-425.774) (-425.225) (-424.861) [-426.684] -- 0:00:56
111500 -- (-426.872) [-427.597] (-428.912) (-425.769) * (-429.483) [-426.866] (-426.832) (-426.363) -- 0:00:55
112000 -- [-426.242] (-425.947) (-427.517) (-426.599) * (-430.319) (-426.455) [-427.653] (-426.186) -- 0:00:55
112500 -- [-426.636] (-426.176) (-426.009) (-427.219) * (-427.719) [-429.309] (-427.968) (-428.051) -- 0:00:55
113000 -- (-427.305) (-427.085) (-425.792) [-425.226] * (-426.647) (-427.344) [-426.160] (-425.493) -- 0:00:54
113500 -- (-427.057) (-427.927) (-427.113) [-426.419] * [-427.011] (-430.256) (-426.241) (-425.291) -- 0:00:54
114000 -- (-426.739) (-428.850) (-430.201) [-427.567] * (-427.898) (-430.548) [-427.676] (-425.043) -- 0:00:54
114500 -- (-426.889) (-427.513) (-425.461) [-427.851] * (-427.420) (-430.722) [-428.948] (-429.521) -- 0:00:54
115000 -- (-425.358) (-428.448) [-426.109] (-428.613) * (-427.169) [-426.021] (-427.641) (-426.345) -- 0:00:53
Average standard deviation of split frequencies: 0.029516
115500 -- (-425.369) [-434.001] (-425.717) (-428.596) * (-428.856) (-426.947) [-427.155] (-426.812) -- 0:00:53
116000 -- (-424.720) [-428.586] (-426.214) (-425.946) * (-429.221) (-427.927) (-430.619) [-426.316] -- 0:00:53
116500 -- [-426.044] (-428.073) (-426.046) (-424.458) * [-424.842] (-429.918) (-428.972) (-425.438) -- 0:01:00
117000 -- (-426.955) (-428.359) (-433.066) [-424.989] * (-426.663) [-426.502] (-425.673) (-430.961) -- 0:01:00
117500 -- (-427.439) [-426.129] (-425.387) (-425.350) * (-426.469) (-426.600) [-426.261] (-427.254) -- 0:01:00
118000 -- (-426.334) (-428.532) [-425.689] (-426.554) * (-435.551) [-425.921] (-428.057) (-426.318) -- 0:00:59
118500 -- (-426.524) [-428.899] (-425.934) (-427.488) * (-432.429) [-427.643] (-427.896) (-431.348) -- 0:00:59
119000 -- (-426.368) (-428.910) [-424.915] (-427.100) * (-432.794) [-426.727] (-425.707) (-425.981) -- 0:00:59
119500 -- [-427.355] (-426.599) (-425.769) (-424.931) * (-427.335) (-428.789) (-426.501) [-425.660] -- 0:00:58
120000 -- (-427.606) (-426.415) (-425.700) [-426.257] * [-426.166] (-428.679) (-426.050) (-427.811) -- 0:00:58
Average standard deviation of split frequencies: 0.030842
120500 -- (-428.365) (-426.961) (-424.627) [-425.559] * (-427.480) [-424.589] (-428.001) (-426.059) -- 0:00:58
121000 -- (-427.088) (-427.631) [-427.188] (-428.594) * (-427.753) [-425.403] (-429.483) (-428.138) -- 0:00:58
121500 -- [-426.573] (-425.867) (-426.064) (-426.316) * (-427.155) [-427.013] (-425.219) (-426.305) -- 0:00:57
122000 -- (-428.693) (-424.495) [-425.713] (-429.673) * (-431.385) [-428.206] (-427.431) (-426.962) -- 0:00:57
122500 -- (-428.805) (-426.275) (-426.406) [-425.601] * [-425.168] (-427.442) (-426.184) (-426.438) -- 0:00:57
123000 -- (-427.508) [-427.364] (-428.820) (-426.321) * [-426.900] (-425.896) (-433.340) (-425.211) -- 0:00:57
123500 -- (-426.533) (-428.982) (-427.385) [-426.832] * (-426.464) (-428.042) (-426.880) [-425.813] -- 0:00:56
124000 -- [-426.566] (-429.390) (-428.797) (-426.811) * [-425.622] (-427.419) (-427.905) (-426.530) -- 0:00:56
124500 -- (-426.734) (-428.476) [-424.849] (-429.567) * (-431.203) (-428.001) [-432.009] (-425.482) -- 0:00:56
125000 -- (-433.501) (-427.652) [-426.742] (-424.652) * (-433.978) (-428.466) (-428.099) [-426.497] -- 0:00:56
Average standard deviation of split frequencies: 0.027568
125500 -- (-426.869) (-426.503) (-427.634) [-425.486] * [-432.995] (-427.129) (-428.951) (-425.141) -- 0:00:55
126000 -- (-429.683) [-425.500] (-428.176) (-426.324) * (-425.796) [-428.574] (-428.161) (-429.296) -- 0:00:55
126500 -- (-427.170) (-436.027) [-429.645] (-426.732) * (-425.246) (-428.648) (-427.559) [-427.693] -- 0:00:55
127000 -- [-425.016] (-424.969) (-429.344) (-424.833) * (-426.546) (-431.769) (-424.859) [-429.591] -- 0:00:54
127500 -- (-425.576) (-424.809) (-426.533) [-428.584] * (-425.160) [-427.259] (-425.813) (-431.102) -- 0:00:54
128000 -- (-429.052) (-427.843) [-425.999] (-427.364) * [-428.227] (-431.524) (-425.415) (-426.804) -- 0:00:54
128500 -- (-429.675) (-427.985) (-427.173) [-424.768] * (-428.626) (-425.310) [-427.606] (-429.607) -- 0:00:54
129000 -- [-429.691] (-430.454) (-427.747) (-426.799) * (-431.103) (-427.138) [-429.005] (-429.768) -- 0:00:54
129500 -- (-427.748) (-428.613) (-425.931) [-428.030] * (-424.781) (-426.376) (-426.327) [-431.831] -- 0:00:53
130000 -- (-427.751) (-428.679) [-424.722] (-427.319) * (-424.632) (-426.844) (-429.888) [-425.825] -- 0:00:53
Average standard deviation of split frequencies: 0.028102
130500 -- (-426.175) (-426.604) [-428.507] (-429.416) * (-426.917) (-428.150) [-428.481] (-427.125) -- 0:00:53
131000 -- (-426.983) (-426.489) [-427.788] (-427.362) * (-425.478) [-425.658] (-428.526) (-426.559) -- 0:00:53
131500 -- (-426.258) (-426.103) (-427.237) [-425.486] * [-425.689] (-428.023) (-427.368) (-424.520) -- 0:00:52
132000 -- (-426.213) (-428.879) (-426.387) [-426.420] * (-427.613) (-427.311) [-431.728] (-426.947) -- 0:00:52
132500 -- [-425.369] (-428.316) (-428.503) (-425.424) * (-430.027) [-426.802] (-426.436) (-425.862) -- 0:00:52
133000 -- (-428.806) (-427.034) [-427.357] (-424.428) * (-426.519) [-426.811] (-427.731) (-426.036) -- 0:00:52
133500 -- (-429.119) (-426.841) (-427.043) [-426.405] * (-426.286) (-425.644) (-425.365) [-428.986] -- 0:00:58
134000 -- [-427.559] (-426.908) (-427.920) (-425.609) * (-426.667) [-427.254] (-429.251) (-429.323) -- 0:00:58
134500 -- (-430.479) [-425.515] (-427.150) (-426.752) * (-428.110) (-427.076) [-425.880] (-426.179) -- 0:00:57
135000 -- [-427.089] (-424.948) (-426.759) (-429.972) * (-425.696) [-425.821] (-426.465) (-428.160) -- 0:00:57
Average standard deviation of split frequencies: 0.025804
135500 -- (-428.827) [-428.733] (-426.994) (-427.202) * (-429.190) (-427.473) (-427.140) [-431.090] -- 0:00:57
136000 -- [-429.060] (-428.429) (-429.250) (-425.749) * (-426.887) (-427.551) (-428.046) [-426.033] -- 0:00:57
136500 -- (-428.599) [-428.151] (-428.098) (-426.723) * [-427.178] (-427.325) (-426.164) (-426.171) -- 0:00:56
137000 -- (-431.577) (-430.233) [-427.189] (-427.810) * (-425.414) (-430.942) (-425.725) [-428.430] -- 0:00:56
137500 -- (-433.790) (-428.151) [-432.008] (-425.644) * (-425.526) (-426.911) [-424.778] (-427.222) -- 0:00:56
138000 -- (-424.560) (-427.166) [-431.205] (-425.994) * (-427.040) [-430.070] (-426.561) (-426.521) -- 0:00:56
138500 -- (-425.206) (-430.898) (-425.532) [-428.787] * (-428.557) (-428.072) (-425.728) [-427.052] -- 0:00:55
139000 -- [-426.351] (-430.272) (-426.931) (-428.066) * (-426.232) [-425.663] (-425.802) (-430.479) -- 0:00:55
139500 -- [-424.804] (-426.377) (-426.096) (-424.896) * [-426.288] (-427.744) (-424.884) (-428.668) -- 0:00:55
140000 -- (-425.619) (-428.462) [-428.238] (-425.151) * [-426.516] (-427.265) (-428.817) (-425.893) -- 0:00:55
Average standard deviation of split frequencies: 0.026810
140500 -- (-429.897) [-426.813] (-426.504) (-428.721) * (-425.065) [-426.279] (-434.218) (-427.888) -- 0:00:55
141000 -- (-426.878) (-426.696) (-428.894) [-425.153] * (-426.481) (-427.638) (-428.206) [-424.717] -- 0:00:54
141500 -- (-428.299) [-426.807] (-425.054) (-425.493) * (-427.497) (-428.556) (-424.994) [-427.319] -- 0:00:54
142000 -- [-425.166] (-426.353) (-428.363) (-429.358) * [-426.667] (-426.140) (-428.027) (-429.102) -- 0:00:54
142500 -- (-425.381) (-425.008) [-429.081] (-426.250) * [-425.850] (-428.781) (-426.745) (-426.290) -- 0:00:54
143000 -- (-426.444) (-428.551) (-428.881) [-427.949] * (-426.279) [-427.982] (-428.282) (-425.072) -- 0:00:53
143500 -- [-425.857] (-428.866) (-429.766) (-425.602) * (-430.851) (-432.533) (-427.505) [-424.874] -- 0:00:53
144000 -- (-429.272) (-432.328) (-425.728) [-427.022] * (-427.084) [-425.647] (-426.867) (-429.582) -- 0:00:53
144500 -- (-429.316) (-425.360) (-426.699) [-426.039] * [-425.587] (-432.991) (-427.957) (-428.852) -- 0:00:53
145000 -- (-428.052) (-426.708) (-426.384) [-426.781] * (-425.259) (-428.148) (-427.134) [-426.712] -- 0:00:53
Average standard deviation of split frequencies: 0.026727
145500 -- [-425.992] (-426.887) (-430.231) (-425.013) * [-427.401] (-432.254) (-427.360) (-425.348) -- 0:00:52
146000 -- (-426.293) (-425.817) [-426.542] (-425.564) * (-425.604) (-428.796) (-430.039) [-427.134] -- 0:00:52
146500 -- (-431.121) [-426.920] (-428.160) (-426.324) * [-425.980] (-430.117) (-425.322) (-427.579) -- 0:00:52
147000 -- (-426.539) (-426.739) [-426.930] (-428.775) * [-424.985] (-429.490) (-426.118) (-429.344) -- 0:00:52
147500 -- [-425.517] (-427.437) (-426.589) (-427.933) * (-426.173) (-428.027) [-425.942] (-426.022) -- 0:00:52
148000 -- (-426.195) [-425.991] (-430.944) (-427.793) * (-427.240) (-426.871) (-426.302) [-428.645] -- 0:00:51
148500 -- (-426.741) [-426.571] (-427.138) (-426.297) * (-428.663) (-426.753) [-426.987] (-428.553) -- 0:00:51
149000 -- (-425.566) [-425.497] (-439.421) (-429.018) * (-426.509) (-425.230) (-430.071) [-428.331] -- 0:00:51
149500 -- (-425.788) (-426.122) [-424.933] (-427.128) * [-428.642] (-425.561) (-425.214) (-429.660) -- 0:00:51
150000 -- (-424.649) (-428.357) (-429.949) [-427.044] * [-426.609] (-428.542) (-427.292) (-427.218) -- 0:00:56
Average standard deviation of split frequencies: 0.027290
150500 -- (-425.863) (-426.707) (-427.285) [-426.078] * (-427.191) (-428.046) (-427.208) [-428.457] -- 0:00:56
151000 -- [-428.670] (-425.125) (-425.095) (-425.608) * (-424.515) (-429.858) (-427.989) [-430.138] -- 0:00:56
151500 -- (-426.052) (-425.319) [-425.341] (-426.118) * (-427.968) (-429.111) [-425.524] (-427.904) -- 0:00:56
152000 -- (-429.409) [-424.832] (-427.990) (-428.128) * (-428.404) [-427.725] (-428.875) (-427.382) -- 0:00:55
152500 -- (-427.462) (-426.396) [-426.360] (-426.634) * (-425.743) (-430.784) (-430.024) [-425.709] -- 0:00:55
153000 -- (-428.766) [-425.400] (-426.034) (-425.287) * (-425.892) (-427.696) [-427.613] (-429.100) -- 0:00:55
153500 -- (-426.245) (-428.564) [-425.354] (-429.321) * (-425.889) [-424.949] (-427.898) (-427.114) -- 0:00:55
154000 -- (-429.192) [-426.943] (-425.281) (-428.137) * (-427.728) (-429.372) [-426.127] (-425.448) -- 0:00:54
154500 -- (-429.071) (-429.085) [-427.822] (-425.642) * (-428.612) [-426.555] (-425.903) (-425.583) -- 0:00:54
155000 -- (-427.330) (-434.851) [-430.791] (-424.748) * (-429.566) (-424.990) (-425.249) [-427.458] -- 0:00:54
Average standard deviation of split frequencies: 0.027029
155500 -- (-430.038) (-426.789) [-427.887] (-425.036) * [-426.289] (-425.265) (-425.239) (-427.885) -- 0:00:54
156000 -- (-431.384) (-427.634) (-427.551) [-428.710] * (-424.978) (-426.595) (-428.068) [-427.305] -- 0:00:54
156500 -- (-428.833) [-426.762] (-428.740) (-428.918) * [-425.302] (-426.720) (-428.567) (-428.562) -- 0:00:53
157000 -- (-426.671) (-427.929) (-426.893) [-428.703] * (-425.288) (-426.862) [-427.226] (-430.336) -- 0:00:53
157500 -- (-427.295) (-425.772) (-426.398) [-428.099] * (-424.921) [-424.677] (-427.448) (-428.746) -- 0:00:53
158000 -- (-427.094) (-428.096) (-429.219) [-429.175] * (-425.240) (-426.399) [-428.676] (-427.004) -- 0:00:53
158500 -- (-425.230) [-431.488] (-426.618) (-428.952) * (-427.313) (-426.445) [-425.426] (-425.290) -- 0:00:53
159000 -- (-426.060) [-427.974] (-426.380) (-427.171) * (-427.221) (-427.062) (-425.329) [-428.475] -- 0:00:52
159500 -- [-427.536] (-430.850) (-425.803) (-425.128) * (-426.956) [-425.550] (-425.226) (-426.361) -- 0:00:52
160000 -- (-429.065) (-424.676) [-428.632] (-426.133) * (-428.801) (-426.373) [-425.622] (-430.828) -- 0:00:52
Average standard deviation of split frequencies: 0.027615
160500 -- (-428.920) (-426.957) [-427.083] (-425.119) * (-427.759) (-426.415) (-425.692) [-424.946] -- 0:00:52
161000 -- [-427.550] (-426.376) (-428.742) (-430.260) * (-428.220) (-426.239) [-432.035] (-425.885) -- 0:00:52
161500 -- (-427.744) [-426.108] (-427.372) (-426.764) * [-428.145] (-428.247) (-427.584) (-425.744) -- 0:00:51
162000 -- [-426.266] (-426.901) (-425.459) (-426.057) * [-425.187] (-428.134) (-426.050) (-429.415) -- 0:00:51
162500 -- (-425.060) (-425.766) [-426.590] (-425.781) * (-424.449) (-427.861) (-426.300) [-428.419] -- 0:00:51
163000 -- (-425.499) (-427.930) [-428.918] (-427.178) * (-429.215) (-427.940) [-428.519] (-424.685) -- 0:00:51
163500 -- [-425.763] (-429.886) (-426.359) (-426.096) * (-428.031) [-425.307] (-436.715) (-431.003) -- 0:00:51
164000 -- (-426.267) (-427.357) [-425.107] (-425.401) * (-428.690) (-429.952) [-429.995] (-436.456) -- 0:00:50
164500 -- [-425.515] (-426.120) (-425.481) (-427.504) * (-428.765) (-426.440) [-425.913] (-425.564) -- 0:00:50
165000 -- (-424.628) [-429.565] (-427.125) (-428.863) * (-430.036) (-428.633) [-425.957] (-426.278) -- 0:00:50
Average standard deviation of split frequencies: 0.024927
165500 -- [-425.273] (-427.680) (-425.085) (-429.254) * (-425.183) [-426.080] (-426.108) (-425.907) -- 0:00:50
166000 -- [-424.729] (-425.940) (-425.349) (-425.370) * (-428.272) (-432.714) [-425.749] (-427.208) -- 0:00:50
166500 -- [-428.924] (-430.263) (-427.008) (-426.200) * [-426.153] (-426.956) (-426.152) (-429.972) -- 0:00:50
167000 -- (-425.478) (-429.681) (-426.104) [-431.259] * (-425.850) [-426.977] (-427.554) (-427.065) -- 0:00:54
167500 -- (-428.301) (-429.953) (-426.054) [-428.688] * (-427.365) (-428.618) [-424.743] (-426.645) -- 0:00:54
168000 -- [-427.575] (-429.593) (-425.329) (-426.948) * (-426.485) (-428.997) [-427.415] (-428.203) -- 0:00:54
168500 -- [-425.323] (-430.922) (-427.466) (-427.677) * [-425.139] (-425.838) (-424.851) (-428.375) -- 0:00:54
169000 -- (-425.833) (-424.986) [-425.183] (-429.040) * (-425.186) (-426.935) [-425.180] (-429.001) -- 0:00:54
169500 -- (-427.814) [-426.627] (-426.330) (-429.262) * (-425.750) (-427.114) (-427.031) [-427.778] -- 0:00:53
170000 -- (-425.650) (-425.946) (-428.656) [-425.159] * (-426.490) (-425.878) [-426.353] (-429.313) -- 0:00:53
Average standard deviation of split frequencies: 0.023478
170500 -- (-429.051) (-426.827) [-427.223] (-427.025) * (-427.053) [-425.987] (-426.628) (-428.776) -- 0:00:53
171000 -- [-425.197] (-426.573) (-428.474) (-431.408) * (-426.281) [-425.443] (-427.225) (-425.673) -- 0:00:53
171500 -- (-428.959) [-425.197] (-427.430) (-427.753) * (-427.186) (-429.898) [-429.630] (-426.092) -- 0:00:53
172000 -- (-427.044) (-425.949) [-426.088] (-426.925) * (-431.797) (-427.078) [-429.632] (-426.497) -- 0:00:52
172500 -- (-426.886) [-424.712] (-426.467) (-429.735) * (-431.544) (-427.242) [-430.859] (-427.054) -- 0:00:52
173000 -- (-428.520) (-426.336) (-426.334) [-432.760] * [-429.829] (-425.871) (-425.619) (-427.503) -- 0:00:52
173500 -- (-426.460) [-426.506] (-428.782) (-431.780) * (-426.002) (-426.969) (-425.850) [-426.163] -- 0:00:52
174000 -- (-427.348) (-429.320) (-427.163) [-427.719] * [-431.182] (-427.098) (-426.487) (-426.901) -- 0:00:52
174500 -- [-426.039] (-427.653) (-427.514) (-426.678) * [-430.113] (-428.339) (-425.429) (-426.211) -- 0:00:52
175000 -- (-426.099) (-429.003) [-429.192] (-428.827) * (-430.087) (-432.600) (-425.418) [-426.935] -- 0:00:51
Average standard deviation of split frequencies: 0.022058
175500 -- (-428.151) (-427.727) [-425.368] (-427.613) * (-430.402) (-427.857) (-425.890) [-425.812] -- 0:00:51
176000 -- (-425.700) (-428.627) [-429.635] (-427.031) * [-425.924] (-425.634) (-426.038) (-429.141) -- 0:00:51
176500 -- (-428.277) (-429.011) (-425.847) [-428.150] * (-427.901) (-429.717) (-424.557) [-428.345] -- 0:00:51
177000 -- (-427.148) [-430.554] (-425.342) (-426.317) * (-430.526) (-425.611) (-427.055) [-425.573] -- 0:00:51
177500 -- [-428.372] (-427.703) (-425.350) (-426.416) * (-426.654) (-424.928) (-425.985) [-428.028] -- 0:00:50
178000 -- (-425.213) [-424.582] (-426.687) (-425.967) * (-425.126) (-426.152) (-424.852) [-425.538] -- 0:00:50
178500 -- (-427.608) [-425.588] (-425.431) (-426.062) * [-428.250] (-424.990) (-425.218) (-426.303) -- 0:00:50
179000 -- (-426.089) (-425.581) (-428.120) [-427.578] * (-426.031) [-427.527] (-425.797) (-427.321) -- 0:00:50
179500 -- (-427.769) (-426.396) [-425.537] (-426.935) * [-427.455] (-431.324) (-425.804) (-426.374) -- 0:00:50
180000 -- [-425.850] (-426.025) (-426.636) (-426.595) * (-426.429) [-428.581] (-425.357) (-425.525) -- 0:00:50
Average standard deviation of split frequencies: 0.024558
180500 -- (-426.477) (-425.534) [-427.298] (-426.530) * [-429.436] (-426.450) (-427.484) (-427.146) -- 0:00:49
181000 -- [-425.017] (-426.582) (-425.884) (-428.000) * (-431.546) (-429.335) (-427.844) [-429.182] -- 0:00:49
181500 -- (-427.650) (-426.036) (-427.951) [-428.914] * (-427.126) (-425.316) [-426.156] (-425.030) -- 0:00:49
182000 -- (-426.839) [-429.042] (-428.292) (-429.378) * (-426.203) (-425.724) [-427.383] (-425.615) -- 0:00:49
182500 -- [-425.130] (-427.615) (-428.970) (-424.830) * (-427.367) (-425.379) [-429.656] (-427.575) -- 0:00:49
183000 -- (-425.972) (-425.835) [-426.525] (-426.329) * (-427.879) (-424.941) (-424.969) [-427.192] -- 0:00:49
183500 -- (-428.219) [-427.496] (-429.699) (-429.021) * (-431.748) (-431.096) [-424.644] (-426.305) -- 0:00:53
184000 -- (-425.779) (-426.659) [-430.660] (-428.819) * (-426.229) (-427.264) [-424.775] (-426.612) -- 0:00:53
184500 -- [-431.325] (-425.236) (-430.684) (-427.199) * [-429.400] (-427.386) (-427.451) (-426.296) -- 0:00:53
185000 -- (-428.121) [-425.720] (-427.654) (-428.849) * [-427.560] (-427.782) (-434.137) (-425.197) -- 0:00:52
Average standard deviation of split frequencies: 0.023077
185500 -- (-426.850) [-427.267] (-426.630) (-432.321) * [-429.730] (-426.877) (-428.768) (-426.228) -- 0:00:52
186000 -- [-427.189] (-424.773) (-424.725) (-428.979) * (-428.579) (-431.752) [-427.750] (-429.451) -- 0:00:52
186500 -- (-426.282) (-426.524) [-426.831] (-427.740) * [-425.754] (-429.317) (-425.834) (-427.857) -- 0:00:52
187000 -- (-425.305) [-426.878] (-427.463) (-426.062) * (-426.353) [-426.424] (-428.123) (-428.552) -- 0:00:52
187500 -- (-427.787) [-426.905] (-429.616) (-428.144) * (-425.835) (-428.717) (-425.478) [-428.792] -- 0:00:52
188000 -- (-427.380) (-427.748) [-427.629] (-424.651) * (-425.478) [-427.383] (-425.852) (-427.075) -- 0:00:51
188500 -- (-427.041) (-425.629) (-425.177) [-427.927] * (-428.220) [-428.181] (-427.354) (-425.970) -- 0:00:51
189000 -- (-424.996) (-425.304) [-428.652] (-431.604) * (-427.508) (-425.273) (-427.828) [-426.530] -- 0:00:51
189500 -- (-426.425) (-427.978) [-427.028] (-425.404) * (-428.825) [-426.261] (-424.959) (-431.018) -- 0:00:51
190000 -- (-426.677) (-425.496) [-429.851] (-428.030) * (-428.534) (-429.795) [-426.376] (-429.877) -- 0:00:51
Average standard deviation of split frequencies: 0.021379
190500 -- [-427.309] (-426.359) (-426.937) (-425.819) * (-425.047) (-428.970) [-428.524] (-426.941) -- 0:00:50
191000 -- (-426.670) [-426.661] (-427.910) (-425.215) * [-426.758] (-428.314) (-427.150) (-425.445) -- 0:00:50
191500 -- (-426.879) (-427.261) [-428.053] (-425.824) * (-425.984) (-432.067) (-427.081) [-426.081] -- 0:00:50
192000 -- [-427.764] (-427.817) (-425.450) (-427.649) * (-428.371) (-428.882) (-427.434) [-425.348] -- 0:00:50
192500 -- (-425.352) [-427.634] (-427.906) (-427.117) * [-426.510] (-430.849) (-427.951) (-429.962) -- 0:00:50
193000 -- (-426.438) [-426.677] (-430.225) (-429.030) * (-425.855) (-426.617) (-427.811) [-425.923] -- 0:00:50
193500 -- (-430.096) (-427.296) (-430.279) [-425.062] * (-428.051) [-425.154] (-432.054) (-431.177) -- 0:00:50
194000 -- (-428.082) (-427.737) (-426.191) [-427.088] * (-429.362) (-425.361) [-432.449] (-425.111) -- 0:00:49
194500 -- (-424.991) (-427.928) [-426.807] (-427.410) * [-426.987] (-428.242) (-429.331) (-427.703) -- 0:00:49
195000 -- [-426.118] (-428.040) (-426.581) (-429.036) * (-428.055) [-430.991] (-432.417) (-425.783) -- 0:00:49
Average standard deviation of split frequencies: 0.022354
195500 -- (-426.159) (-429.253) (-430.470) [-428.992] * (-426.729) [-428.860] (-429.334) (-428.521) -- 0:00:49
196000 -- [-425.755] (-429.311) (-428.076) (-425.829) * (-429.857) (-428.377) (-429.137) [-426.934] -- 0:00:49
196500 -- (-425.686) (-426.905) [-426.096] (-427.273) * [-427.128] (-428.958) (-427.358) (-427.830) -- 0:00:49
197000 -- (-431.527) [-426.853] (-429.811) (-427.774) * (-427.234) (-425.517) (-426.627) [-427.905] -- 0:00:48
197500 -- (-426.724) [-426.023] (-424.787) (-429.249) * (-427.061) (-426.279) [-427.667] (-425.385) -- 0:00:48
198000 -- [-426.282] (-427.258) (-425.089) (-425.973) * [-424.874] (-433.418) (-432.375) (-427.118) -- 0:00:48
198500 -- [-425.772] (-427.031) (-426.960) (-426.713) * (-425.048) [-426.923] (-425.958) (-426.527) -- 0:00:48
199000 -- (-426.766) [-428.211] (-427.484) (-428.318) * [-426.493] (-430.903) (-424.967) (-427.388) -- 0:00:48
199500 -- (-426.751) (-428.391) (-427.575) [-426.693] * (-425.052) [-429.083] (-425.531) (-427.495) -- 0:00:48
200000 -- (-425.171) [-426.032] (-425.840) (-425.782) * [-427.290] (-425.478) (-426.321) (-429.904) -- 0:00:48
Average standard deviation of split frequencies: 0.021695
200500 -- (-428.013) [-426.759] (-426.495) (-429.209) * [-426.242] (-427.476) (-425.985) (-428.598) -- 0:00:51
201000 -- (-427.486) [-426.700] (-426.168) (-425.194) * (-425.882) (-426.039) [-427.730] (-426.838) -- 0:00:51
201500 -- (-425.684) [-429.106] (-427.682) (-425.486) * [-426.253] (-428.630) (-428.056) (-426.559) -- 0:00:51
202000 -- (-426.893) (-427.816) (-427.484) [-425.720] * [-426.196] (-426.180) (-433.081) (-425.175) -- 0:00:51
202500 -- (-425.347) (-427.316) [-427.743] (-425.970) * (-425.528) (-426.260) (-426.017) [-427.862] -- 0:00:51
203000 -- (-432.432) (-428.821) [-428.573] (-426.087) * (-427.112) (-426.553) [-425.787] (-425.790) -- 0:00:51
203500 -- (-426.789) [-426.853] (-428.169) (-426.686) * (-427.372) (-426.315) (-426.246) [-426.382] -- 0:00:50
204000 -- (-425.596) [-426.968] (-427.485) (-426.658) * [-426.069] (-426.371) (-425.345) (-426.276) -- 0:00:50
204500 -- (-429.569) [-429.925] (-425.712) (-425.887) * (-426.691) [-428.332] (-424.685) (-426.017) -- 0:00:50
205000 -- [-426.238] (-425.554) (-426.855) (-427.895) * (-429.064) [-427.897] (-429.411) (-426.696) -- 0:00:50
Average standard deviation of split frequencies: 0.021994
205500 -- (-425.643) (-427.041) (-425.226) [-427.262] * (-425.289) [-426.058] (-427.318) (-426.275) -- 0:00:50
206000 -- [-424.762] (-429.071) (-424.561) (-426.710) * (-426.842) [-427.388] (-424.700) (-426.166) -- 0:00:50
206500 -- (-425.010) [-426.443] (-427.823) (-425.100) * (-426.269) (-429.016) (-426.926) [-428.634] -- 0:00:49
207000 -- (-425.993) (-427.105) [-428.106] (-425.649) * (-426.351) [-427.336] (-433.994) (-427.105) -- 0:00:49
207500 -- [-428.086] (-427.117) (-427.926) (-428.642) * (-427.217) (-427.171) [-427.314] (-426.313) -- 0:00:49
208000 -- (-424.942) [-424.421] (-424.647) (-430.898) * (-429.518) (-428.245) [-425.436] (-426.337) -- 0:00:49
208500 -- [-425.363] (-424.509) (-429.827) (-425.166) * (-431.046) (-428.406) [-428.676] (-425.657) -- 0:00:49
209000 -- (-424.789) [-431.405] (-424.806) (-425.332) * (-427.838) (-426.398) (-431.774) [-428.681] -- 0:00:49
209500 -- (-425.699) (-424.783) (-425.379) [-426.986] * [-426.398] (-428.833) (-436.483) (-427.116) -- 0:00:49
210000 -- [-431.380] (-432.956) (-425.320) (-426.854) * (-426.497) (-430.491) [-427.936] (-427.307) -- 0:00:48
Average standard deviation of split frequencies: 0.021382
210500 -- (-425.965) (-425.698) (-424.835) [-426.314] * (-425.151) [-430.490] (-426.237) (-429.454) -- 0:00:48
211000 -- (-425.978) (-429.462) (-425.428) [-425.146] * (-425.507) (-425.560) [-428.733] (-429.072) -- 0:00:48
211500 -- (-432.868) (-427.693) [-424.875] (-425.517) * (-425.600) (-424.786) [-425.136] (-427.382) -- 0:00:48
212000 -- (-428.141) (-429.123) [-426.838] (-429.199) * (-426.376) (-424.704) (-430.709) [-426.584] -- 0:00:48
212500 -- (-425.822) [-427.320] (-425.897) (-425.052) * (-427.505) [-429.829] (-426.725) (-425.000) -- 0:00:48
213000 -- (-425.307) (-427.644) (-429.762) [-430.394] * [-427.685] (-426.334) (-428.492) (-426.577) -- 0:00:48
213500 -- [-427.317] (-425.211) (-425.631) (-428.765) * [-429.478] (-428.329) (-427.404) (-428.905) -- 0:00:47
214000 -- (-429.065) (-425.864) (-432.407) [-427.187] * [-427.547] (-427.681) (-427.237) (-429.439) -- 0:00:47
214500 -- (-426.160) [-425.280] (-429.596) (-430.585) * (-429.105) [-425.918] (-429.702) (-428.500) -- 0:00:47
215000 -- (-425.749) (-427.655) [-425.089] (-427.210) * (-426.018) [-425.265] (-425.542) (-428.678) -- 0:00:47
Average standard deviation of split frequencies: 0.022338
215500 -- [-426.380] (-428.069) (-429.024) (-427.714) * [-427.132] (-424.926) (-424.968) (-426.705) -- 0:00:47
216000 -- [-427.370] (-429.053) (-427.577) (-425.105) * (-426.913) [-425.793] (-424.526) (-427.523) -- 0:00:47
216500 -- (-426.408) (-428.315) [-425.420] (-424.632) * (-424.805) (-426.909) [-426.849] (-427.439) -- 0:00:47
217000 -- (-424.944) [-426.591] (-427.563) (-425.101) * (-427.559) [-426.215] (-425.679) (-427.351) -- 0:00:46
217500 -- [-429.867] (-430.850) (-427.416) (-425.646) * (-431.337) (-425.651) [-431.286] (-426.220) -- 0:00:50
218000 -- (-427.352) (-425.551) [-426.691] (-425.032) * (-426.868) (-425.449) [-427.907] (-428.598) -- 0:00:50
218500 -- (-425.753) (-425.386) (-425.462) [-424.894] * [-425.626] (-424.658) (-426.893) (-429.729) -- 0:00:50
219000 -- (-425.093) (-426.675) (-427.536) [-426.024] * [-429.029] (-425.989) (-426.031) (-428.004) -- 0:00:49
219500 -- [-425.326] (-425.148) (-425.943) (-425.295) * (-425.664) (-424.943) [-428.628] (-432.255) -- 0:00:49
220000 -- [-426.574] (-427.437) (-427.580) (-424.716) * [-426.881] (-425.578) (-425.988) (-425.630) -- 0:00:49
Average standard deviation of split frequencies: 0.020860
220500 -- (-426.433) (-426.344) [-426.970] (-424.509) * (-425.442) [-425.732] (-426.510) (-425.869) -- 0:00:49
221000 -- (-424.752) (-425.142) [-429.177] (-425.098) * [-426.036] (-427.783) (-426.035) (-427.337) -- 0:00:49
221500 -- (-430.573) (-424.608) [-425.819] (-424.569) * (-426.739) (-427.402) (-426.653) [-430.507] -- 0:00:49
222000 -- (-425.227) (-429.128) (-426.203) [-425.886] * (-426.241) [-428.930] (-425.344) (-426.104) -- 0:00:49
222500 -- (-428.775) (-427.736) (-425.819) [-426.524] * [-429.172] (-424.687) (-424.921) (-426.568) -- 0:00:48
223000 -- [-425.037] (-425.526) (-428.409) (-426.381) * [-430.522] (-425.660) (-426.034) (-425.644) -- 0:00:48
223500 -- [-425.039] (-425.526) (-429.111) (-427.816) * (-428.162) (-428.923) [-425.757] (-425.273) -- 0:00:48
224000 -- (-427.563) (-431.754) [-428.064] (-425.698) * (-425.582) (-426.610) (-426.194) [-426.854] -- 0:00:48
224500 -- (-428.907) (-428.202) [-426.072] (-427.265) * (-425.720) (-430.232) (-426.859) [-425.372] -- 0:00:48
225000 -- [-427.068] (-425.904) (-425.938) (-424.880) * [-428.647] (-425.925) (-428.811) (-430.578) -- 0:00:48
Average standard deviation of split frequencies: 0.020368
225500 -- (-426.282) (-425.317) (-427.130) [-425.479] * (-429.255) [-424.689] (-432.950) (-428.795) -- 0:00:48
226000 -- (-425.738) (-428.094) (-427.587) [-428.570] * (-429.091) (-427.000) (-429.312) [-428.788] -- 0:00:47
226500 -- (-426.533) (-427.567) (-429.402) [-425.335] * (-426.191) [-426.925] (-427.067) (-425.775) -- 0:00:47
227000 -- (-427.150) [-430.399] (-431.959) (-425.613) * (-426.449) (-429.684) (-427.940) [-425.512] -- 0:00:47
227500 -- (-427.546) (-429.045) (-432.423) [-427.531] * [-424.552] (-427.226) (-426.936) (-425.828) -- 0:00:47
228000 -- (-425.386) [-425.152] (-424.769) (-427.485) * [-427.349] (-425.394) (-425.953) (-426.342) -- 0:00:47
228500 -- [-428.579] (-426.280) (-425.512) (-427.650) * (-428.382) (-430.091) [-428.026] (-425.924) -- 0:00:47
229000 -- (-427.554) [-426.059] (-429.287) (-426.974) * (-426.547) [-425.911] (-425.102) (-425.455) -- 0:00:47
229500 -- (-428.648) (-426.510) [-426.019] (-428.283) * (-426.373) (-426.143) [-425.469] (-428.145) -- 0:00:47
230000 -- (-428.459) (-424.900) (-428.627) [-427.329] * (-426.838) [-426.018] (-427.582) (-426.721) -- 0:00:46
Average standard deviation of split frequencies: 0.019715
230500 -- [-427.788] (-427.928) (-427.063) (-424.983) * [-427.494] (-425.081) (-425.153) (-425.991) -- 0:00:46
231000 -- [-425.253] (-426.169) (-428.187) (-425.021) * (-427.052) [-424.702] (-430.709) (-424.847) -- 0:00:46
231500 -- [-425.879] (-427.434) (-425.726) (-426.132) * (-425.917) [-425.405] (-426.270) (-425.077) -- 0:00:46
232000 -- [-426.802] (-426.870) (-429.185) (-427.275) * (-425.882) (-425.878) (-426.312) [-425.634] -- 0:00:46
232500 -- (-430.943) (-428.344) [-424.979] (-425.674) * (-427.901) [-427.425] (-426.802) (-427.632) -- 0:00:46
233000 -- (-426.701) (-426.764) (-425.080) [-425.917] * (-427.553) (-428.406) [-427.091] (-426.302) -- 0:00:46
233500 -- (-431.081) (-426.065) [-427.565] (-424.881) * [-428.517] (-425.495) (-427.248) (-427.029) -- 0:00:45
234000 -- (-427.882) [-426.933] (-426.416) (-427.608) * [-424.502] (-425.419) (-426.084) (-430.682) -- 0:00:49
234500 -- (-428.719) (-426.455) (-429.823) [-424.921] * (-426.823) [-430.309] (-427.798) (-425.865) -- 0:00:48
235000 -- (-430.405) (-427.562) (-427.149) [-425.321] * [-426.253] (-430.111) (-426.120) (-425.478) -- 0:00:48
Average standard deviation of split frequencies: 0.019864
235500 -- (-428.180) (-427.922) (-430.147) [-425.290] * (-427.997) [-425.632] (-425.680) (-426.836) -- 0:00:48
236000 -- (-426.688) (-426.636) (-425.961) [-426.451] * [-426.593] (-428.126) (-426.512) (-425.486) -- 0:00:48
236500 -- (-425.322) [-427.944] (-430.106) (-430.808) * (-427.309) (-426.865) [-427.790] (-427.020) -- 0:00:48
237000 -- [-426.187] (-426.199) (-428.700) (-427.331) * (-426.497) (-427.140) [-429.627] (-427.622) -- 0:00:48
237500 -- (-429.048) [-426.661] (-426.755) (-426.214) * (-427.409) (-428.370) [-427.869] (-428.283) -- 0:00:48
238000 -- (-427.324) [-426.757] (-425.925) (-425.465) * (-427.966) [-425.532] (-427.965) (-425.965) -- 0:00:48
238500 -- [-424.528] (-425.508) (-426.387) (-424.962) * (-427.369) (-431.025) (-428.658) [-425.161] -- 0:00:47
239000 -- [-427.290] (-427.056) (-426.443) (-425.075) * (-427.172) (-428.992) (-425.370) [-425.946] -- 0:00:47
239500 -- (-428.127) (-425.844) (-427.376) [-425.368] * [-427.279] (-427.709) (-432.362) (-428.637) -- 0:00:47
240000 -- [-427.326] (-427.086) (-425.716) (-425.652) * (-429.015) (-425.814) (-431.332) [-424.995] -- 0:00:47
Average standard deviation of split frequencies: 0.019043
240500 -- (-426.911) [-427.629] (-425.888) (-427.090) * [-426.265] (-425.418) (-424.794) (-427.659) -- 0:00:47
241000 -- (-427.532) (-429.093) (-428.699) [-425.157] * (-427.305) (-427.145) (-428.587) [-427.039] -- 0:00:47
241500 -- (-426.950) (-425.837) (-428.046) [-426.190] * (-426.218) (-426.535) (-426.772) [-429.764] -- 0:00:47
242000 -- (-429.338) (-429.775) [-427.240] (-429.870) * (-429.345) [-425.291] (-430.257) (-428.839) -- 0:00:46
242500 -- (-426.220) (-430.026) [-428.942] (-426.608) * (-429.267) [-425.668] (-426.452) (-428.394) -- 0:00:46
243000 -- [-427.638] (-430.432) (-427.386) (-430.405) * (-427.592) (-426.139) (-426.072) [-429.024] -- 0:00:46
243500 -- (-428.266) (-431.798) [-428.725] (-427.664) * (-426.092) (-427.468) (-430.980) [-425.685] -- 0:00:46
244000 -- (-426.225) (-429.315) [-427.130] (-426.069) * (-427.484) [-426.862] (-431.998) (-425.417) -- 0:00:46
244500 -- (-427.132) (-426.386) [-425.342] (-429.530) * (-427.367) [-425.552] (-428.768) (-428.909) -- 0:00:46
245000 -- (-429.618) (-429.015) (-428.199) [-432.516] * (-428.496) (-428.510) [-427.896] (-426.244) -- 0:00:46
Average standard deviation of split frequencies: 0.019264
245500 -- (-424.848) (-425.317) [-425.366] (-426.539) * (-425.902) (-428.489) [-426.325] (-427.877) -- 0:00:46
246000 -- (-425.935) (-428.273) (-427.542) [-425.826] * (-425.916) [-431.006] (-426.421) (-431.086) -- 0:00:45
246500 -- (-425.922) (-426.982) [-425.987] (-429.395) * (-426.723) (-425.545) [-425.745] (-427.902) -- 0:00:45
247000 -- (-425.849) (-426.153) (-426.113) [-425.785] * [-425.461] (-427.991) (-428.707) (-427.604) -- 0:00:45
247500 -- (-426.708) (-429.039) (-430.206) [-426.591] * (-427.040) [-425.545] (-427.919) (-426.662) -- 0:00:45
248000 -- (-427.126) (-430.758) (-425.819) [-427.032] * (-430.558) [-426.272] (-426.178) (-428.019) -- 0:00:45
248500 -- (-431.240) (-431.518) [-426.458] (-425.898) * (-428.327) (-427.261) [-426.410] (-425.572) -- 0:00:45
249000 -- [-425.433] (-427.314) (-428.178) (-429.925) * (-428.937) (-425.685) [-424.671] (-427.025) -- 0:00:45
249500 -- (-427.764) (-426.530) [-425.975] (-427.866) * (-425.564) (-426.165) (-426.001) [-427.832] -- 0:00:45
250000 -- [-429.121] (-424.999) (-427.585) (-426.302) * [-424.679] (-428.159) (-425.012) (-425.643) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-425.635) (-427.189) [-426.660] (-426.046) * (-425.773) (-426.334) [-425.177] (-429.504) -- 0:00:44
251000 -- [-425.452] (-425.732) (-425.601) (-431.421) * (-425.226) (-426.785) [-428.318] (-428.581) -- 0:00:47
251500 -- [-424.846] (-431.099) (-427.189) (-428.131) * (-426.671) [-429.460] (-427.473) (-426.862) -- 0:00:47
252000 -- (-426.161) [-425.738] (-426.052) (-426.727) * (-425.475) (-428.226) (-425.312) [-426.439] -- 0:00:47
252500 -- [-425.851] (-427.642) (-426.103) (-426.175) * [-426.029] (-424.936) (-425.585) (-427.378) -- 0:00:47
253000 -- (-425.670) (-427.248) (-426.041) [-426.402] * [-430.216] (-426.812) (-427.532) (-427.817) -- 0:00:47
253500 -- (-426.006) [-427.808] (-427.104) (-427.186) * (-428.997) (-427.825) [-431.247] (-428.234) -- 0:00:47
254000 -- (-428.053) [-425.969] (-427.105) (-426.800) * [-425.127] (-425.131) (-431.657) (-425.301) -- 0:00:46
254500 -- (-431.802) (-425.693) [-426.846] (-426.748) * (-424.657) (-426.200) [-427.404] (-425.656) -- 0:00:46
255000 -- [-425.572] (-429.384) (-430.232) (-428.298) * (-425.626) [-426.304] (-426.200) (-425.915) -- 0:00:46
Average standard deviation of split frequencies: 0.016880
255500 -- (-427.119) (-432.675) [-425.350] (-427.932) * (-430.981) [-428.060] (-425.422) (-426.630) -- 0:00:46
256000 -- (-426.702) (-427.286) [-427.717] (-426.243) * (-425.303) (-426.214) [-429.670] (-430.382) -- 0:00:46
256500 -- (-426.004) (-426.677) (-430.204) [-426.738] * [-425.162] (-429.176) (-427.304) (-430.749) -- 0:00:46
257000 -- (-426.256) (-427.051) [-427.084] (-426.538) * (-426.697) [-425.875] (-425.602) (-428.167) -- 0:00:46
257500 -- (-426.730) [-425.913] (-425.909) (-426.033) * (-425.752) [-426.427] (-426.115) (-427.246) -- 0:00:46
258000 -- (-426.492) (-425.661) (-425.971) [-425.311] * (-427.362) (-425.715) [-426.396] (-431.718) -- 0:00:46
258500 -- (-427.591) (-427.943) (-429.670) [-427.435] * [-427.587] (-429.387) (-426.253) (-429.492) -- 0:00:45
259000 -- (-425.554) (-425.258) [-427.496] (-427.402) * [-426.717] (-426.222) (-432.703) (-430.165) -- 0:00:45
259500 -- (-429.352) [-426.308] (-430.794) (-427.315) * (-430.308) (-426.677) (-430.810) [-426.984] -- 0:00:45
260000 -- [-426.685] (-425.893) (-427.700) (-426.399) * [-429.601] (-429.180) (-430.844) (-428.287) -- 0:00:45
Average standard deviation of split frequencies: 0.016778
260500 -- [-425.426] (-426.259) (-427.486) (-427.225) * (-429.010) [-427.194] (-434.541) (-428.237) -- 0:00:45
261000 -- (-425.468) [-429.594] (-425.024) (-427.749) * (-426.726) [-424.705] (-426.099) (-426.818) -- 0:00:45
261500 -- (-426.269) [-424.989] (-427.122) (-429.836) * (-428.902) (-425.323) (-426.921) [-425.671] -- 0:00:45
262000 -- (-429.852) [-426.738] (-433.663) (-427.580) * (-426.001) (-427.488) [-429.114] (-426.009) -- 0:00:45
262500 -- (-428.342) (-428.115) [-425.216] (-432.167) * (-425.956) [-431.495] (-426.946) (-428.936) -- 0:00:44
263000 -- (-426.823) [-426.501] (-428.535) (-426.663) * [-425.415] (-426.412) (-427.195) (-425.365) -- 0:00:44
263500 -- (-425.681) [-425.673] (-432.860) (-427.595) * (-427.554) (-427.928) [-427.378] (-426.238) -- 0:00:44
264000 -- (-426.206) (-426.217) (-433.458) [-425.537] * (-426.426) [-429.303] (-424.611) (-426.149) -- 0:00:44
264500 -- [-429.215] (-425.870) (-425.676) (-426.205) * (-425.532) (-430.495) [-427.269] (-425.648) -- 0:00:44
265000 -- [-426.030] (-426.929) (-428.841) (-425.006) * [-425.336] (-426.947) (-430.344) (-431.223) -- 0:00:44
Average standard deviation of split frequencies: 0.017328
265500 -- (-427.199) [-425.492] (-426.941) (-424.997) * (-432.803) (-425.051) [-426.903] (-425.205) -- 0:00:44
266000 -- (-427.137) [-425.146] (-427.334) (-426.384) * (-431.575) (-427.804) (-429.631) [-428.155] -- 0:00:44
266500 -- (-428.938) [-426.709] (-426.191) (-426.045) * (-427.971) (-428.854) [-425.435] (-428.580) -- 0:00:44
267000 -- (-428.342) (-427.378) (-426.321) [-425.960] * (-426.172) (-425.089) [-426.042] (-426.325) -- 0:00:43
267500 -- (-426.182) [-426.579] (-427.258) (-426.753) * [-428.455] (-427.625) (-425.799) (-426.090) -- 0:00:43
268000 -- (-424.709) (-425.583) [-427.432] (-428.468) * (-425.611) (-425.587) [-426.861] (-429.097) -- 0:00:46
268500 -- (-427.169) (-425.837) [-429.254] (-430.132) * (-428.979) (-426.103) (-426.996) [-430.295] -- 0:00:46
269000 -- (-426.257) (-428.878) (-425.495) [-429.661] * (-426.930) [-426.485] (-428.110) (-430.261) -- 0:00:46
269500 -- (-425.065) (-425.418) (-426.478) [-431.134] * (-425.326) (-427.403) [-426.016] (-428.574) -- 0:00:46
270000 -- (-426.672) (-428.178) (-428.718) [-427.037] * [-425.023] (-427.766) (-424.881) (-426.841) -- 0:00:45
Average standard deviation of split frequencies: 0.016904
270500 -- (-425.971) (-424.400) [-427.156] (-425.565) * (-426.068) (-427.670) (-425.040) [-427.790] -- 0:00:45
271000 -- [-426.052] (-426.589) (-428.734) (-427.258) * (-428.312) (-427.834) [-424.742] (-426.390) -- 0:00:45
271500 -- (-430.213) (-426.660) [-425.239] (-427.267) * [-431.074] (-426.995) (-427.291) (-424.756) -- 0:00:45
272000 -- [-424.939] (-425.466) (-428.459) (-425.890) * (-428.590) [-426.853] (-429.833) (-425.348) -- 0:00:45
272500 -- [-427.711] (-427.930) (-437.272) (-425.526) * (-426.451) (-428.032) (-426.670) [-426.136] -- 0:00:45
273000 -- (-428.652) (-429.155) [-431.150] (-426.345) * [-425.489] (-427.803) (-426.027) (-428.452) -- 0:00:45
273500 -- [-424.721] (-426.949) (-426.805) (-430.028) * [-425.012] (-428.632) (-425.879) (-430.043) -- 0:00:45
274000 -- [-425.574] (-427.284) (-428.310) (-426.760) * [-425.408] (-425.840) (-426.905) (-427.033) -- 0:00:45
274500 -- (-426.288) (-428.831) (-425.385) [-426.541] * [-427.093] (-425.435) (-428.548) (-428.244) -- 0:00:44
275000 -- (-427.190) (-430.454) [-426.576] (-429.373) * (-429.991) (-425.770) [-426.452] (-425.573) -- 0:00:44
Average standard deviation of split frequencies: 0.016176
275500 -- (-426.196) (-429.946) [-426.445] (-427.532) * [-426.290] (-428.537) (-427.264) (-426.947) -- 0:00:44
276000 -- (-426.521) (-426.849) [-427.723] (-424.940) * [-426.010] (-427.452) (-426.299) (-428.364) -- 0:00:44
276500 -- [-426.665] (-426.344) (-430.070) (-425.818) * (-427.339) [-424.750] (-431.449) (-426.927) -- 0:00:44
277000 -- [-427.178] (-428.158) (-429.782) (-429.879) * (-424.974) (-425.356) (-425.189) [-428.025] -- 0:00:44
277500 -- (-425.259) (-426.339) (-425.903) [-427.516] * [-426.721] (-430.625) (-428.736) (-425.632) -- 0:00:44
278000 -- (-425.260) (-426.613) [-430.483] (-426.892) * (-427.103) (-428.224) [-426.125] (-425.214) -- 0:00:44
278500 -- (-427.443) [-426.688] (-425.049) (-427.064) * [-431.369] (-429.536) (-426.990) (-425.840) -- 0:00:44
279000 -- [-425.799] (-429.315) (-426.574) (-428.117) * (-429.356) (-425.629) [-426.541] (-425.402) -- 0:00:43
279500 -- (-428.222) (-429.440) [-429.512] (-426.964) * [-425.846] (-426.115) (-427.994) (-425.561) -- 0:00:43
280000 -- (-427.064) (-428.805) (-427.309) [-427.517] * [-430.349] (-426.596) (-427.953) (-425.818) -- 0:00:43
Average standard deviation of split frequencies: 0.015907
280500 -- (-428.367) (-428.203) (-428.547) [-426.055] * [-431.377] (-425.514) (-427.309) (-426.396) -- 0:00:43
281000 -- (-425.179) (-425.013) [-428.632] (-425.400) * (-426.323) [-425.661] (-428.206) (-426.191) -- 0:00:43
281500 -- (-426.321) [-425.737] (-426.730) (-424.635) * [-425.132] (-426.498) (-427.381) (-426.821) -- 0:00:43
282000 -- (-426.414) (-425.396) (-428.216) [-428.423] * (-426.358) (-424.948) (-426.424) [-426.417] -- 0:00:43
282500 -- (-425.764) (-425.862) [-428.728] (-426.045) * (-425.445) (-424.834) (-426.513) [-427.014] -- 0:00:43
283000 -- (-426.220) [-426.441] (-426.387) (-427.250) * (-426.275) (-427.971) (-426.308) [-428.037] -- 0:00:43
283500 -- [-426.365] (-425.057) (-428.648) (-425.801) * (-424.496) [-426.299] (-426.779) (-426.757) -- 0:00:42
284000 -- (-428.434) (-427.474) [-425.902] (-426.245) * [-424.684] (-427.336) (-425.064) (-425.887) -- 0:00:42
284500 -- (-427.202) (-425.365) (-426.147) [-425.751] * (-427.595) [-429.645] (-425.626) (-428.322) -- 0:00:45
285000 -- (-425.573) [-426.653] (-426.856) (-427.630) * (-425.389) (-426.704) [-426.069] (-425.957) -- 0:00:45
Average standard deviation of split frequencies: 0.017258
285500 -- (-427.438) (-427.173) (-428.350) [-426.598] * (-424.932) (-427.574) [-425.011] (-429.117) -- 0:00:45
286000 -- (-426.819) (-426.487) (-425.069) [-425.643] * [-427.608] (-431.007) (-427.872) (-426.463) -- 0:00:44
286500 -- [-425.325] (-427.032) (-424.974) (-425.920) * (-427.651) (-425.766) (-426.242) [-428.939] -- 0:00:44
287000 -- [-426.059] (-426.817) (-429.125) (-426.211) * [-428.179] (-426.754) (-426.729) (-426.038) -- 0:00:44
287500 -- (-427.234) (-430.754) (-424.693) [-425.242] * (-428.739) (-429.605) [-429.714] (-426.312) -- 0:00:44
288000 -- (-429.822) (-427.104) (-427.449) [-427.451] * (-425.995) (-426.076) (-430.696) [-425.543] -- 0:00:44
288500 -- [-425.427] (-426.268) (-429.436) (-425.892) * (-424.987) [-426.149] (-429.787) (-425.058) -- 0:00:44
289000 -- (-426.534) (-425.050) [-428.618] (-429.241) * [-425.078] (-426.562) (-426.060) (-425.612) -- 0:00:44
289500 -- (-426.390) (-425.475) (-425.971) [-426.950] * (-427.991) (-427.157) (-426.753) [-424.678] -- 0:00:44
290000 -- (-429.239) (-426.040) (-425.536) [-427.147] * (-426.508) (-426.088) [-428.281] (-424.408) -- 0:00:44
Average standard deviation of split frequencies: 0.018698
290500 -- (-429.742) (-425.131) (-426.406) [-427.618] * [-425.032] (-426.939) (-425.856) (-426.669) -- 0:00:43
291000 -- (-428.151) (-426.454) (-427.534) [-426.388] * (-427.873) [-425.676] (-428.828) (-424.740) -- 0:00:43
291500 -- (-426.636) [-427.688] (-426.733) (-425.197) * [-426.865] (-427.479) (-425.884) (-427.222) -- 0:00:43
292000 -- [-425.517] (-427.687) (-425.242) (-426.765) * (-426.971) [-426.585] (-427.219) (-427.782) -- 0:00:43
292500 -- (-427.340) (-427.764) [-424.941] (-428.174) * (-426.004) (-426.061) [-425.566] (-428.998) -- 0:00:43
293000 -- (-426.702) (-426.105) [-425.975] (-426.284) * (-426.732) (-424.457) (-425.435) [-428.487] -- 0:00:43
293500 -- (-429.531) (-426.461) (-432.515) [-426.432] * (-425.457) (-427.454) (-425.175) [-427.128] -- 0:00:43
294000 -- (-427.826) (-424.863) [-427.603] (-429.889) * (-425.808) [-427.504] (-426.491) (-430.559) -- 0:00:43
294500 -- [-426.256] (-427.112) (-426.789) (-425.086) * (-427.667) (-425.925) (-429.580) [-424.876] -- 0:00:43
295000 -- [-430.302] (-425.109) (-429.027) (-425.516) * (-425.991) [-429.059] (-426.590) (-425.669) -- 0:00:43
Average standard deviation of split frequencies: 0.018736
295500 -- (-427.272) (-426.023) [-428.065] (-426.609) * (-434.402) [-427.717] (-431.031) (-425.840) -- 0:00:42
296000 -- (-428.530) [-426.068] (-427.305) (-428.913) * [-426.339] (-426.766) (-427.317) (-426.877) -- 0:00:42
296500 -- (-425.847) [-425.398] (-429.154) (-427.243) * (-424.825) (-425.600) [-428.179] (-426.318) -- 0:00:42
297000 -- (-426.822) (-425.530) [-426.341] (-436.527) * (-425.477) (-429.022) [-425.310] (-428.166) -- 0:00:42
297500 -- (-427.817) [-432.243] (-426.523) (-426.728) * (-427.829) [-429.907] (-426.532) (-427.834) -- 0:00:42
298000 -- [-424.757] (-426.379) (-430.345) (-426.278) * [-428.297] (-432.378) (-425.567) (-428.656) -- 0:00:42
298500 -- (-428.818) [-427.416] (-426.748) (-426.359) * [-427.626] (-430.873) (-425.554) (-427.285) -- 0:00:42
299000 -- [-428.307] (-426.117) (-424.836) (-426.891) * [-428.380] (-426.939) (-428.680) (-426.281) -- 0:00:42
299500 -- (-428.161) (-429.804) (-426.195) [-428.034] * [-428.877] (-427.160) (-425.633) (-426.290) -- 0:00:42
300000 -- (-426.940) (-427.373) [-426.501] (-425.488) * (-425.817) (-426.822) [-426.604] (-425.351) -- 0:00:42
Average standard deviation of split frequencies: 0.017431
300500 -- (-428.750) (-426.575) [-425.595] (-425.433) * (-424.622) (-431.869) (-425.877) [-428.056] -- 0:00:41
301000 -- [-428.540] (-425.620) (-426.133) (-426.084) * (-425.634) (-429.212) (-432.938) [-428.570] -- 0:00:41
301500 -- (-427.167) (-426.765) [-425.811] (-426.463) * (-425.736) (-425.387) [-424.912] (-425.886) -- 0:00:44
302000 -- (-426.383) (-425.435) (-427.495) [-425.431] * (-425.525) (-428.353) (-427.570) [-426.512] -- 0:00:43
302500 -- (-429.414) [-425.804] (-427.620) (-426.523) * (-426.235) (-429.980) (-428.797) [-429.515] -- 0:00:43
303000 -- (-426.791) (-425.360) [-424.778] (-426.020) * (-425.341) (-425.230) (-426.307) [-430.532] -- 0:00:43
303500 -- (-428.429) (-428.211) [-426.639] (-429.201) * [-425.478] (-425.245) (-428.725) (-427.692) -- 0:00:43
304000 -- [-424.638] (-426.508) (-427.381) (-427.347) * (-425.481) (-427.080) (-429.197) [-433.291] -- 0:00:43
304500 -- (-424.700) (-429.136) (-426.734) [-425.234] * (-424.579) (-428.110) [-425.635] (-429.286) -- 0:00:43
305000 -- (-424.830) (-429.384) [-426.409] (-425.129) * (-426.181) (-426.956) (-426.979) [-429.820] -- 0:00:43
Average standard deviation of split frequencies: 0.016946
305500 -- (-427.713) (-430.105) (-429.028) [-433.070] * [-427.096] (-427.681) (-427.121) (-427.715) -- 0:00:43
306000 -- (-433.048) (-429.076) [-427.559] (-426.979) * [-427.495] (-429.989) (-427.400) (-426.097) -- 0:00:43
306500 -- (-430.307) (-431.151) (-427.159) [-427.237] * (-429.282) (-425.879) (-425.371) [-424.699] -- 0:00:42
307000 -- (-430.558) (-425.324) (-425.476) [-426.962] * [-430.759] (-428.966) (-428.134) (-424.965) -- 0:00:42
307500 -- [-429.910] (-424.867) (-426.478) (-425.918) * (-424.829) (-429.360) [-426.392] (-425.737) -- 0:00:42
308000 -- (-425.710) [-425.979] (-428.997) (-427.906) * [-429.394] (-426.271) (-426.925) (-426.785) -- 0:00:42
308500 -- (-428.739) (-427.634) [-427.795] (-426.401) * (-424.690) [-429.058] (-427.287) (-425.941) -- 0:00:42
309000 -- [-425.691] (-427.658) (-427.627) (-427.179) * (-425.656) (-432.954) (-428.946) [-429.253] -- 0:00:42
309500 -- (-427.059) (-426.126) [-426.771] (-424.704) * [-426.209] (-427.457) (-426.281) (-428.879) -- 0:00:42
310000 -- (-432.118) (-424.710) [-429.024] (-430.093) * (-426.618) (-426.123) [-427.682] (-426.392) -- 0:00:42
Average standard deviation of split frequencies: 0.017405
310500 -- [-427.745] (-424.900) (-428.550) (-430.380) * (-425.592) (-428.885) (-426.155) [-427.249] -- 0:00:42
311000 -- (-428.740) [-428.758] (-426.898) (-427.672) * [-427.700] (-427.469) (-426.793) (-427.339) -- 0:00:42
311500 -- (-427.741) (-426.137) (-426.445) [-428.252] * (-426.007) [-429.658] (-429.363) (-426.014) -- 0:00:41
312000 -- (-425.720) (-425.158) (-426.875) [-427.138] * (-427.783) [-426.839] (-425.273) (-429.190) -- 0:00:41
312500 -- (-426.746) (-426.006) [-426.587] (-426.441) * (-427.351) [-425.267] (-430.809) (-428.965) -- 0:00:41
313000 -- (-426.154) (-425.686) (-426.008) [-427.538] * (-427.787) (-426.549) [-425.075] (-428.116) -- 0:00:41
313500 -- (-425.603) (-426.373) (-427.179) [-427.437] * (-427.552) (-425.045) (-426.888) [-426.690] -- 0:00:41
314000 -- [-425.631] (-428.572) (-426.124) (-425.504) * [-426.208] (-425.934) (-424.616) (-427.028) -- 0:00:41
314500 -- (-426.743) (-431.145) (-425.472) [-425.571] * (-426.517) (-426.331) [-425.951] (-427.247) -- 0:00:41
315000 -- (-426.200) (-432.742) (-428.371) [-426.440] * (-428.861) (-427.279) [-426.685] (-439.792) -- 0:00:41
Average standard deviation of split frequencies: 0.017463
315500 -- (-424.767) (-426.115) (-430.377) [-431.104] * (-428.444) (-427.782) [-424.656] (-426.134) -- 0:00:41
316000 -- (-426.926) (-425.246) (-427.531) [-426.218] * (-427.519) [-428.126] (-425.217) (-431.268) -- 0:00:41
316500 -- [-425.786] (-424.959) (-428.187) (-428.947) * [-426.940] (-426.739) (-424.775) (-426.556) -- 0:00:41
317000 -- (-424.739) (-426.012) (-428.803) [-425.560] * (-431.368) (-427.948) (-431.298) [-429.414] -- 0:00:40
317500 -- (-428.054) (-428.288) (-426.882) [-424.643] * (-427.742) (-430.310) (-426.806) [-424.762] -- 0:00:40
318000 -- (-426.645) [-429.705] (-426.970) (-431.783) * (-428.882) (-425.930) (-427.480) [-424.771] -- 0:00:42
318500 -- (-426.233) (-430.502) [-427.439] (-425.776) * (-430.840) [-426.148] (-427.064) (-426.438) -- 0:00:42
319000 -- (-425.537) (-426.125) [-427.542] (-427.366) * (-428.095) (-426.864) (-425.915) [-428.825] -- 0:00:42
319500 -- (-426.096) [-425.861] (-426.851) (-427.509) * [-428.979] (-427.787) (-425.656) (-429.017) -- 0:00:42
320000 -- [-425.146] (-426.938) (-429.160) (-425.679) * [-426.452] (-426.974) (-427.102) (-428.210) -- 0:00:42
Average standard deviation of split frequencies: 0.016517
320500 -- (-427.651) (-426.294) (-426.147) [-426.554] * (-425.561) (-424.777) (-424.840) [-427.575] -- 0:00:42
321000 -- (-426.647) (-425.212) (-427.337) [-426.746] * (-430.044) (-426.154) [-426.753] (-428.234) -- 0:00:42
321500 -- (-426.886) (-427.499) (-430.612) [-424.608] * (-425.470) (-425.347) (-428.491) [-429.642] -- 0:00:42
322000 -- (-424.881) [-427.526] (-427.078) (-427.547) * [-429.054] (-427.191) (-426.346) (-425.211) -- 0:00:42
322500 -- (-427.546) [-425.037] (-426.936) (-430.493) * (-425.212) [-427.774] (-434.320) (-431.027) -- 0:00:42
323000 -- (-429.666) (-426.357) [-425.845] (-430.308) * (-425.934) [-426.068] (-426.419) (-430.728) -- 0:00:41
323500 -- (-428.324) [-426.807] (-429.453) (-425.527) * [-425.712] (-428.394) (-427.261) (-427.511) -- 0:00:41
324000 -- (-425.259) [-425.728] (-428.579) (-431.656) * (-426.506) (-430.117) (-433.584) [-427.138] -- 0:00:41
324500 -- [-427.937] (-427.471) (-425.867) (-431.542) * (-425.627) (-427.390) (-426.606) [-427.644] -- 0:00:41
325000 -- [-433.197] (-425.375) (-426.800) (-428.060) * [-425.949] (-425.626) (-425.486) (-428.255) -- 0:00:41
Average standard deviation of split frequencies: 0.016161
325500 -- (-429.628) (-428.286) (-429.831) [-425.757] * (-426.079) (-425.660) [-425.857] (-426.275) -- 0:00:41
326000 -- (-428.857) (-426.584) (-426.970) [-425.400] * [-426.192] (-429.811) (-427.299) (-429.889) -- 0:00:41
326500 -- (-429.576) [-426.375] (-425.311) (-427.025) * (-427.627) (-426.064) [-428.022] (-426.809) -- 0:00:41
327000 -- [-425.749] (-426.057) (-426.103) (-426.908) * [-427.379] (-425.850) (-428.562) (-427.708) -- 0:00:41
327500 -- (-429.292) (-427.644) [-427.655] (-425.076) * (-431.299) (-428.061) (-425.590) [-430.777] -- 0:00:41
328000 -- (-428.886) (-426.128) (-425.674) [-427.202] * (-427.971) (-426.589) (-434.277) [-425.696] -- 0:00:40
328500 -- (-427.696) (-425.662) [-427.754] (-428.825) * [-427.746] (-426.619) (-436.666) (-429.002) -- 0:00:40
329000 -- [-427.610] (-426.974) (-428.841) (-428.977) * (-426.141) [-426.474] (-425.730) (-425.175) -- 0:00:40
329500 -- (-425.523) (-428.082) [-426.630] (-429.255) * (-425.593) (-426.423) (-429.000) [-427.353] -- 0:00:40
330000 -- (-427.164) (-427.539) [-425.847] (-426.333) * (-427.117) [-426.275] (-428.349) (-426.694) -- 0:00:40
Average standard deviation of split frequencies: 0.015346
330500 -- [-426.071] (-425.834) (-426.754) (-428.330) * (-424.820) (-424.873) (-426.354) [-425.516] -- 0:00:40
331000 -- (-427.103) (-428.493) [-428.671] (-428.520) * [-425.755] (-425.759) (-429.970) (-425.392) -- 0:00:40
331500 -- (-429.164) (-428.569) (-427.415) [-425.119] * (-424.927) [-425.629] (-428.675) (-425.867) -- 0:00:40
332000 -- (-431.593) [-425.802] (-429.027) (-427.103) * [-425.462] (-425.984) (-425.937) (-425.291) -- 0:00:40
332500 -- (-426.823) [-426.142] (-426.099) (-430.962) * (-426.222) (-426.411) (-425.017) [-428.068] -- 0:00:40
333000 -- [-427.047] (-428.398) (-427.428) (-429.889) * [-426.923] (-428.983) (-425.497) (-428.187) -- 0:00:40
333500 -- (-429.349) [-430.545] (-426.521) (-426.877) * (-429.013) (-426.445) (-427.025) [-426.108] -- 0:00:39
334000 -- (-430.271) (-425.247) [-426.310] (-427.361) * [-425.127] (-427.375) (-425.707) (-424.440) -- 0:00:39
334500 -- (-425.307) (-427.284) [-428.011] (-432.910) * [-426.167] (-429.752) (-426.497) (-428.717) -- 0:00:41
335000 -- (-425.862) (-427.437) [-425.948] (-429.817) * (-428.289) (-425.909) [-429.343] (-427.362) -- 0:00:41
Average standard deviation of split frequencies: 0.014938
335500 -- [-427.986] (-424.725) (-433.377) (-427.799) * [-427.965] (-427.990) (-427.130) (-425.928) -- 0:00:41
336000 -- (-428.249) [-428.773] (-426.427) (-429.869) * (-426.990) (-428.654) [-428.016] (-424.866) -- 0:00:41
336500 -- (-427.998) (-427.043) [-426.230] (-426.211) * (-425.754) (-427.443) [-429.665] (-426.936) -- 0:00:41
337000 -- (-428.307) [-427.639] (-424.946) (-426.428) * (-425.949) (-429.219) (-426.481) [-425.584] -- 0:00:41
337500 -- (-426.633) (-429.814) [-426.629] (-425.654) * (-425.357) (-427.072) [-426.000] (-425.392) -- 0:00:41
338000 -- (-427.851) [-425.304] (-425.033) (-427.418) * (-431.344) (-427.715) (-428.085) [-427.755] -- 0:00:41
338500 -- (-432.953) [-426.238] (-429.751) (-426.869) * (-429.328) [-425.418] (-424.681) (-428.091) -- 0:00:41
339000 -- [-425.109] (-427.458) (-428.954) (-424.852) * (-428.417) (-425.563) (-425.129) [-427.518] -- 0:00:40
339500 -- [-425.582] (-426.245) (-427.011) (-426.218) * (-424.739) [-428.660] (-424.849) (-429.944) -- 0:00:40
340000 -- [-427.693] (-429.022) (-425.891) (-430.831) * (-425.194) (-429.254) [-426.310] (-427.272) -- 0:00:40
Average standard deviation of split frequencies: 0.013838
340500 -- (-427.076) [-425.780] (-425.760) (-429.899) * [-425.763] (-428.688) (-426.774) (-426.072) -- 0:00:40
341000 -- (-426.441) [-425.622] (-430.915) (-426.828) * (-428.482) [-426.489] (-430.468) (-427.277) -- 0:00:40
341500 -- (-427.011) (-425.071) (-428.000) [-430.933] * (-425.462) [-426.301] (-427.552) (-427.214) -- 0:00:40
342000 -- (-426.158) (-425.508) [-427.918] (-427.414) * (-424.931) (-425.598) (-426.199) [-428.527] -- 0:00:40
342500 -- (-428.435) (-425.136) [-426.755] (-426.568) * (-425.169) (-425.491) (-427.707) [-426.704] -- 0:00:40
343000 -- (-425.895) (-428.193) [-426.535] (-428.270) * (-425.803) [-425.243] (-429.895) (-426.110) -- 0:00:40
343500 -- (-428.437) [-426.905] (-427.076) (-425.519) * (-426.720) [-427.373] (-425.381) (-427.848) -- 0:00:40
344000 -- [-425.315] (-432.482) (-426.653) (-424.420) * (-428.935) (-428.845) (-426.834) [-426.407] -- 0:00:40
344500 -- [-425.183] (-429.487) (-425.727) (-429.004) * (-429.171) (-427.120) (-426.706) [-426.475] -- 0:00:39
345000 -- (-428.455) (-427.718) [-426.684] (-430.485) * (-428.014) (-428.809) (-425.284) [-428.155] -- 0:00:39
Average standard deviation of split frequencies: 0.013144
345500 -- (-429.958) (-430.469) [-425.797] (-431.629) * [-427.264] (-425.071) (-427.575) (-428.707) -- 0:00:39
346000 -- [-427.273] (-433.694) (-426.842) (-428.577) * (-429.018) [-428.172] (-425.593) (-428.033) -- 0:00:39
346500 -- (-426.778) [-427.734] (-436.528) (-425.419) * (-430.931) (-427.027) (-430.455) [-428.312] -- 0:00:39
347000 -- (-429.889) (-424.938) (-429.172) [-426.359] * [-425.088] (-427.486) (-431.970) (-425.974) -- 0:00:39
347500 -- [-428.454] (-427.042) (-428.089) (-424.828) * [-425.158] (-427.113) (-430.365) (-426.784) -- 0:00:39
348000 -- (-431.480) (-426.041) (-425.789) [-426.677] * (-426.569) (-426.711) [-425.339] (-426.615) -- 0:00:39
348500 -- (-427.672) (-428.423) [-427.403] (-424.912) * [-425.968] (-429.313) (-424.601) (-426.649) -- 0:00:39
349000 -- [-426.979] (-429.663) (-428.284) (-427.804) * (-425.483) (-428.930) [-427.317] (-426.614) -- 0:00:39
349500 -- (-429.683) (-426.740) [-428.256] (-428.827) * [-426.275] (-426.841) (-429.807) (-427.479) -- 0:00:39
350000 -- (-429.727) (-427.504) [-425.067] (-427.310) * (-427.356) (-426.992) (-431.225) [-426.243] -- 0:00:39
Average standard deviation of split frequencies: 0.013443
350500 -- [-429.361] (-425.964) (-432.711) (-425.979) * [-426.572] (-427.256) (-426.893) (-426.532) -- 0:00:38
351000 -- [-426.560] (-426.172) (-429.940) (-425.820) * (-427.134) [-425.579] (-427.532) (-426.942) -- 0:00:38
351500 -- (-427.651) (-429.627) (-427.639) [-425.528] * (-429.152) (-425.487) [-424.871] (-424.917) -- 0:00:40
352000 -- (-431.379) [-433.185] (-428.329) (-426.959) * (-426.434) [-426.213] (-425.301) (-430.510) -- 0:00:40
352500 -- (-431.120) (-425.834) [-426.467] (-426.167) * (-427.143) (-426.800) (-424.957) [-426.043] -- 0:00:40
353000 -- (-425.309) (-431.592) [-427.977] (-425.829) * (-424.834) (-425.913) (-425.917) [-428.638] -- 0:00:40
353500 -- (-427.200) [-426.046] (-427.113) (-426.526) * [-425.163] (-431.782) (-429.143) (-429.537) -- 0:00:40
354000 -- [-428.128] (-428.074) (-426.465) (-427.767) * (-424.581) (-427.138) (-426.421) [-430.899] -- 0:00:40
354500 -- (-425.154) [-425.493] (-425.502) (-426.798) * [-424.745] (-428.611) (-427.045) (-427.618) -- 0:00:40
355000 -- (-428.073) [-425.427] (-433.748) (-425.641) * (-424.952) [-428.609] (-429.040) (-427.693) -- 0:00:39
Average standard deviation of split frequencies: 0.013242
355500 -- (-427.379) [-424.557] (-425.971) (-427.371) * (-427.671) [-425.806] (-428.182) (-426.171) -- 0:00:39
356000 -- (-434.351) [-426.181] (-432.309) (-429.989) * (-429.436) [-426.710] (-427.991) (-429.024) -- 0:00:39
356500 -- (-427.545) [-426.370] (-427.740) (-426.452) * [-427.052] (-425.467) (-425.120) (-425.040) -- 0:00:39
357000 -- [-425.774] (-425.780) (-427.322) (-428.443) * [-426.781] (-427.268) (-425.444) (-430.493) -- 0:00:39
357500 -- [-425.555] (-425.316) (-427.608) (-425.182) * (-425.529) [-426.000] (-424.780) (-426.406) -- 0:00:39
358000 -- (-427.547) (-429.558) [-432.754] (-426.124) * (-426.890) [-428.184] (-427.644) (-426.768) -- 0:00:39
358500 -- (-426.882) (-429.534) [-425.526] (-424.726) * [-425.055] (-426.483) (-426.604) (-424.641) -- 0:00:39
359000 -- [-425.994] (-431.412) (-426.810) (-425.099) * (-427.299) (-429.337) [-426.953] (-425.703) -- 0:00:39
359500 -- [-426.015] (-431.232) (-426.358) (-430.264) * (-428.629) (-427.303) (-425.288) [-429.968] -- 0:00:39
360000 -- [-429.362] (-426.280) (-427.360) (-428.099) * (-425.219) (-427.979) [-426.842] (-427.340) -- 0:00:39
Average standard deviation of split frequencies: 0.013224
360500 -- (-427.654) (-427.478) [-428.291] (-426.882) * [-427.588] (-428.413) (-428.451) (-428.711) -- 0:00:39
361000 -- (-426.864) [-425.340] (-425.129) (-430.251) * (-427.610) [-426.691] (-429.861) (-425.097) -- 0:00:38
361500 -- (-425.409) [-426.089] (-426.299) (-428.294) * (-425.781) (-425.247) [-426.403] (-426.241) -- 0:00:38
362000 -- [-425.326] (-427.291) (-425.545) (-429.501) * (-428.049) (-427.156) (-428.224) [-426.209] -- 0:00:38
362500 -- (-425.796) [-429.097] (-427.391) (-426.785) * (-426.802) (-425.851) (-426.034) [-426.410] -- 0:00:38
363000 -- (-425.319) (-427.505) (-425.491) [-426.015] * (-426.661) (-426.233) (-429.076) [-424.866] -- 0:00:38
363500 -- (-425.592) (-427.900) [-427.441] (-426.032) * [-426.200] (-427.000) (-427.949) (-429.651) -- 0:00:38
364000 -- (-428.011) (-427.694) (-430.822) [-426.706] * (-426.889) (-438.951) [-424.697] (-430.667) -- 0:00:38
364500 -- (-427.085) (-429.985) (-425.756) [-426.087] * (-428.253) (-425.434) (-426.177) [-425.381] -- 0:00:38
365000 -- (-427.255) (-425.680) (-428.906) [-425.947] * (-428.779) (-426.038) (-425.172) [-428.067] -- 0:00:38
Average standard deviation of split frequencies: 0.012728
365500 -- (-427.854) [-424.673] (-429.937) (-425.912) * (-426.400) (-428.367) (-425.476) [-425.085] -- 0:00:38
366000 -- (-427.429) (-427.709) [-427.508] (-426.060) * (-431.949) (-426.507) [-426.147] (-427.138) -- 0:00:38
366500 -- (-427.994) (-430.919) (-425.182) [-427.273] * (-425.639) [-425.702] (-425.888) (-428.091) -- 0:00:38
367000 -- (-427.856) [-429.032] (-428.499) (-432.152) * (-429.368) (-427.318) [-426.055] (-428.754) -- 0:00:37
367500 -- (-428.275) [-427.044] (-430.924) (-424.701) * (-427.928) (-429.683) [-425.938] (-428.542) -- 0:00:37
368000 -- [-426.725] (-426.500) (-428.776) (-432.171) * (-428.735) (-427.644) [-427.403] (-426.221) -- 0:00:37
368500 -- [-425.528] (-426.972) (-426.962) (-425.393) * (-434.976) (-424.824) [-426.150] (-424.840) -- 0:00:39
369000 -- (-426.055) (-430.122) [-426.019] (-427.840) * (-427.326) (-425.186) (-425.246) [-432.860] -- 0:00:39
369500 -- [-427.634] (-427.172) (-427.443) (-428.639) * (-425.076) (-425.215) [-430.842] (-427.141) -- 0:00:39
370000 -- (-426.318) (-427.690) (-427.881) [-426.567] * (-426.427) (-427.353) (-425.856) [-425.543] -- 0:00:39
Average standard deviation of split frequencies: 0.011970
370500 -- (-427.727) (-434.222) [-425.458] (-426.369) * (-429.034) (-428.845) (-428.241) [-426.228] -- 0:00:39
371000 -- (-427.991) (-426.532) (-427.365) [-428.846] * (-426.306) (-426.788) (-429.385) [-424.842] -- 0:00:38
371500 -- (-429.833) (-426.899) (-427.281) [-430.953] * (-427.151) (-426.702) [-429.095] (-426.403) -- 0:00:38
372000 -- (-427.988) [-425.844] (-424.844) (-426.156) * [-428.250] (-424.796) (-428.791) (-427.017) -- 0:00:38
372500 -- [-428.556] (-428.399) (-425.962) (-426.425) * (-427.807) (-426.050) [-428.154] (-428.692) -- 0:00:38
373000 -- (-426.251) [-430.914] (-429.341) (-426.528) * (-425.780) (-426.581) (-429.385) [-426.415] -- 0:00:38
373500 -- (-426.816) (-428.738) (-424.779) [-425.468] * [-425.534] (-427.204) (-428.573) (-425.742) -- 0:00:38
374000 -- (-428.974) [-427.524] (-424.703) (-430.144) * (-425.662) (-427.228) (-430.828) [-425.560] -- 0:00:38
374500 -- (-429.560) (-425.883) [-426.008] (-430.811) * (-426.366) [-425.029] (-430.665) (-425.649) -- 0:00:38
375000 -- [-426.379] (-427.390) (-425.461) (-432.216) * (-427.304) (-425.044) (-425.672) [-426.459] -- 0:00:38
Average standard deviation of split frequencies: 0.011579
375500 -- (-427.883) (-426.874) (-426.901) [-425.187] * (-424.514) (-427.173) (-426.563) [-425.074] -- 0:00:38
376000 -- [-427.793] (-429.909) (-426.690) (-426.403) * (-424.413) [-431.824] (-427.268) (-426.955) -- 0:00:38
376500 -- (-425.986) (-432.526) (-428.391) [-426.117] * [-426.954] (-428.324) (-425.197) (-425.497) -- 0:00:38
377000 -- (-426.936) (-433.465) [-426.342] (-427.481) * (-428.263) (-426.322) [-426.823] (-424.857) -- 0:00:38
377500 -- (-427.148) (-429.826) (-428.469) [-425.135] * [-425.558] (-426.205) (-426.509) (-427.784) -- 0:00:37
378000 -- (-425.701) (-428.171) (-427.658) [-427.549] * (-426.098) (-428.416) [-428.637] (-425.735) -- 0:00:37
378500 -- (-425.874) (-427.194) [-424.678] (-426.642) * (-425.992) (-426.267) [-426.075] (-425.868) -- 0:00:37
379000 -- (-430.694) (-426.267) (-427.658) [-426.274] * [-426.408] (-428.445) (-427.656) (-428.025) -- 0:00:37
379500 -- (-427.999) [-425.892] (-429.182) (-425.695) * (-426.436) (-427.506) (-428.032) [-425.251] -- 0:00:37
380000 -- (-427.733) (-429.279) [-424.941] (-427.107) * [-426.484] (-425.582) (-432.260) (-427.027) -- 0:00:37
Average standard deviation of split frequencies: 0.011655
380500 -- (-429.831) (-431.513) (-425.363) [-424.949] * (-426.550) (-426.062) [-426.666] (-425.047) -- 0:00:37
381000 -- (-427.911) (-427.444) [-425.541] (-425.420) * (-426.117) [-426.239] (-426.104) (-427.604) -- 0:00:37
381500 -- (-431.907) (-425.685) (-429.348) [-429.048] * [-431.528] (-429.846) (-426.335) (-429.841) -- 0:00:37
382000 -- [-425.247] (-426.060) (-427.665) (-425.894) * [-428.648] (-432.309) (-432.412) (-428.255) -- 0:00:37
382500 -- (-426.314) (-426.791) [-425.910] (-425.352) * (-427.578) (-425.976) (-430.388) [-428.019] -- 0:00:37
383000 -- (-428.899) [-427.832] (-426.827) (-425.279) * (-429.793) (-425.451) [-429.022] (-428.181) -- 0:00:37
383500 -- [-428.296] (-429.557) (-431.755) (-430.089) * (-430.003) (-426.139) (-427.474) [-425.457] -- 0:00:36
384000 -- (-427.389) (-428.249) [-426.297] (-431.154) * [-428.428] (-425.540) (-427.497) (-424.955) -- 0:00:36
384500 -- [-427.403] (-426.228) (-428.699) (-432.471) * (-434.013) [-426.770] (-427.194) (-426.345) -- 0:00:36
385000 -- (-426.455) (-428.347) [-425.565] (-428.235) * (-429.031) (-426.757) (-426.832) [-425.796] -- 0:00:38
Average standard deviation of split frequencies: 0.010991
385500 -- (-427.698) (-428.650) [-426.020] (-425.657) * (-425.492) (-426.645) [-426.532] (-426.150) -- 0:00:38
386000 -- (-429.530) [-428.808] (-425.181) (-425.843) * [-425.567] (-427.819) (-426.099) (-426.933) -- 0:00:38
386500 -- (-425.047) [-427.016] (-428.569) (-425.899) * [-425.020] (-424.875) (-426.118) (-426.221) -- 0:00:38
387000 -- (-428.489) (-428.109) [-426.219] (-425.609) * (-428.535) (-426.369) (-432.000) [-427.893] -- 0:00:38
387500 -- (-427.416) (-426.372) [-424.898] (-429.223) * (-426.611) (-425.746) (-426.503) [-428.776] -- 0:00:37
388000 -- [-428.563] (-429.701) (-431.754) (-426.405) * [-426.980] (-430.753) (-427.558) (-427.271) -- 0:00:37
388500 -- [-430.776] (-426.158) (-425.826) (-428.409) * [-427.652] (-427.403) (-424.975) (-429.961) -- 0:00:37
389000 -- (-425.545) (-425.625) (-426.325) [-426.246] * (-428.304) (-427.374) [-427.709] (-429.235) -- 0:00:37
389500 -- (-430.252) (-427.556) (-425.261) [-425.706] * (-427.949) (-426.657) (-425.637) [-428.534] -- 0:00:37
390000 -- [-427.938] (-426.487) (-425.241) (-426.432) * (-431.996) [-427.776] (-425.671) (-428.762) -- 0:00:37
Average standard deviation of split frequencies: 0.010257
390500 -- (-425.003) (-429.826) (-424.833) [-425.672] * (-427.553) (-425.352) (-425.769) [-425.829] -- 0:00:37
391000 -- [-427.926] (-428.675) (-425.553) (-429.056) * [-425.651] (-427.022) (-429.757) (-427.532) -- 0:00:37
391500 -- [-425.291] (-426.395) (-425.395) (-429.239) * [-426.942] (-426.275) (-427.408) (-426.672) -- 0:00:37
392000 -- (-425.452) (-425.981) (-426.125) [-424.857] * (-429.295) (-426.016) (-426.506) [-428.059] -- 0:00:37
392500 -- (-425.316) (-425.752) (-427.010) [-425.278] * (-431.919) [-426.810] (-425.295) (-428.513) -- 0:00:37
393000 -- [-427.296] (-430.265) (-430.017) (-427.615) * (-428.630) (-426.609) (-425.461) [-426.056] -- 0:00:37
393500 -- (-426.336) (-429.349) [-425.639] (-430.357) * (-426.812) [-429.578] (-428.010) (-426.341) -- 0:00:36
394000 -- (-435.860) (-434.004) (-426.321) [-425.977] * (-427.376) [-428.900] (-428.817) (-427.054) -- 0:00:36
394500 -- (-427.352) (-428.818) [-425.972] (-428.506) * (-426.615) (-429.484) (-425.795) [-429.560] -- 0:00:36
395000 -- (-428.214) (-426.000) (-428.665) [-433.344] * (-428.434) (-428.390) (-428.686) [-425.607] -- 0:00:36
Average standard deviation of split frequencies: 0.009873
395500 -- (-427.292) (-426.211) [-427.346] (-426.653) * (-426.843) (-426.049) (-428.424) [-428.316] -- 0:00:36
396000 -- [-428.643] (-426.304) (-426.884) (-428.780) * (-428.038) [-425.701] (-427.894) (-431.019) -- 0:00:36
396500 -- (-425.476) (-427.552) [-427.783] (-424.961) * (-427.783) (-428.210) (-426.112) [-427.115] -- 0:00:36
397000 -- (-427.272) (-430.368) [-428.159] (-425.346) * (-425.977) (-429.065) [-424.890] (-426.051) -- 0:00:36
397500 -- (-425.289) (-427.741) [-427.610] (-425.693) * (-426.650) [-426.900] (-430.321) (-429.679) -- 0:00:36
398000 -- [-425.471] (-427.315) (-426.681) (-427.837) * (-425.951) [-425.334] (-433.993) (-425.131) -- 0:00:36
398500 -- (-427.980) (-426.750) (-427.213) [-424.847] * (-425.539) (-426.671) (-429.237) [-426.102] -- 0:00:36
399000 -- [-426.901] (-426.899) (-425.168) (-426.684) * (-425.677) [-426.091] (-426.952) (-428.668) -- 0:00:36
399500 -- (-426.077) (-428.366) [-426.620] (-426.982) * (-425.322) (-425.405) [-425.881] (-426.285) -- 0:00:36
400000 -- (-425.512) [-429.253] (-425.984) (-431.543) * (-426.029) (-427.061) (-427.230) [-427.205] -- 0:00:36
Average standard deviation of split frequencies: 0.008997
400500 -- (-426.872) (-428.701) [-425.180] (-430.044) * (-425.988) (-428.164) (-427.806) [-426.050] -- 0:00:35
401000 -- (-425.692) [-425.585] (-426.201) (-429.136) * (-425.962) [-426.755] (-428.218) (-426.730) -- 0:00:35
401500 -- [-425.926] (-425.162) (-424.865) (-427.210) * (-437.964) [-429.557] (-427.318) (-427.663) -- 0:00:37
402000 -- (-427.643) [-425.787] (-427.338) (-425.016) * (-431.765) (-427.318) (-428.302) [-426.090] -- 0:00:37
402500 -- (-428.849) (-431.071) [-425.205] (-426.537) * (-427.765) (-426.118) (-426.660) [-429.136] -- 0:00:37
403000 -- (-425.558) (-426.654) [-425.828] (-427.210) * (-425.297) (-427.983) [-426.875] (-429.315) -- 0:00:37
403500 -- (-429.565) (-427.915) (-426.669) [-426.203] * [-426.506] (-425.628) (-427.567) (-427.223) -- 0:00:36
404000 -- (-425.233) (-426.860) (-426.524) [-431.263] * (-426.004) (-428.274) [-426.531] (-426.978) -- 0:00:36
404500 -- (-424.880) [-426.193] (-427.673) (-426.471) * (-426.268) (-429.698) [-427.034] (-425.534) -- 0:00:36
405000 -- (-429.296) (-428.129) (-424.972) [-425.669] * (-427.332) (-425.269) (-426.187) [-426.174] -- 0:00:36
Average standard deviation of split frequencies: 0.007923
405500 -- (-425.804) (-425.483) [-432.867] (-424.947) * (-431.379) (-426.265) [-425.402] (-428.669) -- 0:00:36
406000 -- (-425.680) [-427.197] (-431.914) (-429.745) * (-425.348) (-427.340) [-428.140] (-427.216) -- 0:00:36
406500 -- (-429.733) (-427.367) [-425.944] (-427.038) * (-426.013) (-426.213) (-431.016) [-433.737] -- 0:00:36
407000 -- (-430.658) (-428.590) (-427.364) [-426.249] * (-427.109) (-427.336) (-426.209) [-424.817] -- 0:00:36
407500 -- [-429.329] (-427.013) (-426.358) (-427.938) * (-427.549) (-425.819) (-428.560) [-426.732] -- 0:00:36
408000 -- (-427.466) [-428.756] (-426.809) (-426.545) * (-427.995) (-429.220) [-424.633] (-426.179) -- 0:00:36
408500 -- (-426.029) (-425.362) (-426.369) [-426.120] * (-428.072) (-425.508) [-426.319] (-430.083) -- 0:00:36
409000 -- (-425.585) (-424.913) (-426.561) [-426.556] * (-428.834) (-426.114) [-428.667] (-432.115) -- 0:00:36
409500 -- [-426.056] (-426.085) (-425.646) (-425.386) * (-425.582) (-425.465) (-429.069) [-429.059] -- 0:00:36
410000 -- (-428.267) [-425.264] (-425.884) (-426.219) * (-427.354) (-425.019) (-427.780) [-425.833] -- 0:00:35
Average standard deviation of split frequencies: 0.007563
410500 -- [-426.744] (-425.553) (-426.909) (-425.175) * [-425.673] (-425.150) (-426.676) (-426.658) -- 0:00:35
411000 -- (-428.474) [-425.999] (-426.112) (-425.108) * (-425.840) (-425.294) (-426.376) [-426.621] -- 0:00:35
411500 -- (-428.153) (-426.467) (-427.827) [-426.054] * (-427.008) [-426.483] (-425.631) (-429.791) -- 0:00:35
412000 -- (-429.782) (-425.850) (-431.043) [-427.411] * (-426.456) (-428.323) (-425.141) [-425.347] -- 0:00:35
412500 -- (-427.941) (-426.060) (-425.456) [-426.841] * [-426.452] (-426.431) (-426.521) (-430.693) -- 0:00:35
413000 -- (-427.721) (-429.052) [-427.129] (-432.099) * (-425.533) (-426.899) [-429.337] (-425.503) -- 0:00:35
413500 -- (-426.631) (-425.119) (-428.720) [-426.563] * (-426.300) (-426.687) (-426.002) [-426.877] -- 0:00:35
414000 -- (-426.621) (-427.032) (-425.641) [-428.364] * (-427.011) [-425.832] (-426.273) (-425.209) -- 0:00:35
414500 -- (-425.149) (-426.801) (-426.484) [-425.710] * (-426.294) (-425.416) [-432.021] (-425.510) -- 0:00:35
415000 -- [-426.613] (-427.931) (-427.372) (-424.914) * (-427.615) (-427.417) [-429.058] (-425.797) -- 0:00:35
Average standard deviation of split frequencies: 0.007932
415500 -- (-427.183) (-429.033) [-428.638] (-425.376) * [-427.458] (-427.527) (-427.492) (-428.424) -- 0:00:35
416000 -- (-428.258) [-425.591] (-429.487) (-425.492) * (-426.893) (-427.939) [-425.103] (-425.122) -- 0:00:35
416500 -- (-431.468) [-425.708] (-426.754) (-425.322) * (-429.213) [-429.407] (-426.784) (-428.871) -- 0:00:35
417000 -- [-428.125] (-426.918) (-425.095) (-425.973) * (-426.639) [-426.680] (-426.604) (-427.782) -- 0:00:34
417500 -- [-426.074] (-427.748) (-425.589) (-425.655) * (-427.617) (-428.319) [-426.296] (-428.089) -- 0:00:34
418000 -- (-426.666) (-427.329) (-426.636) [-426.196] * [-425.776] (-430.675) (-429.165) (-431.066) -- 0:00:34
418500 -- [-429.281] (-428.491) (-425.595) (-426.729) * (-426.540) (-425.116) (-430.528) [-427.251] -- 0:00:36
419000 -- (-429.994) (-427.657) (-425.453) [-425.985] * (-428.158) (-425.715) [-425.436] (-427.310) -- 0:00:36
419500 -- [-426.298] (-426.113) (-428.065) (-427.709) * (-427.389) (-426.685) [-428.608] (-427.093) -- 0:00:35
420000 -- (-426.240) (-425.746) [-426.528] (-429.577) * [-427.702] (-426.238) (-427.129) (-427.148) -- 0:00:35
Average standard deviation of split frequencies: 0.008240
420500 -- (-426.539) (-425.398) (-425.908) [-430.056] * (-426.634) [-425.785] (-429.973) (-426.695) -- 0:00:35
421000 -- (-428.559) [-426.877] (-426.216) (-427.157) * [-425.104] (-425.771) (-425.836) (-426.472) -- 0:00:35
421500 -- (-426.049) (-426.420) [-424.520] (-427.391) * (-424.916) (-424.957) (-426.994) [-426.948] -- 0:00:35
422000 -- [-424.817] (-429.910) (-429.003) (-429.404) * (-425.770) (-426.580) (-427.567) [-425.935] -- 0:00:35
422500 -- (-425.246) [-429.400] (-430.809) (-429.009) * (-431.005) (-430.362) [-427.191] (-426.110) -- 0:00:35
423000 -- (-425.780) (-427.277) [-424.905] (-429.154) * [-426.140] (-428.488) (-428.758) (-426.628) -- 0:00:35
423500 -- (-428.464) [-427.676] (-427.062) (-432.385) * (-425.167) (-426.538) [-428.747] (-428.381) -- 0:00:35
424000 -- (-431.972) [-427.093] (-426.790) (-429.147) * (-424.720) (-426.020) [-425.543] (-426.146) -- 0:00:35
424500 -- (-429.427) [-428.816] (-429.006) (-429.080) * [-424.702] (-426.413) (-425.470) (-429.834) -- 0:00:35
425000 -- [-431.785] (-427.191) (-428.495) (-426.647) * [-425.349] (-428.564) (-428.167) (-427.763) -- 0:00:35
Average standard deviation of split frequencies: 0.008722
425500 -- (-428.119) (-427.569) (-430.160) [-428.173] * [-425.504] (-425.788) (-425.557) (-429.281) -- 0:00:35
426000 -- (-424.849) (-426.231) [-425.792] (-427.218) * [-426.903] (-426.452) (-427.750) (-426.063) -- 0:00:35
426500 -- (-424.922) (-431.181) [-426.574] (-426.755) * [-425.335] (-427.421) (-425.840) (-426.543) -- 0:00:34
427000 -- (-427.845) [-428.803] (-424.851) (-426.717) * (-425.356) [-426.545] (-428.667) (-425.567) -- 0:00:34
427500 -- [-426.421] (-424.889) (-429.335) (-427.809) * (-426.017) (-426.619) (-426.081) [-425.099] -- 0:00:34
428000 -- (-429.968) [-425.090] (-425.942) (-426.471) * (-426.451) [-427.369] (-426.877) (-426.309) -- 0:00:34
428500 -- [-425.911] (-425.380) (-426.899) (-427.675) * (-426.458) (-430.143) (-426.490) [-427.523] -- 0:00:34
429000 -- [-426.338] (-427.715) (-428.349) (-427.012) * (-427.657) (-426.519) [-426.171] (-426.697) -- 0:00:34
429500 -- [-426.981] (-427.035) (-425.731) (-427.810) * (-426.578) (-426.584) [-431.175] (-426.397) -- 0:00:34
430000 -- (-426.212) [-426.831] (-425.058) (-426.443) * [-426.186] (-429.331) (-430.154) (-427.856) -- 0:00:34
Average standard deviation of split frequencies: 0.008435
430500 -- (-427.564) [-425.865] (-426.114) (-427.055) * (-425.804) (-426.371) [-431.001] (-428.654) -- 0:00:34
431000 -- [-424.758] (-427.049) (-424.673) (-426.148) * (-428.735) (-425.071) [-424.911] (-431.473) -- 0:00:34
431500 -- (-428.273) (-425.035) [-424.926] (-426.362) * (-427.592) (-426.708) [-428.591] (-429.008) -- 0:00:34
432000 -- (-427.130) (-432.417) [-425.042] (-425.426) * [-425.271] (-425.775) (-425.453) (-427.146) -- 0:00:34
432500 -- (-431.102) [-425.689] (-425.657) (-425.349) * [-425.292] (-429.770) (-430.635) (-428.658) -- 0:00:34
433000 -- (-427.504) (-432.352) (-426.954) [-426.307] * (-425.101) (-425.985) (-425.231) [-430.857] -- 0:00:34
433500 -- (-425.482) (-428.597) [-427.213] (-425.255) * (-426.108) (-426.875) (-424.951) [-426.072] -- 0:00:33
434000 -- (-425.642) [-425.983] (-428.536) (-428.545) * (-426.605) (-427.188) [-426.051] (-427.606) -- 0:00:33
434500 -- [-425.863] (-428.007) (-427.219) (-426.356) * (-424.865) (-428.903) (-429.335) [-428.392] -- 0:00:33
435000 -- (-426.012) (-425.661) (-426.087) [-425.528] * (-426.647) [-426.175] (-426.432) (-430.696) -- 0:00:33
Average standard deviation of split frequencies: 0.008332
435500 -- (-424.729) [-425.795] (-426.759) (-426.362) * (-425.822) (-428.363) (-434.251) [-427.060] -- 0:00:34
436000 -- (-424.783) (-424.847) [-426.692] (-424.602) * (-425.519) (-426.416) (-425.366) [-425.252] -- 0:00:34
436500 -- [-426.154] (-427.657) (-426.541) (-430.040) * (-425.974) [-426.347] (-426.702) (-426.575) -- 0:00:34
437000 -- (-424.624) (-425.717) [-427.662] (-428.693) * (-424.718) [-426.748] (-425.642) (-426.982) -- 0:00:34
437500 -- (-425.802) (-426.357) [-429.115] (-429.097) * (-426.281) (-427.348) (-425.852) [-425.978] -- 0:00:34
438000 -- (-429.181) (-425.144) (-427.228) [-426.262] * (-427.672) (-427.834) [-427.756] (-426.087) -- 0:00:34
438500 -- (-430.954) [-425.408] (-425.265) (-427.948) * (-426.687) [-427.334] (-430.020) (-426.114) -- 0:00:34
439000 -- (-429.266) (-426.245) (-427.308) [-426.422] * [-427.034] (-428.044) (-427.719) (-426.753) -- 0:00:34
439500 -- (-426.336) (-427.047) (-425.690) [-427.633] * [-425.884] (-426.423) (-425.658) (-427.991) -- 0:00:34
440000 -- (-426.900) (-426.139) (-426.860) [-427.800] * (-426.285) (-428.316) (-426.060) [-426.453] -- 0:00:34
Average standard deviation of split frequencies: 0.008810
440500 -- (-425.211) [-428.741] (-424.577) (-427.891) * (-426.885) (-428.152) [-426.295] (-427.562) -- 0:00:34
441000 -- (-426.506) (-426.485) (-427.131) [-427.001] * [-429.560] (-426.158) (-426.155) (-425.048) -- 0:00:34
441500 -- (-425.407) [-426.140] (-428.224) (-425.735) * (-429.871) (-426.108) (-425.587) [-426.952] -- 0:00:34
442000 -- (-427.039) (-426.072) [-427.505] (-426.246) * (-427.231) (-425.099) [-426.900] (-428.179) -- 0:00:34
442500 -- [-425.636] (-428.469) (-426.680) (-426.312) * (-430.078) [-426.162] (-425.909) (-428.938) -- 0:00:34
443000 -- (-425.098) (-426.006) [-425.586] (-427.180) * (-425.709) [-426.169] (-428.364) (-428.314) -- 0:00:33
443500 -- (-427.735) [-425.936] (-425.561) (-427.923) * (-427.178) (-433.446) [-426.610] (-427.447) -- 0:00:33
444000 -- [-429.423] (-429.570) (-426.141) (-426.834) * (-426.287) (-427.408) [-425.996] (-427.089) -- 0:00:33
444500 -- [-425.102] (-432.010) (-426.058) (-426.729) * (-426.548) (-427.065) (-425.888) [-427.511] -- 0:00:33
445000 -- (-426.185) (-425.763) [-426.221] (-425.711) * (-424.909) (-429.155) [-426.417] (-425.662) -- 0:00:33
Average standard deviation of split frequencies: 0.008020
445500 -- (-432.457) [-425.660] (-426.482) (-428.750) * (-426.807) (-426.842) [-427.511] (-428.335) -- 0:00:33
446000 -- (-431.357) (-425.646) [-428.183] (-427.739) * [-427.533] (-426.315) (-427.181) (-425.164) -- 0:00:33
446500 -- (-434.086) (-425.277) [-425.415] (-427.883) * (-425.723) (-425.190) [-426.749] (-427.437) -- 0:00:33
447000 -- (-426.869) (-428.234) (-425.731) [-426.391] * (-431.732) [-424.737] (-427.378) (-427.532) -- 0:00:33
447500 -- (-425.203) [-425.672] (-426.055) (-427.908) * (-428.026) (-425.673) [-425.834] (-428.036) -- 0:00:33
448000 -- (-428.815) (-426.788) [-425.347] (-426.676) * [-426.783] (-425.222) (-426.229) (-428.013) -- 0:00:33
448500 -- (-430.538) (-429.818) (-425.866) [-425.740] * [-426.215] (-426.608) (-426.740) (-425.779) -- 0:00:33
449000 -- (-426.959) (-431.807) (-427.503) [-425.240] * (-426.832) (-427.838) [-426.059] (-425.977) -- 0:00:33
449500 -- (-426.452) (-426.519) [-425.655] (-427.244) * (-426.154) [-424.995] (-425.014) (-424.992) -- 0:00:33
450000 -- [-425.034] (-426.378) (-425.266) (-427.512) * (-426.689) (-425.216) [-427.152] (-431.363) -- 0:00:33
Average standard deviation of split frequencies: 0.007507
450500 -- (-427.935) [-430.027] (-427.142) (-428.052) * (-425.638) [-427.783] (-428.338) (-427.784) -- 0:00:32
451000 -- [-427.871] (-428.987) (-427.833) (-426.085) * (-429.822) (-426.248) (-426.254) [-426.654] -- 0:00:32
451500 -- (-426.092) (-427.687) [-425.031] (-426.966) * (-425.381) (-431.840) [-425.836] (-425.934) -- 0:00:32
452000 -- [-426.814] (-426.125) (-425.911) (-430.419) * [-425.629] (-430.946) (-428.493) (-426.728) -- 0:00:32
452500 -- (-426.861) [-425.862] (-426.598) (-430.821) * [-424.766] (-427.860) (-426.641) (-426.051) -- 0:00:33
453000 -- (-434.593) [-426.326] (-428.810) (-427.755) * (-427.667) [-425.429] (-425.769) (-426.162) -- 0:00:33
453500 -- (-428.110) (-425.359) (-427.539) [-430.571] * (-428.702) (-426.682) [-424.949] (-432.289) -- 0:00:33
454000 -- [-426.170] (-426.527) (-425.358) (-426.742) * (-427.283) (-426.588) [-426.074] (-426.676) -- 0:00:33
454500 -- (-427.848) [-428.202] (-425.792) (-425.119) * (-425.682) (-428.153) (-428.948) [-425.713] -- 0:00:33
455000 -- (-425.589) [-426.374] (-427.026) (-430.446) * (-426.965) [-426.557] (-426.587) (-427.245) -- 0:00:33
Average standard deviation of split frequencies: 0.007480
455500 -- (-426.594) (-425.736) (-425.558) [-425.204] * [-425.333] (-429.233) (-425.790) (-426.697) -- 0:00:33
456000 -- (-425.342) (-427.239) (-427.562) [-425.051] * (-425.489) (-428.206) (-427.143) [-425.439] -- 0:00:33
456500 -- (-432.961) (-425.239) [-425.244] (-427.547) * (-427.015) [-427.037] (-426.494) (-426.380) -- 0:00:33
457000 -- (-426.376) (-427.074) (-426.014) [-426.911] * (-426.091) [-426.492] (-428.539) (-425.429) -- 0:00:33
457500 -- (-427.977) [-425.474] (-427.085) (-430.479) * (-428.192) (-427.085) [-429.234] (-426.553) -- 0:00:33
458000 -- (-428.892) (-425.087) (-426.617) [-428.915] * (-428.205) (-427.795) (-431.419) [-426.405] -- 0:00:33
458500 -- [-427.612] (-425.224) (-426.061) (-429.877) * (-428.157) (-430.891) [-428.595] (-427.302) -- 0:00:33
459000 -- (-428.723) (-428.844) [-424.735] (-425.911) * (-428.954) (-426.465) [-426.222] (-426.160) -- 0:00:33
459500 -- [-426.224] (-429.429) (-425.710) (-427.137) * [-428.273] (-426.052) (-426.252) (-432.978) -- 0:00:32
460000 -- [-427.086] (-430.145) (-425.801) (-425.777) * (-428.319) (-425.848) [-428.451] (-427.175) -- 0:00:32
Average standard deviation of split frequencies: 0.008006
460500 -- (-428.658) (-426.882) [-428.457] (-428.445) * (-427.355) (-431.125) [-425.652] (-426.197) -- 0:00:32
461000 -- [-429.078] (-427.625) (-427.496) (-428.283) * (-425.939) (-432.185) (-425.766) [-427.671] -- 0:00:32
461500 -- [-427.397] (-426.734) (-424.868) (-425.279) * (-426.655) (-427.587) (-429.323) [-426.277] -- 0:00:32
462000 -- (-426.682) [-426.306] (-426.540) (-427.124) * (-426.355) [-426.424] (-425.919) (-426.379) -- 0:00:32
462500 -- (-428.287) [-426.609] (-426.282) (-428.475) * (-427.971) (-429.947) [-425.607] (-426.977) -- 0:00:32
463000 -- (-425.505) (-431.553) (-428.166) [-427.427] * (-425.769) [-424.697] (-425.171) (-427.050) -- 0:00:32
463500 -- (-427.797) (-430.706) (-429.927) [-425.360] * (-426.039) (-428.010) [-436.011] (-426.469) -- 0:00:32
464000 -- [-426.222] (-431.280) (-430.468) (-425.093) * [-427.617] (-425.661) (-426.347) (-424.773) -- 0:00:32
464500 -- (-428.577) [-426.295] (-426.279) (-426.791) * (-430.805) (-428.822) [-428.282] (-425.315) -- 0:00:32
465000 -- (-426.901) [-425.849] (-426.269) (-428.114) * (-426.954) [-427.497] (-426.902) (-425.481) -- 0:00:32
Average standard deviation of split frequencies: 0.007438
465500 -- (-426.189) (-426.759) [-427.853] (-425.869) * (-429.714) (-430.341) [-428.990] (-425.830) -- 0:00:32
466000 -- (-425.200) [-427.660] (-429.190) (-425.999) * [-427.580] (-429.279) (-424.774) (-427.675) -- 0:00:32
466500 -- (-428.246) (-425.632) [-427.150] (-425.608) * (-426.202) [-425.467] (-429.501) (-428.035) -- 0:00:32
467000 -- (-427.154) (-426.300) (-425.533) [-426.430] * (-427.566) (-429.199) [-425.288] (-431.843) -- 0:00:31
467500 -- (-426.445) (-426.085) [-425.927] (-426.868) * (-430.236) [-427.819] (-424.638) (-425.919) -- 0:00:31
468000 -- (-425.943) (-428.049) (-425.675) [-426.878] * (-426.663) [-428.349] (-427.247) (-426.456) -- 0:00:31
468500 -- (-426.350) [-426.758] (-425.997) (-428.577) * (-426.683) [-426.415] (-426.647) (-425.281) -- 0:00:31
469000 -- (-426.042) (-431.096) (-426.680) [-429.946] * (-426.068) [-427.523] (-427.390) (-428.358) -- 0:00:31
469500 -- (-425.011) (-427.981) (-427.376) [-426.483] * (-429.468) [-424.961] (-425.272) (-425.440) -- 0:00:32
470000 -- [-426.092] (-426.175) (-427.958) (-426.822) * (-427.429) (-425.900) [-426.322] (-431.568) -- 0:00:32
Average standard deviation of split frequencies: 0.006834
470500 -- (-425.677) (-427.147) [-428.385] (-429.356) * [-427.038] (-430.555) (-425.787) (-427.270) -- 0:00:32
471000 -- [-429.926] (-428.586) (-428.448) (-425.899) * [-426.130] (-427.731) (-428.161) (-425.911) -- 0:00:32
471500 -- (-428.382) (-429.491) [-425.085] (-429.046) * (-425.420) [-426.182] (-425.931) (-427.448) -- 0:00:32
472000 -- (-428.004) [-428.542] (-425.173) (-432.626) * [-425.097] (-427.691) (-428.159) (-425.963) -- 0:00:32
472500 -- (-427.933) [-428.656] (-428.522) (-425.262) * [-426.098] (-425.569) (-427.589) (-427.392) -- 0:00:32
473000 -- (-427.949) (-425.226) [-426.025] (-425.057) * (-425.956) [-428.693] (-425.671) (-427.455) -- 0:00:32
473500 -- (-427.388) (-425.585) (-425.320) [-426.697] * (-424.759) (-430.035) [-425.318] (-427.090) -- 0:00:32
474000 -- (-425.524) [-425.184] (-424.674) (-425.657) * [-425.544] (-428.700) (-426.005) (-426.942) -- 0:00:32
474500 -- (-424.579) (-431.333) (-424.654) [-426.038] * (-424.842) (-424.745) (-426.112) [-427.321] -- 0:00:32
475000 -- (-425.313) (-430.524) [-426.683] (-427.824) * (-430.080) [-430.161] (-426.583) (-427.248) -- 0:00:32
Average standard deviation of split frequencies: 0.006292
475500 -- (-424.853) (-425.894) (-425.383) [-428.016] * (-430.091) [-428.213] (-425.818) (-428.963) -- 0:00:31
476000 -- [-425.501] (-428.836) (-425.013) (-427.536) * (-425.999) [-425.916] (-429.651) (-426.137) -- 0:00:31
476500 -- [-426.947] (-425.457) (-428.280) (-428.699) * (-431.407) (-426.056) [-425.888] (-426.577) -- 0:00:31
477000 -- [-426.090] (-425.164) (-432.891) (-425.442) * (-427.272) (-425.556) (-427.865) [-425.599] -- 0:00:31
477500 -- [-429.336] (-425.226) (-425.553) (-425.533) * [-427.488] (-425.077) (-425.853) (-424.744) -- 0:00:31
478000 -- [-426.536] (-428.200) (-424.916) (-425.545) * [-425.489] (-427.303) (-427.406) (-427.379) -- 0:00:31
478500 -- [-427.766] (-425.079) (-425.710) (-425.267) * (-425.748) [-431.580] (-426.116) (-426.099) -- 0:00:31
479000 -- (-425.864) (-425.567) [-425.028] (-426.680) * [-430.110] (-426.000) (-429.301) (-426.064) -- 0:00:31
479500 -- (-426.611) (-426.904) [-426.641] (-426.346) * (-426.113) (-426.616) [-425.894] (-426.057) -- 0:00:31
480000 -- (-427.295) (-425.720) (-425.534) [-425.887] * (-425.814) (-428.226) (-425.029) [-425.885] -- 0:00:31
Average standard deviation of split frequencies: 0.005827
480500 -- (-426.701) [-426.050] (-425.311) (-425.231) * (-425.757) [-428.113] (-425.599) (-425.618) -- 0:00:31
481000 -- (-426.853) (-426.289) [-425.261] (-427.541) * (-428.055) (-426.883) [-425.964] (-425.935) -- 0:00:31
481500 -- (-428.365) (-425.400) (-425.801) [-428.753] * (-426.622) [-428.111] (-424.970) (-426.693) -- 0:00:31
482000 -- (-427.176) (-426.761) (-424.506) [-430.236] * (-428.270) (-426.074) [-425.503] (-426.811) -- 0:00:31
482500 -- (-426.394) (-426.405) [-425.267] (-428.407) * (-428.461) [-428.915] (-425.905) (-424.404) -- 0:00:31
483000 -- (-425.647) (-429.115) (-429.638) [-426.997] * [-425.983] (-426.060) (-427.148) (-430.955) -- 0:00:31
483500 -- (-426.757) (-425.237) [-427.428] (-431.438) * (-425.778) [-425.876] (-429.351) (-426.310) -- 0:00:30
484000 -- (-424.781) [-424.564] (-425.106) (-426.184) * (-429.625) (-428.509) [-429.471] (-425.493) -- 0:00:30
484500 -- (-426.799) [-425.889] (-427.742) (-426.414) * (-426.477) (-425.339) (-426.811) [-425.677] -- 0:00:30
485000 -- (-426.331) (-428.600) [-430.532] (-429.462) * [-430.674] (-425.581) (-426.836) (-426.243) -- 0:00:30
Average standard deviation of split frequencies: 0.005420
485500 -- (-425.649) (-425.196) (-424.817) [-427.530] * (-429.551) [-425.173] (-426.327) (-426.116) -- 0:00:30
486000 -- (-428.830) (-425.923) [-427.543] (-428.277) * (-432.830) (-426.648) [-426.351] (-427.476) -- 0:00:30
486500 -- (-427.486) (-425.900) [-431.097] (-429.002) * [-426.087] (-426.751) (-425.712) (-427.711) -- 0:00:31
487000 -- [-426.405] (-428.439) (-425.426) (-427.343) * (-426.985) (-427.584) [-425.685] (-426.012) -- 0:00:31
487500 -- (-427.434) (-426.879) (-426.384) [-425.515] * (-425.534) (-430.119) [-426.160] (-426.467) -- 0:00:31
488000 -- [-427.150] (-428.048) (-425.864) (-427.403) * [-426.832] (-426.320) (-428.093) (-430.330) -- 0:00:31
488500 -- (-428.928) [-427.211] (-427.939) (-425.215) * (-427.052) (-425.349) [-426.251] (-426.833) -- 0:00:31
489000 -- (-426.235) [-429.283] (-427.154) (-426.540) * [-428.334] (-432.577) (-425.618) (-429.048) -- 0:00:31
489500 -- (-427.260) (-429.308) [-427.778] (-429.224) * (-428.889) (-428.309) (-426.751) [-427.786] -- 0:00:31
490000 -- [-425.994] (-427.187) (-425.531) (-427.521) * [-427.283] (-428.244) (-426.875) (-427.706) -- 0:00:31
Average standard deviation of split frequencies: 0.005595
490500 -- (-427.145) (-429.188) [-427.271] (-426.187) * (-429.684) (-425.037) [-427.204] (-428.004) -- 0:00:31
491000 -- (-427.173) [-428.058] (-426.193) (-425.740) * (-427.766) (-426.893) (-429.319) [-425.560] -- 0:00:31
491500 -- (-426.303) [-427.087] (-429.095) (-425.701) * (-428.257) (-426.941) (-425.144) [-425.165] -- 0:00:31
492000 -- [-426.780] (-425.758) (-426.595) (-425.252) * (-431.494) (-426.229) [-427.784] (-428.696) -- 0:00:30
492500 -- (-427.829) (-426.778) (-427.617) [-427.428] * (-428.269) (-427.241) (-428.486) [-427.037] -- 0:00:30
493000 -- (-427.034) [-428.332] (-427.256) (-431.088) * (-424.997) [-426.174] (-428.489) (-425.867) -- 0:00:30
493500 -- [-425.177] (-427.182) (-427.966) (-428.913) * [-426.172] (-426.643) (-429.205) (-428.659) -- 0:00:30
494000 -- (-425.458) (-426.262) (-425.825) [-425.963] * (-425.424) (-427.609) (-426.187) [-428.029] -- 0:00:30
494500 -- (-429.085) (-425.343) [-425.058] (-425.862) * (-428.448) (-426.495) (-426.769) [-426.551] -- 0:00:30
495000 -- (-426.650) [-425.008] (-426.237) (-427.689) * (-428.634) [-429.445] (-428.197) (-427.979) -- 0:00:30
Average standard deviation of split frequencies: 0.006038
495500 -- (-425.776) (-426.122) [-429.045] (-427.032) * [-425.282] (-430.534) (-429.092) (-425.388) -- 0:00:30
496000 -- (-427.529) (-428.533) [-425.964] (-426.540) * (-427.341) [-426.017] (-424.874) (-425.901) -- 0:00:30
496500 -- (-428.002) (-428.275) [-425.678] (-428.768) * (-429.294) (-425.940) [-430.266] (-425.628) -- 0:00:30
497000 -- (-424.723) (-426.278) [-426.898] (-425.178) * [-429.075] (-425.247) (-429.739) (-425.037) -- 0:00:30
497500 -- (-426.481) (-426.754) [-425.318] (-425.794) * (-427.294) (-426.503) (-427.205) [-425.106] -- 0:00:30
498000 -- (-426.256) [-425.990] (-428.649) (-427.223) * (-430.640) (-426.568) (-425.495) [-429.424] -- 0:00:30
498500 -- (-430.144) [-425.795] (-428.408) (-427.895) * [-426.843] (-425.834) (-426.397) (-428.058) -- 0:00:30
499000 -- (-428.118) [-425.187] (-426.133) (-425.004) * (-425.097) (-427.162) (-426.609) [-426.155] -- 0:00:30
499500 -- (-428.151) [-428.616] (-427.679) (-425.640) * (-425.814) [-429.114] (-427.195) (-426.848) -- 0:00:30
500000 -- [-432.490] (-429.209) (-425.167) (-425.041) * [-425.667] (-428.161) (-429.723) (-430.071) -- 0:00:30
Average standard deviation of split frequencies: 0.005296
500500 -- (-424.927) (-428.211) [-424.910] (-430.148) * (-427.558) (-427.776) [-425.010] (-431.295) -- 0:00:29
501000 -- (-425.649) [-426.242] (-427.743) (-425.654) * (-427.753) (-427.446) (-427.327) [-426.791] -- 0:00:29
501500 -- (-425.416) [-428.098] (-427.573) (-428.582) * [-424.742] (-428.246) (-425.708) (-425.302) -- 0:00:29
502000 -- [-430.034] (-429.485) (-427.925) (-428.210) * (-425.219) (-426.113) [-425.918] (-425.964) -- 0:00:29
502500 -- (-427.658) (-425.162) [-427.126] (-429.262) * (-427.245) (-425.146) [-425.125] (-425.744) -- 0:00:29
503000 -- [-430.530] (-425.490) (-425.460) (-426.025) * (-425.552) [-425.279] (-427.270) (-426.070) -- 0:00:30
503500 -- (-427.766) [-426.267] (-424.904) (-426.342) * [-424.869] (-425.982) (-426.036) (-427.830) -- 0:00:30
504000 -- (-427.256) [-425.346] (-428.802) (-426.471) * (-426.815) (-426.461) (-426.373) [-425.672] -- 0:00:30
504500 -- (-429.984) [-427.251] (-430.373) (-426.500) * (-427.231) (-424.717) [-426.025] (-425.701) -- 0:00:30
505000 -- (-428.680) (-426.402) (-427.055) [-427.392] * [-429.334] (-428.330) (-429.246) (-425.240) -- 0:00:30
Average standard deviation of split frequencies: 0.005357
505500 -- (-432.972) [-425.844] (-429.606) (-425.688) * (-429.105) (-428.548) (-429.588) [-426.204] -- 0:00:30
506000 -- (-425.156) (-429.138) [-428.306] (-425.416) * (-425.307) [-426.751] (-426.166) (-425.424) -- 0:00:30
506500 -- [-426.714] (-427.790) (-428.648) (-426.999) * (-427.106) (-429.300) (-424.927) [-424.978] -- 0:00:30
507000 -- (-426.428) (-427.411) (-428.027) [-428.173] * (-425.954) (-427.099) (-427.007) [-427.328] -- 0:00:30
507500 -- (-425.646) [-425.362] (-426.090) (-428.591) * [-428.404] (-428.407) (-428.081) (-427.222) -- 0:00:30
508000 -- (-425.276) (-425.281) [-431.545] (-427.071) * [-424.854] (-431.791) (-426.778) (-430.517) -- 0:00:30
508500 -- (-426.711) [-425.573] (-427.521) (-424.876) * (-425.226) [-428.464] (-428.936) (-434.185) -- 0:00:29
509000 -- (-426.449) (-431.382) [-426.782] (-426.459) * (-426.104) (-427.076) (-430.819) [-429.669] -- 0:00:29
509500 -- [-427.441] (-428.109) (-424.822) (-427.447) * (-426.171) [-426.140] (-429.126) (-426.907) -- 0:00:29
510000 -- (-430.804) (-429.954) [-425.279] (-431.324) * [-427.651] (-425.645) (-428.812) (-428.095) -- 0:00:29
Average standard deviation of split frequencies: 0.005654
510500 -- (-425.699) (-427.642) (-425.812) [-427.012] * [-426.856] (-427.006) (-424.656) (-425.584) -- 0:00:29
511000 -- (-425.917) (-427.873) [-425.817] (-425.735) * (-430.832) [-426.259] (-425.133) (-431.524) -- 0:00:29
511500 -- (-424.791) (-427.793) (-426.568) [-426.749] * (-429.921) [-425.102] (-425.334) (-432.080) -- 0:00:29
512000 -- [-426.989] (-431.415) (-426.843) (-426.951) * (-431.454) [-427.370] (-425.533) (-428.739) -- 0:00:29
512500 -- [-425.754] (-425.773) (-426.724) (-428.973) * (-425.721) (-425.322) [-427.080] (-428.072) -- 0:00:29
513000 -- (-426.900) (-425.999) [-425.219] (-425.636) * [-425.395] (-427.112) (-425.394) (-426.738) -- 0:00:29
513500 -- [-425.275] (-425.255) (-425.480) (-431.797) * (-426.076) [-428.667] (-426.606) (-425.865) -- 0:00:29
514000 -- [-425.875] (-427.184) (-428.438) (-430.177) * (-425.432) [-429.891] (-426.231) (-428.910) -- 0:00:29
514500 -- (-427.448) [-424.799] (-430.314) (-428.578) * [-425.601] (-430.350) (-424.916) (-426.500) -- 0:00:29
515000 -- (-426.089) [-425.625] (-428.697) (-426.701) * [-429.143] (-427.716) (-426.388) (-426.974) -- 0:00:29
Average standard deviation of split frequencies: 0.006224
515500 -- [-425.217] (-426.043) (-425.255) (-427.965) * (-427.495) [-425.564] (-426.569) (-427.749) -- 0:00:29
516000 -- [-425.304] (-425.437) (-430.596) (-427.743) * (-426.982) (-426.592) (-427.686) [-427.591] -- 0:00:29
516500 -- (-428.367) [-428.718] (-425.590) (-428.958) * (-425.597) [-425.769] (-427.901) (-427.998) -- 0:00:29
517000 -- [-425.225] (-425.923) (-429.848) (-429.121) * [-427.165] (-426.368) (-426.364) (-426.289) -- 0:00:28
517500 -- [-428.040] (-427.093) (-432.041) (-429.320) * [-427.521] (-427.474) (-431.304) (-426.178) -- 0:00:28
518000 -- (-426.672) (-426.923) [-425.284] (-426.619) * (-427.952) [-431.101] (-431.518) (-426.693) -- 0:00:28
518500 -- (-426.249) (-430.259) (-425.578) [-426.059] * (-424.866) [-425.296] (-428.984) (-427.106) -- 0:00:28
519000 -- (-425.043) [-427.432] (-426.795) (-427.401) * (-426.166) [-425.512] (-425.863) (-426.958) -- 0:00:28
519500 -- [-428.308] (-429.548) (-425.137) (-427.869) * [-427.234] (-430.257) (-428.189) (-424.633) -- 0:00:29
520000 -- [-425.893] (-424.813) (-427.035) (-429.203) * (-426.284) (-425.107) (-425.760) [-425.102] -- 0:00:29
Average standard deviation of split frequencies: 0.006338
520500 -- [-425.753] (-428.473) (-426.952) (-426.204) * (-426.618) (-424.764) (-427.084) [-425.428] -- 0:00:29
521000 -- [-426.581] (-429.299) (-430.719) (-425.104) * (-426.077) (-425.277) [-426.390] (-426.385) -- 0:00:29
521500 -- [-426.537] (-424.959) (-428.854) (-425.415) * (-432.766) (-428.557) (-430.012) [-428.467] -- 0:00:29
522000 -- (-427.099) [-425.822] (-426.713) (-427.135) * [-425.908] (-424.811) (-429.481) (-426.406) -- 0:00:29
522500 -- [-425.916] (-426.541) (-425.303) (-428.448) * (-424.881) [-427.571] (-426.670) (-427.656) -- 0:00:29
523000 -- [-426.712] (-426.748) (-426.425) (-425.443) * (-428.364) (-429.380) [-428.549] (-425.001) -- 0:00:29
523500 -- (-428.273) [-424.980] (-428.119) (-430.274) * (-427.895) (-425.016) (-429.106) [-427.279] -- 0:00:29
524000 -- (-426.937) (-426.700) (-427.114) [-426.571] * (-424.649) (-431.078) (-427.811) [-425.717] -- 0:00:29
524500 -- (-430.490) (-427.194) (-428.308) [-425.458] * (-425.560) (-431.651) (-427.464) [-424.380] -- 0:00:29
525000 -- [-427.420] (-427.104) (-427.922) (-425.576) * [-425.573] (-431.432) (-426.182) (-427.763) -- 0:00:28
Average standard deviation of split frequencies: 0.006610
525500 -- [-431.269] (-429.663) (-428.308) (-426.203) * (-425.988) [-429.144] (-427.762) (-426.809) -- 0:00:28
526000 -- (-425.680) (-424.854) [-429.562] (-428.476) * (-428.183) (-431.268) [-424.624] (-426.703) -- 0:00:28
526500 -- (-429.463) [-426.304] (-427.476) (-429.971) * (-426.608) [-428.917] (-425.024) (-426.181) -- 0:00:28
527000 -- [-427.367] (-427.399) (-427.017) (-430.290) * (-427.442) [-426.953] (-424.911) (-425.642) -- 0:00:28
527500 -- (-426.351) (-428.979) [-426.040] (-428.000) * (-428.391) [-425.793] (-424.484) (-425.963) -- 0:00:28
528000 -- (-429.258) (-428.514) (-426.624) [-425.585] * (-430.681) [-425.411] (-424.945) (-425.947) -- 0:00:28
528500 -- (-430.506) (-428.705) (-427.942) [-426.515] * (-430.588) (-426.530) [-428.893] (-424.981) -- 0:00:28
529000 -- (-429.281) (-431.360) (-425.727) [-425.837] * (-428.734) (-427.063) [-425.358] (-424.889) -- 0:00:28
529500 -- [-426.303] (-426.809) (-426.633) (-430.052) * (-425.799) (-427.046) [-427.124] (-425.564) -- 0:00:28
530000 -- [-425.166] (-425.935) (-429.319) (-425.234) * (-425.391) [-426.484] (-424.443) (-425.898) -- 0:00:28
Average standard deviation of split frequencies: 0.006551
530500 -- (-428.781) [-424.726] (-425.558) (-426.757) * [-426.136] (-427.026) (-426.192) (-427.769) -- 0:00:28
531000 -- (-429.432) [-425.620] (-426.225) (-427.041) * (-428.522) (-427.144) (-426.278) [-425.726] -- 0:00:28
531500 -- (-424.910) (-429.871) [-425.213] (-425.935) * (-429.728) (-427.043) (-426.264) [-425.887] -- 0:00:28
532000 -- [-425.469] (-426.781) (-428.238) (-425.857) * [-426.043] (-425.035) (-428.843) (-428.329) -- 0:00:28
532500 -- (-425.197) (-424.651) [-425.957] (-426.751) * (-425.139) (-428.274) [-426.364] (-427.178) -- 0:00:28
533000 -- (-426.442) (-428.088) (-426.753) [-426.228] * (-429.144) [-427.116] (-426.917) (-431.097) -- 0:00:28
533500 -- (-425.158) (-426.151) [-428.506] (-427.053) * (-429.723) (-427.569) (-424.818) [-425.383] -- 0:00:27
534000 -- [-425.751] (-425.196) (-434.348) (-425.820) * [-427.257] (-428.240) (-426.944) (-426.125) -- 0:00:27
534500 -- [-428.212] (-429.093) (-429.418) (-425.415) * (-425.524) (-426.358) [-426.025] (-426.205) -- 0:00:27
535000 -- (-428.066) [-428.349] (-428.716) (-426.260) * (-427.240) (-426.369) [-427.608] (-427.744) -- 0:00:27
Average standard deviation of split frequencies: 0.006541
535500 -- (-425.024) [-427.465] (-426.341) (-425.841) * [-426.949] (-426.010) (-426.957) (-425.318) -- 0:00:27
536000 -- (-426.119) (-424.770) [-427.240] (-426.235) * (-425.015) (-433.320) (-425.623) [-425.831] -- 0:00:27
536500 -- (-427.835) (-428.183) (-427.692) [-429.233] * (-427.456) [-430.389] (-427.257) (-427.864) -- 0:00:28
537000 -- (-427.131) (-426.086) [-425.385] (-426.637) * (-424.839) (-433.243) [-428.563] (-427.830) -- 0:00:28
537500 -- (-428.670) (-426.244) [-427.708] (-427.530) * [-427.382] (-425.030) (-430.451) (-426.069) -- 0:00:28
538000 -- (-427.150) (-425.161) (-425.519) [-427.212] * (-426.750) [-424.610] (-426.746) (-428.463) -- 0:00:28
538500 -- (-428.013) (-427.347) (-425.597) [-425.703] * (-426.300) (-428.083) (-428.757) [-425.014] -- 0:00:28
539000 -- (-426.420) (-425.383) (-431.148) [-426.736] * (-428.316) [-425.553] (-427.225) (-430.904) -- 0:00:28
539500 -- (-425.326) (-427.393) [-427.188] (-426.268) * (-427.774) [-426.018] (-425.880) (-425.632) -- 0:00:28
540000 -- [-425.363] (-428.119) (-430.493) (-429.356) * (-425.706) (-427.071) [-426.847] (-429.932) -- 0:00:28
Average standard deviation of split frequencies: 0.006103
540500 -- (-430.245) (-428.440) (-425.591) [-426.199] * (-426.290) (-425.486) [-427.913] (-425.368) -- 0:00:28
541000 -- (-428.890) (-425.150) [-425.728] (-425.666) * (-426.417) (-426.661) [-431.723] (-425.843) -- 0:00:27
541500 -- (-429.282) (-429.976) [-428.318] (-425.423) * (-427.774) (-427.199) [-427.175] (-427.025) -- 0:00:27
542000 -- (-426.708) (-427.276) (-427.995) [-425.692] * (-428.373) [-426.395] (-426.506) (-425.824) -- 0:00:27
542500 -- [-425.520] (-434.049) (-425.956) (-430.677) * (-431.425) (-428.910) [-425.872] (-424.907) -- 0:00:27
543000 -- (-426.449) (-432.252) [-426.757] (-427.149) * [-424.815] (-428.070) (-427.125) (-434.064) -- 0:00:27
543500 -- (-425.945) [-426.828] (-427.580) (-427.129) * (-426.692) [-428.997] (-426.245) (-429.039) -- 0:00:27
544000 -- [-425.388] (-428.642) (-425.292) (-425.988) * (-427.129) (-426.411) (-426.595) [-430.663] -- 0:00:27
544500 -- (-429.278) (-428.263) [-425.109] (-426.380) * (-426.313) (-428.561) (-426.750) [-426.237] -- 0:00:27
545000 -- (-427.065) (-427.749) (-427.697) [-425.316] * [-429.536] (-428.313) (-430.811) (-425.742) -- 0:00:27
Average standard deviation of split frequencies: 0.006529
545500 -- [-424.977] (-425.001) (-427.600) (-427.544) * (-427.899) (-429.759) (-431.673) [-425.271] -- 0:00:27
546000 -- [-426.284] (-428.647) (-428.632) (-427.344) * (-426.637) (-428.505) (-430.020) [-426.438] -- 0:00:27
546500 -- (-427.853) [-425.772] (-428.468) (-424.777) * (-425.958) (-425.749) (-426.815) [-426.857] -- 0:00:27
547000 -- (-428.284) (-425.850) [-425.126] (-425.361) * (-428.263) (-426.985) [-425.324] (-427.490) -- 0:00:27
547500 -- [-428.646] (-426.242) (-426.765) (-428.352) * (-427.304) (-428.437) [-427.321] (-429.745) -- 0:00:27
548000 -- (-425.397) (-429.285) (-427.133) [-430.151] * (-428.069) (-429.590) [-426.194] (-424.919) -- 0:00:27
548500 -- (-426.895) (-425.410) [-425.001] (-426.634) * (-429.165) (-429.369) [-432.831] (-427.193) -- 0:00:27
549000 -- (-425.882) (-426.718) (-431.325) [-425.503] * (-428.481) (-427.089) (-430.646) [-425.708] -- 0:00:27
549500 -- [-425.726] (-426.465) (-428.191) (-425.235) * [-426.321] (-425.952) (-429.273) (-424.879) -- 0:00:27
550000 -- (-426.816) (-425.747) (-428.772) [-425.145] * [-427.069] (-427.172) (-430.924) (-426.779) -- 0:00:27
Average standard deviation of split frequencies: 0.006902
550500 -- (-427.645) (-427.111) (-429.122) [-424.998] * (-425.336) (-426.511) (-427.407) [-429.857] -- 0:00:26
551000 -- (-427.796) (-427.606) (-428.879) [-425.662] * (-426.511) (-429.022) [-425.062] (-425.515) -- 0:00:26
551500 -- (-429.545) (-429.625) (-425.715) [-425.519] * [-426.891] (-425.803) (-424.975) (-424.879) -- 0:00:26
552000 -- (-428.062) (-428.044) (-428.121) [-425.559] * [-426.341] (-425.804) (-429.113) (-430.115) -- 0:00:26
552500 -- (-426.155) (-427.190) (-428.737) [-427.838] * (-434.196) (-426.945) [-427.837] (-426.676) -- 0:00:26
553000 -- (-425.255) [-425.552] (-429.252) (-428.668) * (-434.521) (-427.465) (-428.012) [-427.364] -- 0:00:27
553500 -- (-429.021) [-426.081] (-427.092) (-427.117) * [-425.995] (-431.652) (-427.702) (-425.423) -- 0:00:27
554000 -- (-426.778) (-426.239) [-425.282] (-427.487) * (-425.881) (-435.414) [-425.838] (-426.448) -- 0:00:27
554500 -- (-426.252) [-426.800] (-427.000) (-426.074) * [-427.141] (-428.871) (-427.101) (-426.985) -- 0:00:27
555000 -- (-427.868) (-427.140) (-424.908) [-426.149] * (-426.742) (-427.401) (-425.268) [-427.187] -- 0:00:27
Average standard deviation of split frequencies: 0.008030
555500 -- (-425.503) (-428.631) [-425.159] (-426.442) * (-424.878) (-427.264) [-427.038] (-426.669) -- 0:00:27
556000 -- (-425.847) [-425.466] (-430.490) (-426.395) * [-424.748] (-429.929) (-427.350) (-425.403) -- 0:00:27
556500 -- [-426.806] (-425.669) (-427.264) (-425.964) * (-427.272) (-426.911) (-428.479) [-426.272] -- 0:00:27
557000 -- [-425.124] (-426.007) (-427.697) (-430.671) * (-424.628) [-428.030] (-429.868) (-427.194) -- 0:00:27
557500 -- [-424.564] (-428.644) (-430.826) (-426.719) * (-424.680) (-425.958) (-426.821) [-425.759] -- 0:00:26
558000 -- (-429.026) (-426.587) (-429.103) [-425.756] * (-430.965) (-428.587) (-426.170) [-426.608] -- 0:00:26
558500 -- [-426.821] (-426.272) (-428.499) (-425.253) * (-427.382) [-426.029] (-425.361) (-426.532) -- 0:00:26
559000 -- (-426.760) (-427.437) (-426.488) [-427.553] * (-427.760) (-428.968) (-427.233) [-425.336] -- 0:00:26
559500 -- (-429.805) (-431.465) (-427.905) [-428.849] * [-425.595] (-428.752) (-430.326) (-427.879) -- 0:00:26
560000 -- [-425.981] (-426.660) (-429.154) (-428.566) * [-426.531] (-426.759) (-427.049) (-426.433) -- 0:00:26
Average standard deviation of split frequencies: 0.008062
560500 -- (-427.157) (-428.259) [-427.548] (-425.283) * (-431.856) (-427.624) [-425.436] (-426.553) -- 0:00:26
561000 -- (-426.671) (-426.182) [-426.872] (-426.644) * (-428.027) [-427.192] (-431.565) (-426.892) -- 0:00:26
561500 -- (-430.229) (-425.400) (-425.438) [-426.654] * (-427.638) (-425.628) [-427.830] (-427.903) -- 0:00:26
562000 -- (-425.415) (-425.244) [-426.456] (-425.443) * (-425.349) [-425.127] (-428.125) (-427.663) -- 0:00:26
562500 -- [-427.540] (-431.543) (-426.500) (-426.537) * (-424.833) [-425.594] (-426.295) (-426.000) -- 0:00:26
563000 -- (-425.606) (-433.892) [-424.933] (-427.598) * [-430.187] (-425.286) (-425.230) (-425.668) -- 0:00:26
563500 -- (-425.890) (-428.700) [-426.439] (-425.576) * (-427.138) (-425.217) (-425.744) [-425.127] -- 0:00:26
564000 -- (-424.673) (-426.938) [-426.983] (-429.719) * (-424.882) [-425.071] (-424.878) (-425.083) -- 0:00:26
564500 -- (-426.578) [-427.444] (-429.596) (-431.556) * (-425.840) [-425.749] (-428.139) (-431.716) -- 0:00:26
565000 -- (-427.071) (-425.378) [-425.654] (-426.678) * (-426.264) [-425.145] (-426.067) (-432.637) -- 0:00:26
Average standard deviation of split frequencies: 0.007937
565500 -- (-425.293) [-424.751] (-429.719) (-427.348) * (-428.147) (-424.949) [-429.642] (-429.702) -- 0:00:26
566000 -- (-427.320) (-426.780) [-430.112] (-426.579) * (-426.107) [-427.801] (-428.370) (-430.399) -- 0:00:26
566500 -- [-426.116] (-428.906) (-427.501) (-424.613) * (-426.923) [-429.504] (-427.841) (-428.211) -- 0:00:26
567000 -- (-425.479) (-427.428) (-426.044) [-425.795] * [-428.180] (-430.497) (-425.377) (-427.647) -- 0:00:25
567500 -- (-426.141) (-426.280) [-426.087] (-426.059) * (-428.782) [-425.612] (-428.788) (-425.022) -- 0:00:25
568000 -- (-429.945) [-427.263] (-428.682) (-428.600) * [-428.547] (-427.273) (-427.384) (-425.339) -- 0:00:25
568500 -- [-428.274] (-425.757) (-428.593) (-425.648) * (-425.559) (-425.674) (-426.812) [-426.790] -- 0:00:25
569000 -- (-430.637) (-424.695) [-426.799] (-426.664) * (-425.479) [-425.159] (-426.618) (-426.343) -- 0:00:25
569500 -- (-424.902) (-427.104) [-428.031] (-429.974) * (-426.787) (-426.790) [-426.179] (-430.310) -- 0:00:26
570000 -- (-426.547) (-428.038) (-427.826) [-427.185] * (-425.591) (-428.554) (-427.763) [-425.859] -- 0:00:26
Average standard deviation of split frequencies: 0.007872
570500 -- (-425.973) (-427.366) (-425.896) [-427.997] * [-426.003] (-431.033) (-425.489) (-426.214) -- 0:00:26
571000 -- [-425.315] (-427.971) (-426.656) (-426.459) * (-425.898) (-431.240) [-427.265] (-427.746) -- 0:00:26
571500 -- (-425.583) (-426.334) [-424.707] (-426.341) * (-427.067) [-427.291] (-429.247) (-425.376) -- 0:00:26
572000 -- (-425.250) (-425.393) [-424.886] (-425.423) * (-424.738) (-424.587) (-428.336) [-425.631] -- 0:00:26
572500 -- (-427.184) [-426.277] (-427.507) (-426.364) * (-425.451) [-426.002] (-425.148) (-427.189) -- 0:00:26
573000 -- (-425.024) (-427.680) (-428.920) [-426.319] * (-425.034) [-426.838] (-426.933) (-430.466) -- 0:00:26
573500 -- (-428.242) (-426.689) (-428.180) [-428.697] * (-426.374) (-426.151) (-425.412) [-424.927] -- 0:00:26
574000 -- [-424.534] (-428.132) (-433.985) (-426.800) * (-428.174) [-426.906] (-428.351) (-426.932) -- 0:00:25
574500 -- (-425.262) (-427.566) [-428.506] (-427.033) * (-424.972) (-426.388) [-428.389] (-427.202) -- 0:00:25
575000 -- (-427.955) (-425.213) [-426.552] (-427.927) * (-424.659) (-426.451) [-426.446] (-426.065) -- 0:00:25
Average standard deviation of split frequencies: 0.007943
575500 -- (-428.240) [-426.518] (-426.435) (-429.247) * (-429.496) (-427.153) (-425.633) [-426.315] -- 0:00:25
576000 -- (-425.726) (-428.816) (-429.161) [-424.768] * [-426.031] (-427.109) (-426.732) (-427.804) -- 0:00:25
576500 -- (-427.552) (-428.837) [-425.715] (-426.377) * (-425.570) [-426.172] (-428.398) (-427.902) -- 0:00:25
577000 -- (-426.506) [-425.073] (-427.415) (-426.700) * (-427.738) (-427.259) [-427.147] (-429.442) -- 0:00:25
577500 -- (-425.017) [-425.132] (-426.441) (-426.658) * (-425.677) (-427.542) (-430.431) [-427.255] -- 0:00:25
578000 -- (-426.096) [-426.125] (-431.460) (-432.610) * (-426.417) (-427.091) (-428.862) [-424.931] -- 0:00:25
578500 -- (-426.427) (-427.243) (-429.024) [-426.558] * (-426.086) [-427.459] (-428.528) (-427.100) -- 0:00:25
579000 -- [-428.042] (-425.789) (-425.921) (-428.203) * (-426.463) (-426.042) [-430.155] (-428.254) -- 0:00:25
579500 -- (-426.635) (-426.523) (-424.875) [-429.643] * [-426.339] (-425.450) (-428.628) (-427.463) -- 0:00:25
580000 -- (-424.974) (-425.941) [-425.466] (-427.686) * [-429.923] (-426.722) (-427.456) (-426.842) -- 0:00:25
Average standard deviation of split frequencies: 0.008118
580500 -- (-429.626) [-428.547] (-425.863) (-427.726) * [-425.825] (-428.173) (-430.513) (-425.665) -- 0:00:25
581000 -- (-427.861) (-430.250) [-425.209] (-425.632) * (-429.740) (-429.010) (-427.152) [-425.241] -- 0:00:25
581500 -- (-426.878) (-426.568) (-426.060) [-425.215] * (-425.767) [-428.548] (-428.773) (-427.038) -- 0:00:25
582000 -- (-427.865) (-426.036) [-424.881] (-426.150) * [-428.327] (-427.849) (-427.232) (-429.544) -- 0:00:25
582500 -- (-425.976) (-426.402) [-430.225] (-426.815) * (-431.179) (-428.847) [-425.699] (-428.343) -- 0:00:25
583000 -- (-426.598) [-427.311] (-428.199) (-425.893) * (-426.989) (-425.335) [-425.468] (-428.725) -- 0:00:25
583500 -- (-429.733) [-424.976] (-428.006) (-426.326) * [-426.172] (-427.048) (-427.105) (-428.048) -- 0:00:24
584000 -- (-428.540) (-427.456) (-426.643) [-427.797] * (-426.786) (-428.434) (-425.798) [-427.186] -- 0:00:24
584500 -- [-425.798] (-428.000) (-427.285) (-425.920) * (-425.377) (-425.626) [-425.329] (-427.394) -- 0:00:24
585000 -- [-426.924] (-425.797) (-427.622) (-431.227) * (-425.509) (-427.585) [-426.082] (-428.573) -- 0:00:24
Average standard deviation of split frequencies: 0.007902
585500 -- (-425.292) [-427.199] (-427.524) (-429.388) * (-428.858) (-424.584) [-425.771] (-425.437) -- 0:00:24
586000 -- (-426.401) (-426.131) (-428.810) [-427.149] * (-426.567) (-424.866) [-426.478] (-426.874) -- 0:00:25
586500 -- [-427.010] (-427.026) (-426.615) (-427.504) * (-425.913) (-425.614) [-425.201] (-425.805) -- 0:00:25
587000 -- [-425.546] (-426.693) (-428.490) (-429.187) * (-428.781) (-425.399) [-425.075] (-431.505) -- 0:00:25
587500 -- (-433.362) (-428.302) (-427.036) [-428.304] * [-428.304] (-429.001) (-426.349) (-426.136) -- 0:00:25
588000 -- (-431.490) [-425.894] (-426.588) (-427.830) * [-426.821] (-428.174) (-426.324) (-433.043) -- 0:00:25
588500 -- (-428.007) (-424.914) (-430.006) [-432.265] * (-427.079) (-426.969) [-424.657] (-426.706) -- 0:00:25
589000 -- (-427.198) (-428.464) (-425.756) [-429.126] * (-426.300) [-425.785] (-425.907) (-429.504) -- 0:00:25
589500 -- (-426.504) [-428.121] (-426.611) (-425.591) * (-427.919) [-427.543] (-425.771) (-427.606) -- 0:00:25
590000 -- (-426.470) (-425.079) (-430.649) [-427.201] * (-426.749) (-431.054) [-425.606] (-425.814) -- 0:00:25
Average standard deviation of split frequencies: 0.007746
590500 -- (-428.818) (-426.771) (-427.615) [-426.059] * (-428.493) (-426.210) (-427.359) [-430.545] -- 0:00:24
591000 -- (-428.448) [-427.515] (-425.922) (-429.557) * (-431.456) [-429.487] (-426.133) (-426.287) -- 0:00:24
591500 -- (-426.255) (-426.765) [-424.624] (-428.687) * (-429.283) (-429.089) [-427.932] (-428.064) -- 0:00:24
592000 -- (-425.696) (-428.642) (-429.452) [-426.219] * (-426.819) (-428.077) (-428.961) [-427.070] -- 0:00:24
592500 -- [-425.664] (-425.367) (-427.031) (-428.571) * (-429.194) (-424.840) [-427.914] (-426.649) -- 0:00:24
593000 -- (-426.067) [-424.870] (-426.279) (-426.811) * [-427.759] (-427.520) (-428.689) (-425.430) -- 0:00:24
593500 -- (-426.028) (-430.218) [-427.257] (-429.592) * (-427.920) [-425.750] (-429.223) (-431.644) -- 0:00:24
594000 -- (-425.924) [-425.491] (-427.495) (-428.240) * (-428.969) [-425.709] (-430.069) (-430.554) -- 0:00:24
594500 -- (-426.694) (-429.431) (-429.356) [-427.356] * (-427.077) (-425.128) [-426.751] (-429.377) -- 0:00:24
595000 -- (-427.478) (-425.234) (-426.240) [-425.523] * [-428.810] (-429.391) (-428.246) (-425.978) -- 0:00:24
Average standard deviation of split frequencies: 0.008096
595500 -- (-430.130) (-425.305) [-425.700] (-424.622) * (-430.714) (-428.052) (-427.516) [-426.508] -- 0:00:24
596000 -- (-428.390) (-425.907) (-426.635) [-425.162] * (-429.842) (-425.113) [-424.657] (-425.514) -- 0:00:24
596500 -- (-427.329) [-424.729] (-426.218) (-429.957) * (-426.315) [-426.740] (-425.040) (-426.482) -- 0:00:24
597000 -- (-424.547) (-428.963) (-430.429) [-425.271] * (-425.557) [-433.233] (-425.067) (-426.198) -- 0:00:24
597500 -- (-426.276) [-425.028] (-425.892) (-426.256) * (-424.494) (-426.425) (-425.704) [-425.466] -- 0:00:24
598000 -- [-426.584] (-427.869) (-425.763) (-425.045) * (-426.567) [-427.657] (-425.779) (-428.151) -- 0:00:24
598500 -- (-426.020) (-425.203) (-428.846) [-428.809] * (-429.057) (-430.370) [-427.752] (-425.452) -- 0:00:24
599000 -- (-426.033) [-424.926] (-434.614) (-425.984) * (-426.452) (-425.579) [-428.383] (-426.906) -- 0:00:24
599500 -- (-426.804) (-427.059) [-426.287] (-428.062) * [-427.700] (-427.320) (-425.742) (-425.544) -- 0:00:24
600000 -- (-425.184) [-426.256] (-427.101) (-426.036) * [-426.511] (-428.371) (-425.874) (-427.733) -- 0:00:24
Average standard deviation of split frequencies: 0.008731
600500 -- (-428.246) [-426.154] (-425.059) (-426.157) * (-427.062) (-430.619) (-425.945) [-425.663] -- 0:00:23
601000 -- [-424.840] (-425.521) (-426.306) (-426.558) * (-426.438) [-425.541] (-425.463) (-425.689) -- 0:00:23
601500 -- (-426.711) [-426.462] (-426.588) (-428.227) * (-428.386) (-427.053) (-431.594) [-425.369] -- 0:00:23
602000 -- (-426.060) (-427.532) (-425.585) [-426.268] * [-427.584] (-429.080) (-428.260) (-426.480) -- 0:00:23
602500 -- (-425.698) (-426.086) [-428.525] (-426.557) * (-430.605) (-431.046) (-428.608) [-426.049] -- 0:00:24
603000 -- [-425.508] (-429.596) (-426.788) (-426.812) * (-426.386) (-426.254) (-428.130) [-426.105] -- 0:00:24
603500 -- (-431.536) (-429.560) (-428.069) [-425.814] * (-425.169) (-428.877) [-424.781] (-428.175) -- 0:00:24
604000 -- (-432.893) (-429.504) [-425.643] (-433.432) * [-428.560] (-432.971) (-425.947) (-428.729) -- 0:00:24
604500 -- (-429.051) (-425.351) (-426.491) [-427.334] * (-427.209) [-425.699] (-425.407) (-427.670) -- 0:00:24
605000 -- (-431.540) (-425.319) [-427.954] (-429.007) * (-425.799) (-426.025) (-427.336) [-425.108] -- 0:00:24
Average standard deviation of split frequencies: 0.008603
605500 -- (-425.690) (-425.510) [-428.085] (-427.576) * (-425.057) (-428.258) (-425.467) [-427.766] -- 0:00:24
606000 -- (-425.844) [-426.219] (-428.777) (-427.385) * [-428.230] (-427.307) (-426.337) (-426.914) -- 0:00:24
606500 -- (-427.331) (-430.378) [-428.532] (-429.763) * (-428.601) (-429.438) [-426.964] (-425.316) -- 0:00:24
607000 -- (-428.251) (-428.189) [-426.216] (-430.797) * (-427.932) [-427.043] (-426.610) (-425.898) -- 0:00:23
607500 -- (-426.508) (-434.553) [-427.944] (-427.278) * (-427.156) [-427.256] (-425.754) (-425.937) -- 0:00:23
608000 -- [-425.116] (-433.872) (-430.501) (-427.093) * (-425.285) (-429.923) (-429.723) [-427.361] -- 0:00:23
608500 -- (-426.659) (-426.041) (-432.022) [-426.188] * (-425.211) (-426.670) [-425.522] (-425.731) -- 0:00:23
609000 -- [-425.634] (-430.973) (-428.397) (-426.305) * (-427.927) (-425.467) [-426.846] (-425.998) -- 0:00:23
609500 -- (-428.970) (-427.989) [-425.863] (-424.843) * (-427.458) (-426.646) [-429.649] (-425.630) -- 0:00:23
610000 -- (-427.938) (-427.967) [-427.292] (-427.740) * (-428.003) [-427.002] (-426.401) (-424.938) -- 0:00:23
Average standard deviation of split frequencies: 0.009354
610500 -- (-425.523) (-432.157) [-427.227] (-430.103) * (-427.365) (-427.608) [-428.223] (-424.674) -- 0:00:23
611000 -- (-428.187) (-435.532) (-427.693) [-425.959] * (-429.055) (-428.963) (-427.794) [-427.494] -- 0:00:23
611500 -- (-426.030) (-426.653) [-425.600] (-426.355) * (-431.401) (-431.535) [-426.013] (-427.397) -- 0:00:23
612000 -- [-428.479] (-427.436) (-425.857) (-429.389) * [-428.120] (-426.847) (-426.745) (-427.758) -- 0:00:23
612500 -- (-431.145) (-424.980) (-426.298) [-428.849] * (-426.465) (-428.362) [-425.555] (-424.827) -- 0:00:23
613000 -- [-425.715] (-430.870) (-424.926) (-424.969) * (-429.876) (-428.311) (-426.894) [-425.788] -- 0:00:23
613500 -- (-426.406) (-425.254) (-426.869) [-426.837] * (-430.561) (-425.698) (-427.153) [-425.409] -- 0:00:23
614000 -- (-427.913) (-426.985) [-426.516] (-430.645) * (-425.806) (-426.163) (-429.092) [-427.806] -- 0:00:23
614500 -- [-426.239] (-426.283) (-426.488) (-431.534) * [-427.714] (-426.838) (-425.941) (-428.681) -- 0:00:23
615000 -- [-426.783] (-426.052) (-426.367) (-429.323) * [-431.180] (-432.439) (-426.274) (-430.547) -- 0:00:23
Average standard deviation of split frequencies: 0.008466
615500 -- (-426.265) (-427.952) (-425.467) [-427.424] * (-428.858) (-427.903) (-428.734) [-427.168] -- 0:00:23
616000 -- (-425.728) (-426.294) (-428.635) [-427.100] * (-426.677) [-431.035] (-427.316) (-427.609) -- 0:00:23
616500 -- (-430.771) (-429.662) (-426.064) [-426.669] * (-426.207) (-426.198) (-426.038) [-429.125] -- 0:00:23
617000 -- [-425.690] (-427.637) (-426.584) (-427.592) * (-426.932) (-424.977) [-425.726] (-427.379) -- 0:00:23
617500 -- (-427.966) (-428.839) (-427.584) [-426.552] * (-424.788) (-432.016) [-426.298] (-429.352) -- 0:00:23
618000 -- [-427.571] (-427.764) (-431.133) (-426.875) * [-424.737] (-428.288) (-426.601) (-428.357) -- 0:00:23
618500 -- [-428.042] (-427.744) (-425.180) (-425.338) * (-424.751) [-425.377] (-428.861) (-428.621) -- 0:00:23
619000 -- [-426.445] (-430.182) (-428.556) (-425.738) * (-424.614) (-425.441) [-425.183] (-426.623) -- 0:00:23
619500 -- (-426.174) (-427.184) [-427.288] (-426.686) * (-425.850) (-426.928) (-428.056) [-428.294] -- 0:00:23
620000 -- (-425.606) (-425.807) [-429.507] (-427.057) * (-425.238) [-426.730] (-424.789) (-427.777) -- 0:00:23
Average standard deviation of split frequencies: 0.008497
620500 -- (-429.004) (-429.068) [-426.354] (-427.980) * (-425.033) [-425.401] (-428.746) (-427.756) -- 0:00:23
621000 -- [-426.953] (-426.066) (-428.283) (-429.758) * [-425.249] (-426.715) (-426.459) (-427.715) -- 0:00:23
621500 -- (-427.190) (-427.349) (-426.867) [-428.977] * (-427.178) [-425.118] (-426.083) (-424.698) -- 0:00:23
622000 -- [-426.139] (-426.059) (-426.300) (-429.130) * [-428.331] (-424.761) (-426.669) (-427.584) -- 0:00:23
622500 -- [-426.117] (-425.613) (-425.143) (-431.894) * (-429.981) [-424.710] (-428.772) (-426.018) -- 0:00:23
623000 -- (-425.728) (-427.907) [-427.731] (-426.686) * (-432.125) (-426.133) (-428.660) [-425.466] -- 0:00:22
623500 -- (-427.640) (-430.532) [-425.857] (-427.350) * (-425.565) (-431.145) [-427.444] (-425.369) -- 0:00:22
624000 -- (-426.636) (-426.491) (-427.186) [-424.701] * (-425.648) [-429.588] (-428.911) (-426.618) -- 0:00:22
624500 -- (-426.071) (-424.722) (-427.058) [-424.949] * (-427.145) (-428.637) (-426.484) [-426.742] -- 0:00:22
625000 -- (-425.309) (-427.317) [-426.145] (-426.903) * [-425.616] (-425.251) (-429.894) (-426.759) -- 0:00:22
Average standard deviation of split frequencies: 0.008594
625500 -- (-425.070) (-426.788) (-432.332) [-425.620] * (-425.963) [-427.511] (-430.998) (-427.884) -- 0:00:22
626000 -- [-427.034] (-428.859) (-428.249) (-428.164) * [-425.255] (-426.223) (-432.817) (-425.014) -- 0:00:22
626500 -- [-427.505] (-432.758) (-428.903) (-427.236) * (-425.715) (-426.651) [-433.084] (-427.125) -- 0:00:22
627000 -- [-427.351] (-428.173) (-430.655) (-425.895) * [-426.230] (-428.552) (-425.724) (-428.248) -- 0:00:22
627500 -- (-428.917) (-429.715) (-426.083) [-426.613] * (-424.985) (-427.506) [-427.306] (-427.456) -- 0:00:22
628000 -- (-425.214) (-431.178) [-426.443] (-425.905) * (-426.438) (-431.442) [-424.912] (-429.866) -- 0:00:22
628500 -- [-428.648] (-428.307) (-424.911) (-425.735) * (-427.676) (-430.404) [-425.391] (-425.402) -- 0:00:22
629000 -- (-428.146) (-426.674) [-428.618] (-428.926) * (-427.071) (-431.317) [-427.919] (-430.779) -- 0:00:22
629500 -- (-427.350) [-427.843] (-429.711) (-426.489) * [-428.307] (-428.364) (-425.381) (-427.097) -- 0:00:22
630000 -- (-427.836) (-427.015) (-428.543) [-428.021] * (-428.525) [-427.775] (-427.189) (-426.049) -- 0:00:22
Average standard deviation of split frequencies: 0.008882
630500 -- (-426.094) [-430.313] (-426.206) (-426.544) * (-428.557) (-427.358) (-425.145) [-425.534] -- 0:00:22
631000 -- (-426.288) (-425.354) (-426.264) [-429.491] * (-428.307) (-430.241) [-425.998] (-428.418) -- 0:00:22
631500 -- (-429.891) (-427.133) [-427.643] (-426.030) * [-426.632] (-427.521) (-425.628) (-429.825) -- 0:00:22
632000 -- (-426.371) (-426.469) (-425.059) [-426.236] * [-428.593] (-430.207) (-424.745) (-427.962) -- 0:00:22
632500 -- [-428.125] (-426.796) (-424.631) (-425.281) * (-428.439) (-426.512) (-426.023) [-427.265] -- 0:00:22
633000 -- (-427.068) (-427.752) (-426.685) [-426.322] * (-426.834) (-424.994) (-425.310) [-425.963] -- 0:00:22
633500 -- [-430.001] (-426.689) (-428.158) (-427.499) * (-427.985) [-426.153] (-426.085) (-429.640) -- 0:00:21
634000 -- (-429.186) [-427.144] (-429.022) (-426.102) * (-425.725) [-431.395] (-426.195) (-425.851) -- 0:00:22
634500 -- [-427.619] (-427.334) (-425.864) (-426.157) * [-425.030] (-428.349) (-427.553) (-426.781) -- 0:00:22
635000 -- (-428.450) (-427.408) [-426.619] (-426.985) * (-426.037) (-428.691) (-426.059) [-426.957] -- 0:00:22
Average standard deviation of split frequencies: 0.008477
635500 -- (-429.932) (-427.457) (-426.584) [-427.164] * (-428.087) (-429.648) (-425.752) [-426.695] -- 0:00:22
636000 -- (-424.865) (-426.754) [-426.373] (-426.865) * (-429.461) [-427.574] (-426.991) (-425.400) -- 0:00:22
636500 -- (-427.238) [-425.812] (-431.008) (-426.604) * (-425.721) (-430.028) (-424.794) [-425.121] -- 0:00:22
637000 -- (-426.916) (-428.028) [-430.618] (-426.718) * [-427.085] (-425.119) (-424.523) (-425.160) -- 0:00:22
637500 -- (-425.781) (-427.545) (-424.917) [-425.584] * [-426.008] (-427.638) (-425.310) (-427.958) -- 0:00:22
638000 -- (-424.683) (-429.860) [-426.799] (-425.460) * (-425.310) [-425.689] (-432.369) (-426.012) -- 0:00:22
638500 -- (-432.264) [-426.968] (-424.899) (-425.387) * [-425.571] (-427.070) (-426.930) (-426.621) -- 0:00:22
639000 -- [-429.024] (-425.089) (-425.161) (-428.195) * (-425.163) (-429.298) (-429.855) [-428.141] -- 0:00:22
639500 -- [-427.858] (-425.006) (-425.199) (-429.012) * (-425.482) (-426.898) [-424.546] (-429.331) -- 0:00:21
640000 -- (-427.073) (-426.335) [-426.942] (-426.012) * (-428.682) (-428.207) [-424.870] (-435.587) -- 0:00:21
Average standard deviation of split frequencies: 0.009014
640500 -- (-428.590) (-425.939) [-427.515] (-424.711) * (-427.194) (-432.044) [-427.083] (-428.263) -- 0:00:21
641000 -- [-424.804] (-428.345) (-428.021) (-428.091) * (-427.072) (-427.546) (-425.233) [-430.175] -- 0:00:21
641500 -- (-425.367) [-426.074] (-429.942) (-429.084) * (-427.258) (-426.572) [-426.637] (-429.651) -- 0:00:21
642000 -- [-425.620] (-426.099) (-426.133) (-426.288) * (-426.520) (-425.501) (-426.116) [-428.001] -- 0:00:21
642500 -- (-427.063) (-427.690) (-426.456) [-426.330] * (-427.620) (-426.746) [-426.489] (-425.973) -- 0:00:21
643000 -- (-426.175) (-429.949) (-425.786) [-430.122] * [-429.518] (-425.519) (-425.456) (-425.970) -- 0:00:21
643500 -- (-427.111) (-427.311) (-426.722) [-428.413] * [-425.083] (-426.828) (-426.446) (-425.582) -- 0:00:21
644000 -- (-426.159) [-426.577] (-426.860) (-426.057) * (-425.777) (-426.140) [-425.831] (-427.562) -- 0:00:21
644500 -- (-426.856) [-428.211] (-426.092) (-427.595) * [-428.850] (-427.799) (-428.541) (-426.321) -- 0:00:21
645000 -- (-427.382) (-426.038) [-425.766] (-427.078) * (-430.197) [-426.291] (-427.436) (-427.889) -- 0:00:21
Average standard deviation of split frequencies: 0.008113
645500 -- (-430.203) (-429.281) (-426.137) [-425.555] * (-425.093) (-425.348) [-426.481] (-428.469) -- 0:00:21
646000 -- (-426.097) [-426.569] (-429.738) (-424.850) * (-427.298) (-427.537) [-429.301] (-425.678) -- 0:00:21
646500 -- (-430.788) (-427.100) (-428.945) [-426.570] * (-428.209) [-428.299] (-425.637) (-426.305) -- 0:00:21
647000 -- (-427.447) (-426.953) (-429.422) [-427.780] * (-429.226) (-428.202) [-424.907] (-430.091) -- 0:00:21
647500 -- (-426.042) (-425.348) [-427.218] (-426.266) * (-431.620) [-425.717] (-428.040) (-428.302) -- 0:00:21
648000 -- (-426.570) (-427.438) (-426.398) [-427.966] * (-426.162) (-425.052) [-425.442] (-426.762) -- 0:00:21
648500 -- (-425.582) (-426.564) (-425.348) [-425.397] * (-428.830) (-427.213) (-426.330) [-426.678] -- 0:00:21
649000 -- (-428.681) (-426.520) (-426.301) [-428.416] * [-427.993] (-426.494) (-428.344) (-427.550) -- 0:00:21
649500 -- (-428.183) (-427.989) (-425.923) [-425.738] * [-427.507] (-426.322) (-431.882) (-432.555) -- 0:00:21
650000 -- (-426.249) (-426.350) (-426.580) [-425.550] * (-431.044) (-425.809) [-432.698] (-428.515) -- 0:00:21
Average standard deviation of split frequencies: 0.007288
650500 -- (-427.038) [-428.120] (-429.257) (-428.713) * (-430.103) (-427.822) (-428.233) [-426.575] -- 0:00:21
651000 -- (-426.139) (-425.332) (-428.719) [-430.077] * (-429.053) (-428.286) (-427.972) [-425.879] -- 0:00:21
651500 -- (-427.664) (-427.806) [-426.097] (-426.311) * [-427.950] (-427.298) (-426.344) (-426.556) -- 0:00:21
652000 -- [-426.825] (-430.092) (-431.221) (-428.434) * (-425.493) [-427.265] (-425.695) (-428.998) -- 0:00:21
652500 -- (-426.397) (-427.582) (-429.148) [-429.651] * [-426.689] (-427.982) (-425.156) (-428.524) -- 0:00:21
653000 -- (-427.822) (-426.964) (-425.820) [-425.422] * (-426.434) (-427.494) (-425.850) [-426.031] -- 0:00:21
653500 -- (-428.654) [-426.269] (-425.325) (-425.990) * (-426.207) [-426.487] (-428.151) (-430.845) -- 0:00:21
654000 -- (-431.174) (-425.511) (-430.024) [-425.654] * (-427.767) (-427.181) [-426.936] (-425.666) -- 0:00:21
654500 -- (-430.860) (-428.172) [-425.288] (-426.400) * (-426.324) (-430.219) [-425.004] (-427.200) -- 0:00:21
655000 -- (-428.190) (-428.069) (-428.633) [-425.618] * (-425.573) [-429.957] (-426.480) (-430.743) -- 0:00:21
Average standard deviation of split frequencies: 0.007609
655500 -- (-427.976) (-428.695) (-426.686) [-425.018] * (-428.619) [-425.652] (-426.853) (-430.242) -- 0:00:21
656000 -- (-431.867) (-427.769) (-425.608) [-425.122] * (-425.750) [-429.191] (-429.054) (-425.155) -- 0:00:20
656500 -- (-425.475) [-427.233] (-432.013) (-426.148) * [-428.545] (-429.886) (-427.278) (-426.959) -- 0:00:20
657000 -- [-426.201] (-428.156) (-425.485) (-426.456) * (-427.820) [-428.484] (-427.221) (-429.491) -- 0:00:20
657500 -- (-430.363) [-428.292] (-426.865) (-427.427) * (-425.645) (-426.927) (-428.385) [-429.789] -- 0:00:20
658000 -- (-428.770) [-426.182] (-428.142) (-424.729) * [-428.194] (-432.260) (-430.215) (-425.099) -- 0:00:20
658500 -- (-427.372) (-425.850) (-438.638) [-427.381] * [-427.937] (-433.599) (-429.720) (-425.400) -- 0:00:20
659000 -- [-428.310] (-426.481) (-431.181) (-425.767) * (-425.902) [-436.062] (-439.156) (-426.116) -- 0:00:20
659500 -- (-427.231) (-425.438) [-427.344] (-424.993) * (-425.927) (-427.311) (-426.333) [-426.025] -- 0:00:20
660000 -- (-426.494) [-425.283] (-426.696) (-425.550) * [-428.868] (-427.554) (-427.654) (-424.495) -- 0:00:20
Average standard deviation of split frequencies: 0.007261
660500 -- (-426.690) [-425.872] (-427.817) (-425.817) * [-425.192] (-426.572) (-424.958) (-424.500) -- 0:00:20
661000 -- (-426.954) (-428.832) (-430.118) [-425.999] * [-427.988] (-427.065) (-424.836) (-424.702) -- 0:00:20
661500 -- (-426.335) [-428.838] (-426.957) (-425.299) * (-426.830) (-426.051) [-426.724] (-427.164) -- 0:00:20
662000 -- (-426.935) [-428.117] (-427.860) (-426.527) * (-426.371) [-427.811] (-427.951) (-428.510) -- 0:00:20
662500 -- (-431.810) (-426.707) (-426.630) [-425.249] * (-427.638) (-426.782) (-428.309) [-425.524] -- 0:00:20
663000 -- (-426.647) (-429.297) [-427.648] (-425.802) * (-428.712) [-425.028] (-426.614) (-435.703) -- 0:00:20
663500 -- (-425.256) (-428.851) (-425.749) [-425.997] * [-428.626] (-425.272) (-430.553) (-425.838) -- 0:00:20
664000 -- (-426.904) [-427.562] (-427.683) (-426.975) * [-426.884] (-428.573) (-426.171) (-425.687) -- 0:00:20
664500 -- (-425.708) (-425.953) (-427.471) [-425.617] * [-427.147] (-426.384) (-426.997) (-425.944) -- 0:00:20
665000 -- [-424.849] (-427.457) (-426.777) (-427.879) * (-425.573) [-425.036] (-429.612) (-428.141) -- 0:00:20
Average standard deviation of split frequencies: 0.007203
665500 -- (-431.155) (-427.857) (-427.295) [-425.991] * (-426.418) [-431.301] (-427.370) (-426.392) -- 0:00:20
666000 -- (-429.624) [-428.469] (-428.268) (-427.305) * [-425.487] (-430.477) (-425.710) (-427.432) -- 0:00:20
666500 -- (-425.881) (-425.560) [-428.342] (-426.152) * [-426.272] (-427.194) (-425.370) (-436.582) -- 0:00:20
667000 -- (-428.148) (-425.172) (-427.456) [-425.085] * (-428.259) (-427.786) [-424.941] (-436.448) -- 0:00:19
667500 -- (-426.063) (-426.222) [-426.271] (-428.728) * (-426.534) (-425.588) (-424.946) [-427.792] -- 0:00:20
668000 -- [-426.906] (-426.092) (-426.375) (-427.689) * (-428.044) (-427.730) (-426.945) [-427.086] -- 0:00:20
668500 -- [-426.232] (-425.446) (-427.514) (-426.613) * (-427.233) [-428.421] (-427.426) (-426.604) -- 0:00:20
669000 -- [-427.551] (-425.621) (-430.382) (-426.564) * [-426.645] (-427.739) (-426.742) (-426.724) -- 0:00:20
669500 -- (-426.587) (-426.727) (-430.198) [-426.927] * (-430.157) (-426.297) [-430.911] (-425.011) -- 0:00:20
670000 -- [-426.828] (-425.044) (-427.163) (-429.196) * [-426.259] (-430.279) (-426.252) (-425.993) -- 0:00:20
Average standard deviation of split frequencies: 0.007292
670500 -- (-428.563) [-425.085] (-428.086) (-428.039) * [-425.745] (-427.388) (-429.225) (-427.835) -- 0:00:20
671000 -- (-428.078) [-426.771] (-427.241) (-430.122) * (-426.477) (-425.697) [-425.463] (-424.820) -- 0:00:20
671500 -- (-425.891) [-425.067] (-426.557) (-428.354) * (-426.399) (-428.378) [-424.552] (-425.659) -- 0:00:20
672000 -- (-426.503) (-424.777) (-425.692) [-424.922] * (-427.197) (-427.255) (-424.944) [-428.375] -- 0:00:20
672500 -- (-426.793) (-429.259) (-425.228) [-425.414] * (-428.087) (-427.608) [-426.833] (-425.961) -- 0:00:19
673000 -- (-428.636) (-425.204) [-425.560] (-425.906) * (-430.780) (-425.699) (-435.170) [-425.600] -- 0:00:19
673500 -- (-426.919) (-425.245) (-426.575) [-428.331] * (-429.110) [-426.502] (-427.957) (-426.428) -- 0:00:19
674000 -- (-425.775) (-426.027) (-426.942) [-426.803] * (-429.021) [-431.482] (-425.547) (-426.115) -- 0:00:19
674500 -- [-424.919] (-430.687) (-425.530) (-425.793) * [-433.373] (-428.784) (-426.129) (-427.844) -- 0:00:19
675000 -- (-425.214) (-430.118) [-426.329] (-426.958) * (-426.755) [-428.112] (-427.596) (-426.642) -- 0:00:19
Average standard deviation of split frequencies: 0.007889
675500 -- (-426.020) [-426.419] (-427.101) (-428.462) * (-426.903) (-426.734) [-425.381] (-428.506) -- 0:00:19
676000 -- (-425.453) (-428.048) (-426.587) [-429.681] * [-430.408] (-426.247) (-429.445) (-428.891) -- 0:00:19
676500 -- (-425.955) (-426.711) [-427.987] (-425.501) * (-427.224) (-425.950) (-425.135) [-428.618] -- 0:00:19
677000 -- (-431.313) (-428.600) [-425.902] (-427.415) * [-425.957] (-425.137) (-427.718) (-430.624) -- 0:00:19
677500 -- (-431.852) (-426.380) (-428.596) [-428.886] * [-429.799] (-427.749) (-426.981) (-429.879) -- 0:00:19
678000 -- (-424.651) [-428.142] (-428.250) (-428.758) * (-426.533) (-426.328) (-426.852) [-424.917] -- 0:00:19
678500 -- [-425.230] (-424.891) (-429.864) (-430.374) * (-426.301) (-425.708) [-429.435] (-426.515) -- 0:00:19
679000 -- [-426.223] (-427.630) (-426.358) (-431.932) * [-425.742] (-431.348) (-425.463) (-427.293) -- 0:00:19
679500 -- (-426.127) [-426.333] (-425.962) (-428.267) * (-426.874) (-428.515) [-425.981] (-426.013) -- 0:00:19
680000 -- (-430.154) [-425.179] (-426.397) (-431.209) * (-425.840) [-425.415] (-425.541) (-430.568) -- 0:00:19
Average standard deviation of split frequencies: 0.007577
680500 -- (-425.525) (-425.735) (-432.150) [-426.640] * (-427.813) [-426.160] (-426.704) (-425.224) -- 0:00:19
681000 -- (-430.204) [-425.299] (-425.509) (-428.749) * [-424.875] (-428.407) (-426.707) (-425.211) -- 0:00:19
681500 -- (-426.529) (-428.505) [-430.466] (-431.120) * (-426.076) [-426.479] (-429.079) (-426.404) -- 0:00:19
682000 -- (-425.902) [-425.771] (-429.318) (-430.397) * (-426.259) [-425.093] (-428.596) (-427.875) -- 0:00:19
682500 -- (-425.788) (-425.805) (-425.843) [-424.938] * (-426.400) [-424.702] (-426.649) (-426.817) -- 0:00:19
683000 -- (-427.394) (-426.070) (-430.405) [-425.859] * [-427.348] (-431.094) (-427.804) (-426.563) -- 0:00:19
683500 -- (-426.910) (-428.630) (-425.926) [-427.589] * (-425.421) (-428.972) (-429.187) [-427.928] -- 0:00:18
684000 -- (-425.974) (-429.510) [-426.449] (-425.254) * (-425.469) [-426.841] (-430.228) (-427.581) -- 0:00:18
684500 -- (-426.380) (-428.017) (-426.848) [-426.803] * [-426.116] (-426.295) (-429.206) (-428.888) -- 0:00:19
685000 -- (-425.019) [-426.411] (-426.868) (-426.537) * [-427.035] (-427.420) (-426.101) (-427.196) -- 0:00:19
Average standard deviation of split frequencies: 0.007215
685500 -- [-429.034] (-427.284) (-429.146) (-425.728) * (-429.339) (-426.306) (-427.620) [-428.887] -- 0:00:19
686000 -- (-428.276) (-426.948) (-427.573) [-425.847] * (-427.546) (-424.901) (-426.512) [-425.454] -- 0:00:19
686500 -- (-426.945) (-425.121) (-429.095) [-424.850] * (-428.026) [-427.723] (-425.488) (-429.757) -- 0:00:19
687000 -- (-425.274) [-426.045] (-426.677) (-431.177) * (-426.280) (-425.515) (-429.858) [-426.103] -- 0:00:19
687500 -- (-426.955) [-425.705] (-426.265) (-425.162) * (-425.069) [-426.455] (-426.935) (-426.727) -- 0:00:19
688000 -- (-427.120) (-428.182) (-428.439) [-426.108] * [-425.785] (-428.013) (-426.821) (-427.543) -- 0:00:19
688500 -- (-428.660) (-425.510) [-426.314] (-425.684) * [-426.602] (-427.494) (-429.304) (-427.890) -- 0:00:19
689000 -- (-428.210) [-425.659] (-428.884) (-425.474) * (-426.275) [-425.756] (-427.319) (-428.611) -- 0:00:18
689500 -- (-432.184) (-429.867) [-427.069] (-425.358) * (-426.078) (-427.115) (-425.902) [-427.611] -- 0:00:18
690000 -- (-425.155) [-427.602] (-425.071) (-430.203) * (-425.450) (-426.795) [-425.811] (-425.840) -- 0:00:18
Average standard deviation of split frequencies: 0.006783
690500 -- [-427.469] (-425.172) (-432.415) (-426.938) * [-425.555] (-425.516) (-426.748) (-426.618) -- 0:00:18
691000 -- (-427.348) [-427.341] (-429.654) (-427.081) * (-430.456) (-426.317) (-424.861) [-426.890] -- 0:00:18
691500 -- [-427.781] (-428.848) (-425.302) (-426.840) * (-425.213) (-425.362) (-424.756) [-425.214] -- 0:00:18
692000 -- [-426.791] (-428.804) (-425.470) (-428.383) * (-425.740) (-425.526) [-424.515] (-425.269) -- 0:00:18
692500 -- (-424.874) (-428.108) (-426.710) [-426.160] * [-424.730] (-426.948) (-426.895) (-426.092) -- 0:00:18
693000 -- [-424.899] (-427.380) (-427.888) (-425.333) * (-425.480) (-426.220) (-430.719) [-426.041] -- 0:00:18
693500 -- (-425.944) [-426.451] (-425.196) (-426.540) * (-426.153) (-426.988) (-426.736) [-424.870] -- 0:00:18
694000 -- (-427.576) (-430.871) [-424.711] (-425.879) * (-425.667) (-425.712) (-425.979) [-424.502] -- 0:00:18
694500 -- (-425.798) (-425.676) [-427.105] (-427.559) * (-425.928) (-428.600) (-429.223) [-424.817] -- 0:00:18
695000 -- [-425.467] (-424.593) (-429.351) (-435.239) * (-426.732) (-424.432) (-434.969) [-426.328] -- 0:00:18
Average standard deviation of split frequencies: 0.007610
695500 -- (-425.885) (-424.967) (-425.084) [-430.379] * (-425.900) (-425.577) (-427.714) [-426.968] -- 0:00:18
696000 -- (-427.032) (-425.932) (-426.611) [-432.097] * (-427.216) [-426.540] (-427.702) (-426.637) -- 0:00:18
696500 -- (-427.019) (-424.605) [-425.117] (-425.835) * [-426.295] (-425.327) (-425.603) (-425.132) -- 0:00:18
697000 -- (-425.125) (-426.353) (-427.626) [-428.070] * (-425.256) (-425.404) (-430.758) [-427.576] -- 0:00:18
697500 -- (-426.797) (-427.514) [-426.224] (-425.434) * [-425.352] (-431.650) (-428.013) (-427.000) -- 0:00:18
698000 -- (-426.576) [-425.324] (-429.764) (-425.878) * (-426.832) [-424.829] (-427.353) (-425.686) -- 0:00:18
698500 -- [-426.997] (-425.680) (-426.525) (-428.353) * (-430.144) (-425.630) [-425.598] (-426.427) -- 0:00:18
699000 -- [-425.953] (-427.714) (-424.667) (-427.504) * (-428.197) [-429.649] (-429.825) (-426.271) -- 0:00:18
699500 -- (-426.708) (-426.762) [-426.787] (-425.663) * (-426.335) [-427.314] (-425.444) (-424.771) -- 0:00:18
700000 -- (-426.878) (-426.755) (-424.528) [-424.585] * (-432.485) [-424.643] (-425.855) (-425.394) -- 0:00:18
Average standard deviation of split frequencies: 0.006728
700500 -- (-425.692) (-425.515) (-426.831) [-428.910] * (-426.371) [-425.857] (-428.133) (-429.050) -- 0:00:17
701000 -- (-424.565) [-427.445] (-425.777) (-429.690) * (-425.363) [-424.985] (-427.584) (-425.436) -- 0:00:18
701500 -- (-424.819) (-429.464) [-425.915] (-426.932) * [-426.855] (-426.164) (-427.075) (-425.496) -- 0:00:18
702000 -- (-425.388) (-429.324) [-426.212] (-425.471) * (-425.239) (-425.643) [-425.687] (-426.254) -- 0:00:18
702500 -- (-428.691) (-430.659) [-424.545] (-426.518) * [-424.699] (-426.460) (-426.287) (-425.885) -- 0:00:18
703000 -- (-427.255) (-426.196) [-424.786] (-426.148) * [-428.265] (-425.178) (-427.040) (-425.487) -- 0:00:18
703500 -- (-428.137) [-428.546] (-425.878) (-428.448) * (-428.202) [-425.013] (-426.662) (-427.305) -- 0:00:18
704000 -- [-427.760] (-427.036) (-427.618) (-428.364) * (-428.589) (-427.523) [-425.997] (-430.150) -- 0:00:18
704500 -- [-425.550] (-424.912) (-429.492) (-426.647) * (-427.629) (-428.805) [-427.354] (-427.543) -- 0:00:18
705000 -- (-426.243) (-426.043) (-427.935) [-427.149] * (-430.625) [-427.358] (-424.862) (-425.793) -- 0:00:17
Average standard deviation of split frequencies: 0.006834
705500 -- [-424.882] (-426.113) (-425.327) (-426.673) * (-428.825) [-428.093] (-427.457) (-426.212) -- 0:00:17
706000 -- (-427.787) [-425.660] (-424.984) (-427.083) * (-428.213) (-428.384) [-427.459] (-433.244) -- 0:00:17
706500 -- (-428.655) (-427.996) [-426.952] (-431.972) * (-425.713) (-427.677) [-425.175] (-426.583) -- 0:00:17
707000 -- (-428.472) (-426.928) (-427.850) [-426.232] * (-427.497) (-430.424) (-428.115) [-427.160] -- 0:00:17
707500 -- [-424.441] (-425.428) (-427.963) (-429.261) * (-425.444) (-431.300) (-425.778) [-426.124] -- 0:00:17
708000 -- (-425.246) [-427.640] (-426.306) (-427.761) * (-425.101) [-426.404] (-429.434) (-427.778) -- 0:00:17
708500 -- (-424.994) (-428.439) (-425.630) [-426.295] * [-425.821] (-426.457) (-431.453) (-428.921) -- 0:00:17
709000 -- (-431.104) [-425.377] (-432.108) (-424.753) * (-427.233) (-428.570) [-427.802] (-426.259) -- 0:00:17
709500 -- (-426.874) (-425.337) [-428.187] (-426.425) * [-429.290] (-427.507) (-425.189) (-425.201) -- 0:00:17
710000 -- (-426.909) (-428.089) (-425.986) [-427.119] * (-427.245) [-428.198] (-424.884) (-427.425) -- 0:00:17
Average standard deviation of split frequencies: 0.006555
710500 -- (-429.351) (-426.730) (-431.990) [-427.056] * (-425.333) (-431.398) (-425.668) [-425.577] -- 0:00:17
711000 -- (-426.905) (-429.030) (-428.239) [-425.306] * (-426.360) (-431.833) [-424.647] (-428.318) -- 0:00:17
711500 -- [-425.757] (-436.240) (-427.104) (-425.266) * [-424.968] (-425.872) (-427.420) (-428.433) -- 0:00:17
712000 -- (-426.957) (-433.957) (-427.307) [-425.509] * (-429.323) (-431.718) (-427.152) [-427.052] -- 0:00:17
712500 -- (-429.013) (-426.959) (-425.492) [-427.735] * (-427.140) [-425.957] (-428.412) (-425.649) -- 0:00:17
713000 -- [-428.038] (-428.055) (-425.858) (-426.295) * (-427.523) (-427.351) (-427.760) [-425.202] -- 0:00:17
713500 -- (-426.523) (-425.287) [-427.590] (-427.362) * (-428.087) [-426.197] (-426.833) (-428.958) -- 0:00:17
714000 -- (-427.048) (-426.567) [-429.977] (-428.733) * (-426.533) (-425.612) (-427.856) [-427.032] -- 0:00:17
714500 -- (-425.894) [-426.744] (-424.771) (-429.911) * (-427.048) (-425.735) (-428.381) [-426.444] -- 0:00:17
715000 -- [-425.374] (-426.429) (-424.552) (-431.473) * (-427.240) [-426.362] (-427.137) (-432.183) -- 0:00:17
Average standard deviation of split frequencies: 0.006296
715500 -- (-429.276) (-426.006) [-427.345] (-431.104) * (-429.166) (-427.249) [-427.448] (-431.078) -- 0:00:17
716000 -- (-425.165) [-426.234] (-426.408) (-436.507) * (-425.183) (-426.898) (-429.084) [-425.465] -- 0:00:17
716500 -- (-426.100) [-425.988] (-425.069) (-433.562) * (-427.040) (-425.475) [-425.958] (-425.196) -- 0:00:17
717000 -- [-427.837] (-427.014) (-427.418) (-427.873) * (-427.561) (-424.978) [-428.575] (-428.633) -- 0:00:16
717500 -- (-425.862) [-425.484] (-425.753) (-428.151) * (-429.508) (-424.538) [-424.718] (-429.880) -- 0:00:16
718000 -- (-425.425) (-426.740) (-425.618) [-426.182] * (-427.109) (-426.630) (-427.389) [-426.870] -- 0:00:17
718500 -- [-427.957] (-426.390) (-425.440) (-429.675) * (-425.108) (-427.179) (-424.769) [-425.836] -- 0:00:17
719000 -- (-430.112) (-426.518) [-426.378] (-429.167) * (-426.718) (-426.122) [-426.919] (-426.436) -- 0:00:17
719500 -- (-428.461) (-425.680) (-426.624) [-425.847] * (-424.494) [-425.412] (-427.346) (-426.671) -- 0:00:17
720000 -- (-428.434) [-425.274] (-424.795) (-425.658) * (-427.738) (-430.022) [-425.341] (-426.362) -- 0:00:17
Average standard deviation of split frequencies: 0.006541
720500 -- [-428.560] (-425.559) (-427.570) (-425.272) * (-426.239) (-427.041) (-429.221) [-425.426] -- 0:00:17
721000 -- (-426.739) (-426.337) [-426.426] (-426.710) * (-425.744) (-427.678) (-425.304) [-426.156] -- 0:00:17
721500 -- (-427.378) [-429.258] (-427.451) (-426.502) * (-428.045) (-426.232) [-425.669] (-427.506) -- 0:00:16
722000 -- (-430.223) (-426.865) (-425.324) [-430.910] * (-428.832) (-428.937) [-427.625] (-425.693) -- 0:00:16
722500 -- [-426.766] (-430.909) (-428.264) (-425.809) * (-427.905) [-426.613] (-427.706) (-427.600) -- 0:00:16
723000 -- (-430.028) (-427.871) [-429.475] (-427.527) * (-428.624) (-425.082) (-426.859) [-429.168] -- 0:00:16
723500 -- (-428.551) [-426.148] (-427.097) (-425.738) * [-425.535] (-425.256) (-426.604) (-428.759) -- 0:00:16
724000 -- (-429.221) (-426.096) (-429.873) [-427.294] * [-426.891] (-427.982) (-425.100) (-432.484) -- 0:00:16
724500 -- [-426.745] (-426.628) (-434.264) (-427.620) * (-427.596) [-426.692] (-425.281) (-426.698) -- 0:00:16
725000 -- (-428.725) [-424.906] (-428.794) (-427.824) * (-428.839) (-429.555) (-426.605) [-428.217] -- 0:00:16
Average standard deviation of split frequencies: 0.006615
725500 -- (-427.150) [-426.549] (-428.354) (-425.376) * (-428.185) (-427.168) (-425.507) [-427.096] -- 0:00:16
726000 -- (-426.786) (-426.820) [-426.926] (-431.687) * (-427.187) [-428.180] (-425.688) (-426.621) -- 0:00:16
726500 -- (-425.991) (-432.951) [-424.941] (-428.586) * [-426.702] (-426.341) (-425.816) (-426.495) -- 0:00:16
727000 -- (-431.436) (-425.777) (-426.514) [-430.371] * (-426.965) (-431.293) [-424.810] (-425.773) -- 0:00:16
727500 -- (-425.365) [-425.827] (-431.826) (-429.386) * (-428.203) (-428.164) [-426.374] (-426.124) -- 0:00:16
728000 -- (-425.462) [-425.278] (-428.928) (-428.713) * (-427.125) (-426.669) (-425.652) [-427.600] -- 0:00:16
728500 -- (-425.752) (-425.099) [-425.756] (-426.686) * (-426.359) [-429.059] (-425.684) (-424.884) -- 0:00:16
729000 -- (-426.120) (-426.719) [-425.646] (-424.898) * (-428.543) [-428.689] (-424.522) (-427.410) -- 0:00:16
729500 -- [-428.452] (-427.109) (-426.394) (-425.871) * [-425.975] (-425.235) (-425.061) (-427.430) -- 0:00:16
730000 -- (-425.674) (-426.924) (-427.766) [-426.312] * [-425.770] (-424.645) (-426.165) (-427.176) -- 0:00:16
Average standard deviation of split frequencies: 0.006492
730500 -- (-428.063) (-428.147) (-430.078) [-426.132] * (-427.893) (-426.984) [-428.241] (-426.443) -- 0:00:16
731000 -- (-428.122) [-426.281] (-425.215) (-426.884) * [-427.849] (-424.971) (-425.610) (-427.515) -- 0:00:16
731500 -- (-432.347) [-426.706] (-425.223) (-426.984) * (-427.563) (-427.065) (-425.892) [-426.004] -- 0:00:16
732000 -- (-432.367) (-426.713) [-428.115] (-428.202) * [-427.130] (-427.955) (-432.378) (-424.632) -- 0:00:16
732500 -- (-428.689) [-426.284] (-426.022) (-428.666) * (-425.936) [-427.781] (-426.677) (-426.363) -- 0:00:16
733000 -- [-427.610] (-425.864) (-427.585) (-428.476) * (-427.571) (-428.239) [-427.117] (-426.429) -- 0:00:16
733500 -- (-428.354) (-425.457) [-428.502] (-426.758) * (-429.204) (-430.885) (-428.682) [-424.752] -- 0:00:15
734000 -- (-425.784) [-425.267] (-430.028) (-424.766) * (-427.399) (-429.411) [-431.202] (-425.458) -- 0:00:15
734500 -- (-428.639) (-428.090) (-428.902) [-427.902] * (-431.148) (-427.239) (-428.637) [-425.743] -- 0:00:16
735000 -- (-428.244) [-427.746] (-424.968) (-425.690) * (-434.234) (-428.279) [-430.464] (-426.305) -- 0:00:16
Average standard deviation of split frequencies: 0.006485
735500 -- (-429.333) (-427.632) [-424.781] (-430.016) * (-426.259) [-425.396] (-426.010) (-426.785) -- 0:00:16
736000 -- (-428.155) (-425.446) [-426.255] (-426.249) * (-428.398) (-432.167) (-428.543) [-425.259] -- 0:00:16
736500 -- [-424.699] (-426.880) (-426.401) (-427.670) * (-430.915) [-425.602] (-425.976) (-427.276) -- 0:00:16
737000 -- (-427.540) [-426.907] (-430.966) (-425.145) * (-425.098) [-427.986] (-427.676) (-427.259) -- 0:00:16
737500 -- (-427.107) (-426.894) [-429.327] (-427.260) * (-428.332) [-429.571] (-425.030) (-429.026) -- 0:00:16
738000 -- [-426.395] (-426.659) (-427.025) (-430.736) * [-427.161] (-428.896) (-428.270) (-429.220) -- 0:00:15
738500 -- [-428.631] (-427.276) (-428.867) (-425.077) * (-429.540) (-426.521) (-426.305) [-426.676] -- 0:00:15
739000 -- [-426.436] (-426.584) (-426.744) (-428.666) * (-426.839) (-426.020) [-426.313] (-428.482) -- 0:00:15
739500 -- [-427.516] (-426.192) (-429.018) (-426.742) * (-426.675) [-426.012] (-430.729) (-426.926) -- 0:00:15
740000 -- [-427.447] (-427.634) (-427.347) (-428.710) * (-428.458) [-427.440] (-427.182) (-424.852) -- 0:00:15
Average standard deviation of split frequencies: 0.006842
740500 -- [-426.329] (-425.989) (-425.913) (-427.741) * [-427.775] (-427.387) (-428.700) (-426.227) -- 0:00:15
741000 -- (-428.202) [-431.742] (-425.396) (-426.184) * (-426.324) [-425.657] (-425.683) (-434.428) -- 0:00:15
741500 -- (-426.376) [-427.222] (-426.834) (-427.462) * (-430.218) (-424.714) (-429.973) [-427.815] -- 0:00:15
742000 -- (-426.235) [-426.558] (-426.184) (-426.477) * [-427.915] (-426.292) (-426.442) (-429.793) -- 0:00:15
742500 -- (-426.152) (-425.990) (-426.587) [-425.213] * (-427.263) (-426.125) [-425.158] (-427.337) -- 0:00:15
743000 -- (-424.806) (-426.209) (-428.480) [-428.133] * (-427.148) (-429.590) [-425.723] (-425.611) -- 0:00:15
743500 -- (-426.488) (-426.448) (-429.889) [-428.414] * [-424.779] (-425.911) (-425.923) (-427.229) -- 0:00:15
744000 -- [-427.882] (-425.271) (-426.879) (-426.302) * (-424.781) (-427.402) (-426.200) [-427.749] -- 0:00:15
744500 -- (-427.976) (-429.278) [-426.808] (-426.565) * (-425.661) (-426.095) [-426.600] (-429.252) -- 0:00:15
745000 -- (-430.319) (-430.200) [-428.558] (-425.991) * (-429.502) [-425.268] (-425.831) (-427.495) -- 0:00:15
Average standard deviation of split frequencies: 0.006517
745500 -- (-427.694) [-425.147] (-426.578) (-427.806) * (-426.173) (-429.760) [-426.512] (-425.152) -- 0:00:15
746000 -- (-426.793) [-427.799] (-426.298) (-431.016) * (-428.567) [-426.387] (-429.523) (-426.492) -- 0:00:15
746500 -- (-427.660) (-427.175) [-426.132] (-428.185) * (-428.154) [-424.908] (-425.445) (-426.612) -- 0:00:15
747000 -- (-427.039) [-426.775] (-427.742) (-427.227) * (-426.851) (-424.856) [-425.898] (-426.974) -- 0:00:15
747500 -- [-430.663] (-427.518) (-425.751) (-426.211) * (-425.727) (-425.881) [-428.993] (-426.699) -- 0:00:15
748000 -- (-425.435) (-428.194) [-429.315] (-425.694) * (-426.670) [-428.560] (-426.201) (-425.923) -- 0:00:15
748500 -- [-425.479] (-426.937) (-429.766) (-425.499) * [-426.859] (-426.495) (-426.937) (-425.483) -- 0:00:15
749000 -- [-427.774] (-427.984) (-426.069) (-425.408) * (-425.431) (-425.436) [-428.722] (-425.535) -- 0:00:15
749500 -- (-426.294) [-426.849] (-428.683) (-427.814) * (-425.965) [-425.282] (-426.998) (-427.988) -- 0:00:15
750000 -- (-426.171) (-430.027) (-429.268) [-425.982] * (-427.484) [-424.838] (-424.624) (-426.083) -- 0:00:15
Average standard deviation of split frequencies: 0.006672
750500 -- (-425.796) (-428.172) (-425.386) [-426.578] * [-426.951] (-427.071) (-425.711) (-428.021) -- 0:00:15
751000 -- (-427.522) [-426.732] (-426.691) (-428.723) * [-424.788] (-426.127) (-427.652) (-426.744) -- 0:00:15
751500 -- (-430.068) (-433.350) (-426.729) [-429.922] * (-425.909) [-425.428] (-429.444) (-426.356) -- 0:00:15
752000 -- (-425.003) (-427.096) [-427.829] (-424.584) * (-427.140) (-427.104) (-430.459) [-425.978] -- 0:00:15
752500 -- (-426.911) (-429.088) [-425.887] (-424.568) * (-429.811) (-430.310) [-426.005] (-425.091) -- 0:00:15
753000 -- (-425.088) (-428.412) (-425.495) [-426.481] * (-425.815) (-424.850) [-429.672] (-425.999) -- 0:00:15
753500 -- (-424.770) [-428.602] (-425.971) (-426.888) * (-426.085) (-427.448) [-425.457] (-426.135) -- 0:00:15
754000 -- (-431.684) (-426.050) [-425.370] (-431.296) * [-425.382] (-427.477) (-428.702) (-425.574) -- 0:00:15
754500 -- [-426.614] (-426.429) (-426.576) (-425.779) * (-431.178) [-427.038] (-426.930) (-431.345) -- 0:00:14
755000 -- (-427.669) (-426.139) [-424.912] (-426.721) * (-434.193) [-427.477] (-426.857) (-438.451) -- 0:00:14
Average standard deviation of split frequencies: 0.006277
755500 -- [-430.160] (-429.241) (-430.858) (-426.114) * (-426.323) (-425.426) [-427.253] (-434.572) -- 0:00:14
756000 -- (-425.132) [-424.816] (-430.740) (-427.529) * (-427.375) (-426.601) [-425.408] (-427.920) -- 0:00:14
756500 -- (-425.675) [-424.956] (-427.898) (-430.730) * (-427.274) [-426.137] (-425.483) (-425.761) -- 0:00:14
757000 -- [-425.032] (-426.489) (-426.462) (-428.325) * (-428.136) (-426.126) (-424.959) [-425.148] -- 0:00:14
757500 -- [-424.995] (-426.989) (-428.854) (-429.112) * (-427.306) (-424.593) (-426.806) [-428.213] -- 0:00:14
758000 -- (-426.186) (-425.857) (-432.588) [-425.388] * (-428.192) [-426.585] (-426.529) (-427.178) -- 0:00:14
758500 -- (-426.593) (-427.676) [-427.504] (-425.208) * [-425.241] (-432.209) (-428.413) (-427.789) -- 0:00:14
759000 -- (-427.492) (-428.740) [-424.828] (-427.125) * (-424.826) (-428.571) (-429.256) [-426.782] -- 0:00:14
759500 -- (-425.750) [-426.752] (-425.165) (-428.659) * (-427.396) (-428.433) [-427.628] (-425.362) -- 0:00:14
760000 -- (-425.882) (-427.028) [-425.430] (-433.243) * (-424.996) (-426.250) (-430.294) [-425.030] -- 0:00:14
Average standard deviation of split frequencies: 0.006239
760500 -- [-427.653] (-427.042) (-424.971) (-425.369) * (-425.332) (-425.950) [-425.231] (-427.470) -- 0:00:14
761000 -- [-426.911] (-428.896) (-425.793) (-426.682) * (-426.569) (-427.062) (-425.209) [-428.967] -- 0:00:14
761500 -- [-426.192] (-430.852) (-426.174) (-426.598) * (-427.107) [-431.891] (-424.928) (-427.419) -- 0:00:14
762000 -- (-428.292) [-425.925] (-425.857) (-427.845) * [-426.138] (-427.530) (-425.041) (-425.819) -- 0:00:14
762500 -- (-429.320) [-425.782] (-426.432) (-428.839) * (-426.820) (-427.957) (-425.587) [-426.141] -- 0:00:14
763000 -- (-426.322) [-426.442] (-426.455) (-425.653) * (-429.459) (-426.119) (-426.494) [-426.649] -- 0:00:14
763500 -- (-428.766) (-429.308) (-427.449) [-426.065] * [-425.783] (-426.573) (-427.559) (-426.057) -- 0:00:14
764000 -- (-426.912) [-426.283] (-428.019) (-427.649) * (-426.452) (-429.613) (-427.416) [-424.793] -- 0:00:14
764500 -- (-425.632) [-429.300] (-428.488) (-428.717) * (-424.983) (-427.386) (-425.983) [-424.709] -- 0:00:14
765000 -- (-426.545) [-429.039] (-428.727) (-430.579) * [-427.059] (-424.454) (-426.532) (-425.541) -- 0:00:14
Average standard deviation of split frequencies: 0.006423
765500 -- (-425.749) (-430.408) (-426.922) [-428.602] * (-432.401) (-427.653) [-426.172] (-427.580) -- 0:00:14
766000 -- [-424.934] (-430.745) (-427.529) (-425.651) * (-427.808) (-426.232) (-425.565) [-428.158] -- 0:00:14
766500 -- (-425.811) (-427.430) (-426.741) [-425.755] * (-428.535) (-429.271) (-426.688) [-429.186] -- 0:00:14
767000 -- (-428.081) (-428.912) (-427.716) [-425.573] * (-427.144) (-427.677) (-426.134) [-431.709] -- 0:00:14
767500 -- [-429.771] (-426.362) (-430.602) (-427.421) * (-429.444) (-429.789) [-426.645] (-426.827) -- 0:00:14
768000 -- [-429.350] (-428.848) (-427.859) (-427.132) * (-427.764) (-429.154) (-426.739) [-425.641] -- 0:00:14
768500 -- (-425.130) [-424.944] (-427.186) (-425.546) * (-427.044) (-427.615) (-429.179) [-425.413] -- 0:00:14
769000 -- [-425.741] (-425.355) (-429.571) (-426.430) * [-425.721] (-425.959) (-428.024) (-427.606) -- 0:00:14
769500 -- [-426.063] (-425.228) (-424.959) (-426.672) * (-427.905) (-426.263) (-426.003) [-427.386] -- 0:00:14
770000 -- (-428.508) (-424.879) [-425.835] (-425.268) * (-428.998) (-425.798) (-429.030) [-426.474] -- 0:00:14
Average standard deviation of split frequencies: 0.006614
770500 -- (-425.988) (-425.184) [-425.385] (-425.698) * (-428.239) (-427.852) (-429.880) [-426.419] -- 0:00:13
771000 -- (-429.172) (-425.865) (-425.035) [-425.759] * [-427.685] (-428.788) (-427.527) (-426.309) -- 0:00:13
771500 -- (-429.538) (-426.050) (-424.527) [-426.001] * [-428.279] (-425.716) (-425.868) (-427.953) -- 0:00:13
772000 -- (-426.092) [-425.444] (-427.589) (-429.238) * (-428.990) (-428.035) (-429.017) [-428.522] -- 0:00:13
772500 -- [-426.817] (-428.505) (-428.762) (-429.816) * (-425.093) (-427.384) (-428.032) [-426.892] -- 0:00:13
773000 -- (-429.461) [-425.022] (-427.302) (-429.746) * (-425.822) (-424.817) [-426.293] (-425.484) -- 0:00:13
773500 -- (-428.295) (-430.610) [-425.284] (-425.778) * (-427.588) (-426.367) [-427.544] (-428.299) -- 0:00:13
774000 -- (-425.766) (-432.190) (-426.998) [-425.074] * [-427.527] (-425.919) (-429.002) (-430.201) -- 0:00:13
774500 -- (-432.780) [-427.015] (-426.010) (-427.080) * (-428.037) [-424.880] (-430.667) (-429.173) -- 0:00:13
775000 -- (-430.295) (-427.863) [-425.509] (-430.421) * (-425.000) (-426.733) (-430.991) [-425.141] -- 0:00:13
Average standard deviation of split frequencies: 0.006492
775500 -- (-429.532) (-428.836) (-425.387) [-425.209] * (-427.131) (-428.149) (-426.615) [-429.423] -- 0:00:13
776000 -- (-426.687) (-429.315) (-426.707) [-424.779] * (-427.514) (-427.253) [-426.670] (-429.210) -- 0:00:13
776500 -- (-427.325) (-425.708) (-425.039) [-425.515] * (-428.428) (-426.826) (-431.117) [-427.322] -- 0:00:13
777000 -- (-428.097) (-425.781) [-428.586] (-427.861) * (-426.281) (-425.996) (-427.608) [-426.656] -- 0:00:13
777500 -- (-430.397) (-425.230) (-425.429) [-425.817] * (-428.657) [-426.314] (-429.581) (-426.206) -- 0:00:13
778000 -- (-427.258) (-425.344) (-425.243) [-425.106] * (-429.466) (-426.040) [-426.885] (-424.778) -- 0:00:13
778500 -- (-426.687) (-426.009) [-426.009] (-424.443) * (-428.715) (-425.111) (-430.596) [-428.396] -- 0:00:13
779000 -- (-430.665) [-427.343] (-425.846) (-429.480) * (-426.237) [-427.895] (-425.235) (-429.475) -- 0:00:13
779500 -- (-426.189) [-426.522] (-427.411) (-428.987) * (-426.138) (-426.858) [-425.440] (-427.373) -- 0:00:13
780000 -- (-425.231) [-426.578] (-425.030) (-428.612) * (-427.226) (-426.268) [-425.638] (-428.372) -- 0:00:13
Average standard deviation of split frequencies: 0.006378
780500 -- [-424.718] (-428.218) (-429.085) (-432.927) * (-425.881) (-426.368) (-425.506) [-425.805] -- 0:00:13
781000 -- (-428.170) (-428.931) [-428.574] (-426.598) * (-426.011) [-424.650] (-427.325) (-425.473) -- 0:00:13
781500 -- (-431.087) (-427.064) (-426.484) [-425.606] * (-425.852) (-425.082) (-427.883) [-425.673] -- 0:00:13
782000 -- [-429.537] (-433.483) (-425.149) (-428.228) * (-425.665) (-425.275) [-429.918] (-428.093) -- 0:00:13
782500 -- (-426.756) (-427.461) [-428.108] (-429.091) * (-425.068) (-426.105) (-426.621) [-426.330] -- 0:00:13
783000 -- (-426.028) [-429.509] (-429.897) (-427.652) * (-429.691) (-430.763) (-427.733) [-430.992] -- 0:00:13
783500 -- (-429.765) (-425.550) (-427.695) [-424.982] * (-424.765) [-430.607] (-429.588) (-426.678) -- 0:00:13
784000 -- (-426.307) (-426.996) [-426.738] (-425.790) * (-424.812) (-435.244) [-427.919] (-427.994) -- 0:00:13
784500 -- (-428.311) (-425.359) (-428.016) [-426.460] * (-427.102) [-424.412] (-426.335) (-428.439) -- 0:00:13
785000 -- (-427.860) (-427.477) [-427.672] (-427.463) * (-429.934) (-427.569) [-426.605] (-426.519) -- 0:00:13
Average standard deviation of split frequencies: 0.006522
785500 -- (-427.449) (-428.749) (-429.473) [-426.346] * (-427.906) (-426.814) (-427.518) [-427.540] -- 0:00:13
786000 -- (-428.311) [-426.366] (-432.190) (-428.640) * [-426.131] (-427.013) (-427.467) (-428.089) -- 0:00:13
786500 -- [-427.891] (-426.196) (-427.672) (-428.083) * (-427.713) (-427.165) [-427.241] (-429.816) -- 0:00:13
787000 -- (-425.364) (-429.609) [-424.485] (-427.566) * (-426.204) (-426.773) [-427.288] (-427.167) -- 0:00:12
787500 -- (-424.914) (-430.089) (-425.357) [-433.173] * [-427.523] (-426.427) (-426.108) (-426.829) -- 0:00:12
788000 -- (-425.897) [-427.347] (-425.248) (-434.290) * (-424.684) (-426.106) [-424.947] (-425.421) -- 0:00:12
788500 -- (-428.316) (-427.228) (-426.374) [-427.937] * (-424.709) [-427.023] (-427.779) (-429.960) -- 0:00:12
789000 -- [-428.371] (-429.320) (-427.073) (-425.444) * (-425.081) (-429.656) [-428.011] (-429.869) -- 0:00:12
789500 -- (-428.197) [-429.586] (-430.621) (-426.439) * (-425.015) [-427.582] (-427.332) (-426.985) -- 0:00:12
790000 -- (-424.628) (-433.948) [-425.179] (-428.552) * (-426.160) [-426.923] (-428.584) (-427.717) -- 0:00:12
Average standard deviation of split frequencies: 0.006596
790500 -- [-425.621] (-429.198) (-426.500) (-426.048) * (-425.195) [-427.020] (-432.314) (-426.783) -- 0:00:12
791000 -- (-426.391) [-426.350] (-428.643) (-427.081) * [-426.268] (-425.851) (-426.676) (-429.386) -- 0:00:12
791500 -- (-426.429) [-428.943] (-429.274) (-426.376) * [-427.719] (-428.553) (-424.480) (-425.633) -- 0:00:12
792000 -- (-425.113) [-426.058] (-426.804) (-428.523) * (-425.253) (-430.563) [-426.498] (-427.310) -- 0:00:12
792500 -- [-427.420] (-429.505) (-429.080) (-429.522) * (-426.115) (-426.003) (-425.241) [-426.654] -- 0:00:12
793000 -- (-427.236) (-426.828) [-425.440] (-430.446) * (-430.846) (-430.755) [-425.043] (-425.075) -- 0:00:12
793500 -- (-428.819) [-427.937] (-425.429) (-425.980) * [-426.837] (-432.392) (-425.555) (-429.492) -- 0:00:12
794000 -- (-425.183) (-428.717) [-427.011] (-426.445) * (-425.908) (-427.370) [-426.406] (-426.823) -- 0:00:12
794500 -- (-427.843) (-428.888) [-424.985] (-428.139) * (-426.608) (-426.703) (-427.088) [-425.099] -- 0:00:12
795000 -- (-427.765) (-426.837) [-425.557] (-425.605) * (-428.852) (-425.268) (-428.470) [-425.514] -- 0:00:12
Average standard deviation of split frequencies: 0.006773
795500 -- (-427.941) [-427.250] (-425.247) (-428.587) * [-428.348] (-426.608) (-433.036) (-425.604) -- 0:00:12
796000 -- (-426.768) [-426.217] (-427.756) (-429.020) * (-428.291) (-427.162) [-425.394] (-424.933) -- 0:00:12
796500 -- (-430.954) (-431.799) [-428.112] (-431.603) * (-427.888) [-427.412] (-427.141) (-426.353) -- 0:00:12
797000 -- (-427.114) [-425.153] (-426.971) (-426.578) * (-425.205) (-429.566) (-427.915) [-426.416] -- 0:00:12
797500 -- (-424.988) (-425.487) [-428.868] (-424.921) * [-424.816] (-430.106) (-430.124) (-427.202) -- 0:00:12
798000 -- (-428.494) (-426.953) [-427.399] (-427.726) * (-427.824) [-425.529] (-428.954) (-429.715) -- 0:00:12
798500 -- (-428.819) (-427.368) [-426.092] (-426.761) * (-427.652) (-427.542) [-427.200] (-428.619) -- 0:00:12
799000 -- (-428.873) [-425.374] (-425.507) (-425.539) * (-430.484) [-425.311] (-431.345) (-427.225) -- 0:00:12
799500 -- (-428.999) (-427.100) [-427.808] (-424.912) * (-427.736) [-426.221] (-429.169) (-429.237) -- 0:00:12
800000 -- (-426.867) [-428.654] (-426.282) (-424.851) * [-424.881] (-426.513) (-427.183) (-429.307) -- 0:00:12
Average standard deviation of split frequencies: 0.006992
800500 -- (-430.546) [-427.714] (-428.050) (-424.741) * (-425.011) (-427.166) (-427.720) [-426.483] -- 0:00:12
801000 -- (-428.645) [-426.412] (-428.445) (-425.449) * (-427.603) [-426.719] (-427.832) (-426.696) -- 0:00:12
801500 -- (-426.597) (-425.238) (-428.497) [-426.957] * (-426.340) (-426.880) (-425.989) [-425.504] -- 0:00:12
802000 -- (-424.994) (-427.419) (-428.410) [-427.363] * [-427.213] (-425.933) (-430.558) (-427.341) -- 0:00:12
802500 -- (-428.179) [-425.426] (-426.478) (-430.023) * (-428.852) (-425.055) [-427.809] (-430.285) -- 0:00:12
803000 -- (-427.613) [-428.710] (-429.040) (-426.863) * (-428.068) (-427.426) (-429.234) [-427.447] -- 0:00:12
803500 -- (-426.824) [-428.296] (-429.181) (-428.808) * (-428.664) [-428.557] (-428.089) (-426.744) -- 0:00:11
804000 -- (-426.713) [-426.616] (-425.950) (-426.621) * (-429.963) (-429.635) (-428.482) [-425.899] -- 0:00:11
804500 -- (-427.917) [-427.167] (-425.857) (-427.794) * (-426.415) (-426.111) (-428.871) [-428.047] -- 0:00:11
805000 -- (-425.126) (-429.325) (-426.339) [-427.289] * (-428.880) (-425.383) [-425.156] (-426.033) -- 0:00:11
Average standard deviation of split frequencies: 0.006726
805500 -- (-428.225) [-428.006] (-425.550) (-425.638) * [-426.430] (-428.075) (-426.873) (-424.753) -- 0:00:11
806000 -- (-432.078) (-426.600) [-427.398] (-429.686) * (-426.914) [-427.057] (-429.665) (-425.188) -- 0:00:11
806500 -- (-425.514) (-430.292) (-426.098) [-426.379] * (-428.611) [-425.069] (-426.588) (-430.626) -- 0:00:11
807000 -- [-427.377] (-428.193) (-427.217) (-425.979) * (-425.866) (-426.882) (-429.084) [-430.453] -- 0:00:11
807500 -- [-426.878] (-428.978) (-430.467) (-426.156) * (-427.323) [-427.045] (-429.722) (-426.969) -- 0:00:11
808000 -- (-426.922) [-425.332] (-427.599) (-431.442) * (-429.416) (-431.669) (-427.248) [-425.365] -- 0:00:11
808500 -- [-425.569] (-426.188) (-425.737) (-427.148) * (-427.313) [-426.664] (-426.790) (-428.857) -- 0:00:11
809000 -- [-424.526] (-427.179) (-426.947) (-427.272) * (-427.810) (-426.591) [-425.154] (-429.199) -- 0:00:11
809500 -- (-424.925) [-427.553] (-424.779) (-425.777) * (-426.257) (-427.393) (-425.295) [-426.319] -- 0:00:11
810000 -- [-426.769] (-428.354) (-424.740) (-426.234) * (-424.877) (-430.274) (-425.160) [-426.420] -- 0:00:11
Average standard deviation of split frequencies: 0.006578
810500 -- (-426.499) (-425.231) (-427.724) [-430.227] * (-426.546) [-425.227] (-427.368) (-426.928) -- 0:00:11
811000 -- (-425.986) [-426.426] (-426.692) (-432.690) * (-426.553) (-427.895) [-427.651] (-426.594) -- 0:00:11
811500 -- (-427.469) [-428.124] (-427.291) (-427.825) * [-425.845] (-427.109) (-425.624) (-427.629) -- 0:00:11
812000 -- (-426.546) (-428.113) [-425.462] (-425.661) * [-424.769] (-426.148) (-429.637) (-425.064) -- 0:00:11
812500 -- (-424.929) (-428.611) [-425.152] (-428.682) * (-426.872) [-425.221] (-428.014) (-425.223) -- 0:00:11
813000 -- (-428.373) (-425.431) [-425.977] (-428.407) * (-425.805) (-426.106) (-432.246) [-425.920] -- 0:00:11
813500 -- [-428.968] (-426.491) (-429.774) (-427.817) * (-430.796) (-424.695) (-425.640) [-427.008] -- 0:00:11
814000 -- (-425.997) [-425.215] (-429.634) (-425.479) * [-426.048] (-426.906) (-429.491) (-426.456) -- 0:00:11
814500 -- (-426.397) [-425.894] (-425.275) (-426.934) * (-428.469) (-428.977) (-425.571) [-428.270] -- 0:00:11
815000 -- (-426.667) (-425.826) (-432.838) [-427.770] * [-426.700] (-426.207) (-425.633) (-427.525) -- 0:00:11
Average standard deviation of split frequencies: 0.006740
815500 -- (-426.135) (-424.883) [-426.438] (-427.006) * (-426.301) (-427.887) (-427.770) [-425.101] -- 0:00:11
816000 -- [-426.202] (-427.713) (-426.191) (-427.188) * (-431.149) [-425.075] (-430.526) (-426.853) -- 0:00:11
816500 -- [-429.505] (-425.625) (-425.294) (-427.087) * [-429.892] (-427.860) (-429.543) (-429.543) -- 0:00:11
817000 -- (-426.769) (-425.310) (-424.600) [-425.005] * (-433.211) [-426.078] (-425.605) (-426.019) -- 0:00:11
817500 -- (-425.344) (-427.900) [-427.202] (-425.991) * (-431.137) [-426.188] (-424.740) (-429.276) -- 0:00:11
818000 -- (-427.258) (-426.993) [-426.666] (-426.129) * [-429.361] (-428.449) (-429.219) (-429.200) -- 0:00:11
818500 -- (-426.490) (-426.594) (-426.974) [-424.972] * [-426.012] (-429.056) (-426.565) (-427.317) -- 0:00:11
819000 -- (-424.750) [-425.576] (-425.856) (-426.958) * [-428.353] (-430.399) (-427.587) (-428.256) -- 0:00:11
819500 -- (-424.699) (-429.136) (-428.431) [-426.142] * (-428.828) (-427.004) (-430.468) [-427.184] -- 0:00:11
820000 -- (-424.699) [-428.472] (-427.633) (-428.408) * (-430.238) (-426.890) (-426.435) [-427.879] -- 0:00:10
Average standard deviation of split frequencies: 0.006548
820500 -- [-426.683] (-425.592) (-427.101) (-426.853) * (-433.562) [-425.833] (-424.633) (-428.764) -- 0:00:10
821000 -- (-427.359) [-426.589] (-428.656) (-425.548) * (-427.129) (-426.448) [-424.442] (-428.566) -- 0:00:10
821500 -- (-428.005) (-425.817) (-428.317) [-429.328] * (-424.961) [-426.104] (-425.334) (-424.815) -- 0:00:10
822000 -- (-427.126) [-425.127] (-425.597) (-428.887) * (-426.544) [-426.967] (-427.493) (-424.741) -- 0:00:10
822500 -- [-425.114] (-426.380) (-428.779) (-427.326) * (-426.188) [-425.005] (-426.941) (-427.200) -- 0:00:10
823000 -- (-427.240) (-427.542) (-425.458) [-427.110] * (-425.381) [-425.620] (-425.732) (-426.118) -- 0:00:10
823500 -- [-426.558] (-427.000) (-425.610) (-425.791) * (-430.630) [-427.040] (-425.444) (-429.800) -- 0:00:10
824000 -- (-424.998) (-427.225) [-425.053] (-426.238) * [-427.451] (-428.716) (-428.101) (-426.521) -- 0:00:10
824500 -- [-429.757] (-425.120) (-424.910) (-426.960) * [-430.984] (-428.041) (-426.101) (-426.548) -- 0:00:10
825000 -- [-427.554] (-427.970) (-425.357) (-433.475) * [-426.587] (-425.848) (-427.503) (-429.278) -- 0:00:10
Average standard deviation of split frequencies: 0.006963
825500 -- (-429.627) (-426.444) (-426.268) [-432.001] * [-425.522] (-425.113) (-427.514) (-430.622) -- 0:00:10
826000 -- (-427.529) (-428.104) (-426.568) [-428.508] * [-425.271] (-424.782) (-427.187) (-425.424) -- 0:00:10
826500 -- (-428.202) (-426.805) [-425.752] (-432.020) * (-425.171) (-426.601) (-427.461) [-425.847] -- 0:00:10
827000 -- (-425.736) (-427.827) (-431.610) [-426.804] * [-431.793] (-432.666) (-425.152) (-425.017) -- 0:00:10
827500 -- (-426.421) (-430.083) (-427.626) [-424.988] * (-425.194) (-429.543) (-430.128) [-426.524] -- 0:00:10
828000 -- (-425.935) [-426.603] (-425.114) (-425.738) * (-426.617) [-427.672] (-428.110) (-425.110) -- 0:00:10
828500 -- (-426.022) (-426.726) [-424.992] (-426.637) * (-428.949) (-428.742) (-427.604) [-429.313] -- 0:00:10
829000 -- (-427.306) (-426.118) (-427.049) [-426.550] * [-429.130] (-427.751) (-428.158) (-424.768) -- 0:00:10
829500 -- [-426.420] (-425.311) (-429.649) (-429.301) * (-425.777) (-426.056) (-426.532) [-428.191] -- 0:00:10
830000 -- (-427.081) [-425.586] (-429.124) (-431.699) * (-426.502) [-425.021] (-431.729) (-425.822) -- 0:00:10
Average standard deviation of split frequencies: 0.006999
830500 -- (-425.811) (-425.880) [-425.134] (-426.513) * [-427.363] (-426.326) (-427.095) (-427.521) -- 0:00:10
831000 -- (-427.615) (-426.642) (-426.075) [-427.211] * (-428.164) (-424.970) (-429.590) [-426.852] -- 0:00:10
831500 -- [-425.839] (-429.232) (-426.561) (-428.230) * [-426.269] (-425.482) (-424.648) (-429.416) -- 0:00:10
832000 -- (-426.394) (-425.880) [-427.121] (-427.669) * [-427.950] (-427.771) (-424.679) (-429.657) -- 0:00:10
832500 -- (-426.802) [-425.015] (-427.174) (-428.125) * (-428.668) (-430.113) [-425.538] (-428.703) -- 0:00:10
833000 -- (-426.304) (-432.983) (-427.594) [-428.651] * (-426.795) [-426.254] (-427.545) (-430.908) -- 0:00:10
833500 -- (-429.491) [-429.305] (-429.236) (-425.988) * [-427.744] (-427.114) (-424.900) (-429.159) -- 0:00:10
834000 -- (-428.546) [-429.100] (-429.527) (-425.121) * [-425.140] (-426.037) (-424.896) (-426.424) -- 0:00:10
834500 -- (-426.528) (-430.193) (-427.798) [-427.583] * (-425.457) (-425.392) (-431.919) [-425.589] -- 0:00:10
835000 -- [-425.223] (-428.214) (-426.123) (-426.942) * (-425.696) [-426.606] (-426.442) (-426.003) -- 0:00:10
Average standard deviation of split frequencies: 0.007225
835500 -- (-425.584) (-429.292) [-426.638] (-426.781) * (-431.328) [-428.567] (-426.358) (-427.505) -- 0:00:10
836000 -- [-426.366] (-425.493) (-427.799) (-427.160) * (-429.045) (-428.816) (-426.531) [-426.321] -- 0:00:10
836500 -- (-424.648) (-426.300) [-427.822] (-428.264) * [-426.473] (-427.244) (-427.521) (-426.825) -- 0:00:09
837000 -- (-430.008) [-428.815] (-428.834) (-426.471) * (-426.513) (-425.685) (-427.246) [-426.187] -- 0:00:09
837500 -- (-428.309) (-429.022) (-431.574) [-426.185] * [-425.368] (-427.796) (-426.876) (-428.735) -- 0:00:09
838000 -- (-424.765) (-425.288) [-426.813] (-427.139) * (-427.408) (-428.391) [-426.180] (-425.929) -- 0:00:09
838500 -- [-426.353] (-425.452) (-427.191) (-430.801) * (-430.122) (-427.454) [-427.272] (-429.270) -- 0:00:09
839000 -- (-425.345) (-427.306) (-431.542) [-425.679] * (-429.363) (-426.691) [-427.245] (-430.389) -- 0:00:09
839500 -- (-426.186) (-428.149) [-425.945] (-426.443) * [-429.096] (-426.666) (-425.458) (-425.476) -- 0:00:09
840000 -- (-426.432) (-425.129) (-425.381) [-424.835] * (-427.390) (-428.024) [-425.028] (-426.191) -- 0:00:09
Average standard deviation of split frequencies: 0.007570
840500 -- [-427.722] (-427.367) (-424.796) (-427.280) * (-431.500) (-429.127) (-425.635) [-428.808] -- 0:00:09
841000 -- (-426.873) (-429.540) [-424.770] (-426.508) * [-424.723] (-430.636) (-425.528) (-427.194) -- 0:00:09
841500 -- [-427.416] (-432.006) (-428.649) (-428.154) * (-427.572) [-428.093] (-425.847) (-427.675) -- 0:00:09
842000 -- (-426.583) [-425.512] (-427.214) (-429.361) * [-428.213] (-427.049) (-426.358) (-426.352) -- 0:00:09
842500 -- [-428.025] (-424.746) (-425.412) (-427.987) * (-431.529) (-427.475) [-425.848] (-428.953) -- 0:00:09
843000 -- (-426.393) (-425.878) (-431.234) [-429.581] * (-425.940) (-427.124) [-426.533] (-427.445) -- 0:00:09
843500 -- [-425.878] (-425.222) (-426.618) (-430.684) * [-424.854] (-428.182) (-425.115) (-425.918) -- 0:00:09
844000 -- (-426.999) [-427.906] (-427.299) (-426.516) * [-424.737] (-425.936) (-426.424) (-426.160) -- 0:00:09
844500 -- (-426.871) [-425.919] (-425.956) (-430.424) * (-425.254) (-425.874) [-430.051] (-427.581) -- 0:00:09
845000 -- [-426.707] (-426.544) (-430.894) (-430.911) * [-429.459] (-425.272) (-425.229) (-425.984) -- 0:00:09
Average standard deviation of split frequencies: 0.007801
845500 -- [-428.725] (-426.787) (-426.834) (-425.656) * (-429.641) (-427.189) (-427.988) [-425.927] -- 0:00:09
846000 -- (-430.028) [-426.598] (-426.736) (-426.954) * (-425.459) (-426.256) (-426.914) [-426.694] -- 0:00:09
846500 -- (-427.453) [-426.512] (-426.573) (-425.499) * (-426.248) (-432.495) (-426.110) [-426.569] -- 0:00:09
847000 -- (-428.582) [-424.968] (-427.292) (-427.425) * (-428.006) [-425.897] (-430.278) (-426.494) -- 0:00:09
847500 -- (-430.329) (-427.850) [-425.383] (-425.968) * (-429.182) [-426.791] (-432.941) (-427.063) -- 0:00:09
848000 -- (-429.976) (-427.967) [-428.191] (-427.572) * (-429.912) [-426.335] (-425.841) (-427.693) -- 0:00:09
848500 -- (-425.829) [-429.973] (-425.855) (-428.510) * [-427.353] (-427.358) (-426.577) (-425.571) -- 0:00:09
849000 -- (-426.598) [-427.512] (-429.386) (-427.398) * (-426.670) (-428.462) [-426.878] (-427.300) -- 0:00:09
849500 -- (-425.517) (-425.998) (-432.729) [-426.682] * (-426.210) (-426.079) [-430.037] (-428.882) -- 0:00:09
850000 -- (-430.336) (-424.655) (-431.931) [-425.819] * (-428.877) (-426.466) (-428.813) [-425.928] -- 0:00:09
Average standard deviation of split frequencies: 0.007827
850500 -- [-426.861] (-426.300) (-426.618) (-425.296) * (-426.823) (-426.868) [-425.748] (-429.148) -- 0:00:09
851000 -- (-429.000) [-426.842] (-425.769) (-427.735) * (-428.638) (-428.002) [-424.655] (-426.406) -- 0:00:09
851500 -- (-424.741) [-428.808] (-425.235) (-426.803) * [-426.029] (-428.188) (-427.146) (-429.504) -- 0:00:09
852000 -- [-430.343] (-430.816) (-428.190) (-425.950) * [-425.604] (-427.801) (-426.851) (-428.395) -- 0:00:09
852500 -- [-427.551] (-431.057) (-428.008) (-426.855) * (-425.793) (-425.467) [-427.375] (-428.751) -- 0:00:08
853000 -- (-426.992) [-430.215] (-430.155) (-425.452) * (-425.497) (-431.976) [-427.480] (-424.532) -- 0:00:08
853500 -- [-425.681] (-429.103) (-426.943) (-425.474) * (-426.260) (-428.326) [-425.687] (-424.686) -- 0:00:08
854000 -- (-432.789) (-427.747) [-425.832] (-426.881) * (-425.835) [-425.286] (-429.546) (-426.697) -- 0:00:08
854500 -- (-428.459) (-427.204) [-425.571] (-426.804) * (-426.170) (-430.621) (-425.781) [-427.391] -- 0:00:08
855000 -- [-427.550] (-427.805) (-424.866) (-428.103) * [-426.152] (-430.012) (-426.011) (-425.841) -- 0:00:08
Average standard deviation of split frequencies: 0.007538
855500 -- (-426.705) (-427.208) [-424.916] (-428.907) * (-426.453) [-426.158] (-425.200) (-425.853) -- 0:00:08
856000 -- (-427.540) [-428.154] (-426.844) (-427.851) * (-431.876) [-426.187] (-426.491) (-427.013) -- 0:00:08
856500 -- (-427.133) [-426.506] (-428.038) (-429.443) * (-437.436) [-424.859] (-426.387) (-424.918) -- 0:00:08
857000 -- (-429.802) (-425.682) [-426.037] (-429.832) * [-429.939] (-425.312) (-428.763) (-426.119) -- 0:00:08
857500 -- (-432.082) (-427.576) [-427.838] (-429.048) * (-426.827) (-428.612) [-427.344] (-428.699) -- 0:00:08
858000 -- (-426.026) [-425.180] (-427.404) (-429.423) * [-427.224] (-427.155) (-426.199) (-430.796) -- 0:00:08
858500 -- (-425.897) (-427.950) [-425.736] (-431.223) * (-426.024) [-428.762] (-430.544) (-426.973) -- 0:00:08
859000 -- (-428.938) (-428.310) (-428.185) [-430.160] * (-425.034) [-427.154] (-425.673) (-428.695) -- 0:00:08
859500 -- [-425.408] (-427.072) (-432.524) (-427.223) * (-425.980) (-425.748) [-427.608] (-426.609) -- 0:00:08
860000 -- [-428.390] (-428.885) (-425.791) (-428.410) * (-428.064) (-424.921) (-426.954) [-426.612] -- 0:00:08
Average standard deviation of split frequencies: 0.007565
860500 -- [-425.908] (-428.033) (-425.865) (-425.528) * (-426.859) (-428.716) (-431.951) [-426.409] -- 0:00:08
861000 -- (-424.625) (-430.664) [-424.925] (-426.128) * (-426.213) [-426.351] (-428.393) (-429.669) -- 0:00:08
861500 -- (-425.785) [-428.326] (-425.412) (-425.813) * (-427.590) (-427.412) [-425.254] (-425.641) -- 0:00:08
862000 -- [-426.300] (-428.594) (-425.995) (-426.892) * (-426.470) [-427.166] (-426.538) (-425.228) -- 0:00:08
862500 -- [-427.090] (-429.018) (-426.768) (-425.689) * (-427.122) (-426.103) (-426.366) [-425.905] -- 0:00:08
863000 -- (-425.686) (-430.988) [-430.790] (-426.710) * (-425.734) (-425.315) (-427.819) [-427.455] -- 0:00:08
863500 -- [-427.541] (-427.282) (-428.768) (-426.808) * (-427.516) (-426.376) (-425.859) [-428.530] -- 0:00:08
864000 -- (-425.134) (-426.972) (-432.561) [-427.076] * (-426.852) (-426.565) [-425.724] (-428.168) -- 0:00:08
864500 -- (-428.548) (-426.070) (-431.567) [-428.148] * [-425.510] (-429.729) (-426.257) (-426.534) -- 0:00:08
865000 -- (-428.374) (-425.477) (-435.882) [-425.786] * (-427.800) (-429.435) [-424.844] (-426.282) -- 0:00:08
Average standard deviation of split frequencies: 0.007315
865500 -- (-428.686) (-428.102) (-428.298) [-429.960] * (-426.187) (-430.033) (-425.428) [-425.726] -- 0:00:08
866000 -- (-425.161) (-426.212) (-427.154) [-428.743] * (-429.473) (-427.195) [-427.975] (-426.284) -- 0:00:08
866500 -- (-425.447) [-425.662] (-424.920) (-425.202) * (-426.705) (-427.211) (-426.075) [-427.170] -- 0:00:08
867000 -- (-425.268) [-427.256] (-427.352) (-425.226) * [-425.409] (-426.563) (-425.361) (-424.826) -- 0:00:08
867500 -- (-430.926) [-427.941] (-429.406) (-425.398) * (-426.690) (-426.963) [-424.647] (-427.417) -- 0:00:08
868000 -- [-426.840] (-426.404) (-426.061) (-427.579) * (-428.418) (-427.922) [-427.975] (-429.543) -- 0:00:08
868500 -- (-426.365) [-424.866] (-426.931) (-427.328) * (-427.695) (-426.002) [-425.129] (-424.879) -- 0:00:08
869000 -- (-425.856) [-427.737] (-425.311) (-425.634) * (-426.236) [-426.787] (-425.388) (-425.702) -- 0:00:07
869500 -- (-425.933) (-425.596) (-425.778) [-427.166] * (-426.159) (-427.350) (-425.566) [-426.837] -- 0:00:07
870000 -- (-430.415) (-425.750) [-428.261] (-426.278) * (-429.214) [-426.372] (-427.777) (-425.029) -- 0:00:07
Average standard deviation of split frequencies: 0.007952
870500 -- (-427.137) [-428.032] (-429.294) (-427.932) * (-427.260) (-427.948) [-426.193] (-432.390) -- 0:00:07
871000 -- (-426.498) (-428.103) [-427.019] (-426.161) * (-425.265) (-424.720) (-425.336) [-428.414] -- 0:00:07
871500 -- (-425.326) (-427.755) [-431.357] (-426.669) * (-427.499) [-427.162] (-426.740) (-427.870) -- 0:00:07
872000 -- (-427.158) [-424.973] (-428.210) (-426.319) * [-425.589] (-426.479) (-429.000) (-427.411) -- 0:00:07
872500 -- (-426.107) [-428.334] (-429.022) (-425.673) * (-425.872) (-426.663) [-430.674] (-431.087) -- 0:00:07
873000 -- (-426.590) (-426.918) (-428.072) [-427.792] * (-431.824) (-426.457) [-428.840] (-426.854) -- 0:00:07
873500 -- [-428.976] (-426.609) (-426.775) (-429.419) * [-429.491] (-425.237) (-427.593) (-431.140) -- 0:00:07
874000 -- (-426.391) [-428.227] (-430.366) (-429.652) * (-426.295) (-425.756) (-426.289) [-428.741] -- 0:00:07
874500 -- (-426.772) (-429.634) (-428.246) [-429.547] * (-424.794) (-425.511) (-425.699) [-426.867] -- 0:00:07
875000 -- (-430.479) (-425.198) [-428.112] (-425.750) * (-428.068) [-425.765] (-426.903) (-431.207) -- 0:00:07
Average standard deviation of split frequencies: 0.007601
875500 -- (-425.747) (-427.313) (-429.589) [-425.773] * (-426.342) (-431.162) (-425.874) [-427.409] -- 0:00:07
876000 -- (-427.002) (-426.308) [-429.540] (-427.328) * (-429.692) (-428.586) (-428.986) [-430.930] -- 0:00:07
876500 -- (-425.645) (-426.210) [-427.843] (-426.561) * (-428.038) (-426.504) (-430.537) [-427.069] -- 0:00:07
877000 -- (-428.980) (-426.315) (-433.109) [-426.948] * (-427.621) [-426.611] (-432.478) (-425.022) -- 0:00:07
877500 -- (-427.479) (-425.284) (-430.584) [-426.749] * [-427.158] (-425.358) (-426.899) (-424.802) -- 0:00:07
878000 -- (-428.556) (-426.565) [-427.692] (-425.475) * (-425.777) (-426.697) (-427.147) [-426.855] -- 0:00:07
878500 -- (-427.225) (-426.561) [-427.615] (-425.159) * [-426.653] (-424.966) (-428.654) (-427.010) -- 0:00:07
879000 -- (-430.419) (-426.435) (-427.668) [-425.871] * (-425.663) [-425.747] (-424.586) (-429.271) -- 0:00:07
879500 -- (-431.795) (-425.766) [-426.029] (-429.881) * (-425.284) [-424.888] (-426.460) (-429.192) -- 0:00:07
880000 -- [-425.598] (-427.701) (-425.151) (-424.795) * (-426.427) [-426.576] (-427.983) (-426.585) -- 0:00:07
Average standard deviation of split frequencies: 0.007628
880500 -- [-424.656] (-426.667) (-429.703) (-427.765) * (-426.890) (-425.373) [-426.153] (-427.593) -- 0:00:07
881000 -- (-426.139) (-426.109) (-425.217) [-427.430] * (-430.209) (-425.009) (-426.149) [-427.084] -- 0:00:07
881500 -- (-425.689) (-425.680) [-425.383] (-426.149) * (-427.797) [-427.260] (-425.362) (-430.581) -- 0:00:07
882000 -- (-427.451) (-426.850) [-424.719] (-427.156) * [-426.309] (-426.314) (-426.845) (-427.909) -- 0:00:07
882500 -- [-428.334] (-425.815) (-426.995) (-425.747) * [-427.762] (-427.122) (-427.826) (-426.298) -- 0:00:07
883000 -- (-425.867) (-426.266) [-425.489] (-428.504) * (-428.051) (-425.867) (-425.910) [-426.471] -- 0:00:07
883500 -- (-426.380) (-426.512) (-425.606) [-425.654] * [-426.236] (-428.715) (-427.348) (-426.641) -- 0:00:07
884000 -- (-426.387) (-426.208) [-426.656] (-426.354) * (-426.993) (-427.225) [-426.193] (-426.361) -- 0:00:07
884500 -- [-424.775] (-426.569) (-426.112) (-427.390) * [-428.077] (-426.487) (-428.220) (-427.013) -- 0:00:07
885000 -- (-425.832) (-426.632) [-426.194] (-425.496) * (-425.671) (-426.555) [-426.899] (-429.214) -- 0:00:07
Average standard deviation of split frequencies: 0.008047
885500 -- (-428.730) (-425.930) [-426.015] (-426.470) * [-425.732] (-430.600) (-428.891) (-427.411) -- 0:00:06
886000 -- (-429.059) (-426.596) [-428.440] (-425.023) * [-426.316] (-431.895) (-428.153) (-425.267) -- 0:00:06
886500 -- (-427.419) [-426.621] (-426.546) (-425.472) * [-425.227] (-426.091) (-425.317) (-426.113) -- 0:00:06
887000 -- (-426.321) [-427.608] (-428.125) (-424.651) * (-429.311) [-425.423] (-425.352) (-426.133) -- 0:00:06
887500 -- (-427.309) [-425.323] (-424.703) (-425.024) * (-425.205) (-425.337) [-425.779] (-426.458) -- 0:00:06
888000 -- (-428.187) (-425.240) [-427.106] (-424.784) * (-425.980) (-426.065) [-425.518] (-430.109) -- 0:00:06
888500 -- (-425.326) (-426.151) [-428.567] (-426.282) * (-426.705) (-427.389) [-425.334] (-424.943) -- 0:00:06
889000 -- (-426.214) (-428.092) [-424.675] (-426.247) * (-429.635) (-426.441) (-425.384) [-426.915] -- 0:00:06
889500 -- (-426.023) [-427.570] (-424.974) (-426.971) * (-426.038) [-427.595] (-424.759) (-426.604) -- 0:00:06
890000 -- (-426.931) (-428.570) (-425.111) [-426.811] * (-427.035) [-427.431] (-424.910) (-427.779) -- 0:00:06
Average standard deviation of split frequencies: 0.008005
890500 -- (-426.284) (-426.727) (-426.094) [-425.825] * (-428.035) (-427.271) (-424.971) [-429.278] -- 0:00:06
891000 -- (-429.345) (-426.047) [-425.941] (-426.461) * (-425.962) (-431.744) (-424.924) [-427.392] -- 0:00:06
891500 -- (-426.003) (-426.591) [-428.737] (-427.047) * [-428.230] (-427.758) (-425.216) (-428.687) -- 0:00:06
892000 -- (-426.443) (-429.078) (-429.547) [-426.548] * [-426.331] (-426.642) (-425.636) (-425.289) -- 0:00:06
892500 -- (-426.641) (-425.860) (-432.600) [-427.708] * [-425.818] (-426.823) (-425.692) (-427.350) -- 0:00:06
893000 -- (-426.195) (-428.413) (-432.031) [-425.089] * (-426.081) (-431.110) (-427.286) [-427.696] -- 0:00:06
893500 -- (-428.460) [-425.087] (-428.557) (-425.504) * (-427.787) (-425.376) (-430.158) [-427.638] -- 0:00:06
894000 -- (-426.027) (-425.433) [-431.719] (-425.566) * (-425.122) [-425.907] (-432.495) (-427.861) -- 0:00:06
894500 -- [-424.895] (-425.047) (-432.424) (-425.344) * (-428.927) (-428.320) [-425.244] (-426.387) -- 0:00:06
895000 -- (-426.874) (-428.254) (-430.053) [-425.087] * (-425.914) (-430.083) (-425.354) [-425.228] -- 0:00:06
Average standard deviation of split frequencies: 0.008385
895500 -- (-427.091) [-425.424] (-427.554) (-424.787) * (-429.094) (-429.372) (-425.479) [-427.384] -- 0:00:06
896000 -- (-427.651) (-429.337) (-425.945) [-425.368] * (-430.335) (-432.402) [-425.216] (-426.156) -- 0:00:06
896500 -- (-426.336) [-425.775] (-429.509) (-425.386) * (-429.455) (-425.976) (-431.519) [-430.106] -- 0:00:06
897000 -- (-427.708) (-424.975) [-425.661] (-425.438) * [-425.941] (-426.088) (-426.812) (-436.256) -- 0:00:06
897500 -- (-435.396) (-425.414) [-425.488] (-424.847) * (-425.836) (-430.130) (-427.191) [-426.456] -- 0:00:06
898000 -- (-433.961) (-426.162) (-426.045) [-426.339] * (-425.855) (-426.188) [-424.899] (-426.209) -- 0:00:06
898500 -- (-426.590) (-428.381) [-427.679] (-426.459) * (-426.962) [-428.672] (-427.276) (-429.956) -- 0:00:06
899000 -- (-425.692) (-427.586) [-425.772] (-425.457) * (-424.978) (-430.648) (-425.819) [-425.879] -- 0:00:06
899500 -- (-427.092) [-425.961] (-425.839) (-427.607) * (-426.011) [-425.678] (-427.377) (-425.752) -- 0:00:06
900000 -- (-430.315) (-428.613) (-425.799) [-427.138] * (-426.868) (-428.237) [-427.510] (-430.617) -- 0:00:06
Average standard deviation of split frequencies: 0.008472
900500 -- [-426.689] (-427.193) (-425.275) (-425.830) * [-428.425] (-429.207) (-425.491) (-433.955) -- 0:00:06
901000 -- [-429.335] (-428.105) (-426.578) (-427.212) * (-425.166) (-427.220) (-426.093) [-430.632] -- 0:00:06
901500 -- [-425.808] (-430.317) (-429.512) (-426.260) * (-425.080) (-426.400) (-427.012) [-428.089] -- 0:00:06
902000 -- [-430.347] (-427.070) (-428.732) (-426.522) * [-426.201] (-426.777) (-426.509) (-427.028) -- 0:00:05
902500 -- (-431.400) (-426.935) (-429.654) [-426.998] * (-424.630) (-429.249) (-427.657) [-428.181] -- 0:00:05
903000 -- (-426.648) (-425.943) [-426.641] (-427.833) * (-427.864) [-428.487] (-427.433) (-426.066) -- 0:00:05
903500 -- (-425.598) (-427.515) [-427.720] (-425.874) * (-426.148) [-428.588] (-426.821) (-428.211) -- 0:00:05
904000 -- [-429.116] (-426.040) (-427.619) (-426.745) * (-428.866) [-429.460] (-425.848) (-425.228) -- 0:00:05
904500 -- [-430.947] (-427.274) (-429.807) (-425.565) * (-429.305) (-426.422) [-426.435] (-425.656) -- 0:00:05
905000 -- (-424.884) [-424.925] (-430.523) (-425.587) * (-427.490) (-427.742) (-433.113) [-425.524] -- 0:00:05
Average standard deviation of split frequencies: 0.008097
905500 -- [-426.294] (-426.864) (-427.436) (-426.691) * (-427.908) (-427.918) (-427.131) [-426.825] -- 0:00:05
906000 -- (-429.263) (-426.716) (-429.707) [-426.211] * [-427.360] (-426.300) (-429.477) (-426.274) -- 0:00:05
906500 -- (-430.246) [-430.801] (-427.180) (-427.817) * [-426.791] (-430.898) (-428.736) (-425.049) -- 0:00:05
907000 -- [-428.989] (-428.686) (-429.021) (-425.353) * (-425.241) (-427.492) [-427.539] (-424.987) -- 0:00:05
907500 -- (-426.935) (-425.115) [-425.873] (-428.578) * (-426.616) (-427.324) [-428.456] (-428.415) -- 0:00:05
908000 -- (-426.645) (-425.268) [-427.223] (-427.937) * [-426.861] (-428.232) (-428.254) (-427.918) -- 0:00:05
908500 -- (-425.564) (-426.109) (-425.393) [-425.218] * (-425.553) [-426.345] (-430.534) (-425.120) -- 0:00:05
909000 -- [-425.253] (-427.335) (-431.229) (-428.756) * (-425.104) (-426.651) (-425.910) [-426.027] -- 0:00:05
909500 -- [-425.485] (-425.809) (-427.505) (-427.858) * (-427.078) (-429.484) (-426.886) [-425.763] -- 0:00:05
910000 -- (-426.835) (-426.250) (-424.869) [-426.722] * [-427.975] (-426.016) (-429.738) (-428.494) -- 0:00:05
Average standard deviation of split frequencies: 0.008191
910500 -- (-427.043) (-427.660) [-426.292] (-427.479) * (-426.461) (-425.344) (-425.754) [-428.933] -- 0:00:05
911000 -- [-428.817] (-426.681) (-425.380) (-426.491) * (-428.502) [-426.985] (-426.167) (-429.917) -- 0:00:05
911500 -- (-425.670) [-426.229] (-428.274) (-428.277) * [-428.507] (-425.372) (-428.376) (-427.237) -- 0:00:05
912000 -- [-427.372] (-426.874) (-429.297) (-427.268) * (-425.647) [-424.709] (-424.897) (-427.554) -- 0:00:05
912500 -- (-427.818) (-426.498) (-426.223) [-426.290] * (-430.307) (-426.432) (-426.882) [-425.549] -- 0:00:05
913000 -- [-428.399] (-426.652) (-429.806) (-427.272) * (-428.723) [-427.419] (-428.833) (-425.853) -- 0:00:05
913500 -- (-427.961) [-427.133] (-428.938) (-427.881) * [-428.139] (-433.056) (-426.876) (-425.548) -- 0:00:05
914000 -- (-425.817) [-426.377] (-428.493) (-425.564) * (-428.846) [-428.280] (-426.331) (-425.100) -- 0:00:05
914500 -- (-424.981) [-426.162] (-428.306) (-426.099) * (-427.821) [-429.549] (-426.876) (-426.422) -- 0:00:05
915000 -- (-430.460) (-426.600) (-425.369) [-426.889] * [-430.145] (-425.988) (-428.146) (-428.019) -- 0:00:05
Average standard deviation of split frequencies: 0.008022
915500 -- (-429.153) (-426.095) [-427.169] (-425.997) * (-425.506) (-426.777) (-428.779) [-430.148] -- 0:00:05
916000 -- [-430.808] (-427.549) (-430.378) (-428.964) * [-425.568] (-427.460) (-426.624) (-428.520) -- 0:00:05
916500 -- (-428.096) (-427.725) [-426.024] (-433.315) * [-427.279] (-425.407) (-426.403) (-428.198) -- 0:00:05
917000 -- (-427.989) (-428.808) [-428.558] (-426.710) * (-426.131) (-426.589) [-426.602] (-432.940) -- 0:00:05
917500 -- (-426.590) [-425.543] (-429.822) (-425.553) * (-432.255) [-426.605] (-428.830) (-424.938) -- 0:00:05
918000 -- (-427.967) (-426.803) (-427.288) [-426.848] * [-427.888] (-424.539) (-434.017) (-425.454) -- 0:00:05
918500 -- [-426.478] (-431.681) (-429.401) (-425.771) * (-428.028) (-427.564) (-425.790) [-429.694] -- 0:00:04
919000 -- (-426.702) (-425.985) (-427.949) [-425.987] * (-425.856) (-426.185) [-425.806] (-427.554) -- 0:00:04
919500 -- (-426.015) (-426.238) [-425.409] (-426.485) * (-424.549) (-425.842) (-426.492) [-425.387] -- 0:00:04
920000 -- (-425.098) (-424.887) [-426.200] (-426.121) * (-424.971) (-426.590) (-426.554) [-425.577] -- 0:00:04
Average standard deviation of split frequencies: 0.008128
920500 -- (-425.921) [-425.821] (-426.055) (-428.091) * (-425.037) (-426.779) (-425.796) [-426.058] -- 0:00:04
921000 -- (-425.680) (-427.176) [-429.409] (-427.173) * (-427.728) [-427.728] (-425.051) (-426.109) -- 0:00:04
921500 -- (-425.594) (-428.454) [-430.296] (-426.007) * (-425.897) (-427.350) (-425.766) [-427.202] -- 0:00:04
922000 -- [-427.194] (-428.281) (-425.691) (-427.829) * (-426.617) (-427.232) [-426.443] (-427.122) -- 0:00:04
922500 -- [-425.572] (-426.106) (-427.993) (-427.758) * (-428.994) (-425.898) (-426.193) [-425.563] -- 0:00:04
923000 -- [-427.982] (-425.476) (-429.778) (-428.873) * (-424.952) [-428.037] (-429.064) (-428.353) -- 0:00:04
923500 -- (-427.767) [-427.651] (-425.884) (-430.171) * [-426.434] (-425.447) (-426.649) (-427.687) -- 0:00:04
924000 -- (-427.500) (-425.729) [-428.025] (-425.241) * (-427.688) (-426.723) [-429.142] (-426.094) -- 0:00:04
924500 -- (-425.407) (-430.107) (-425.046) [-425.876] * (-426.586) [-427.401] (-426.025) (-425.910) -- 0:00:04
925000 -- [-425.921] (-427.416) (-425.483) (-425.581) * (-424.834) (-425.522) (-426.217) [-425.719] -- 0:00:04
Average standard deviation of split frequencies: 0.007954
925500 -- (-427.020) [-427.280] (-429.989) (-428.095) * (-424.550) (-427.273) (-427.963) [-425.804] -- 0:00:04
926000 -- (-428.125) [-432.582] (-426.065) (-428.664) * (-427.151) (-428.422) (-435.136) [-426.013] -- 0:00:04
926500 -- (-427.877) [-428.275] (-425.159) (-429.147) * [-429.942] (-426.748) (-428.000) (-426.086) -- 0:00:04
927000 -- (-427.913) [-427.149] (-426.029) (-429.820) * [-427.531] (-425.244) (-425.407) (-430.111) -- 0:00:04
927500 -- (-426.286) (-424.941) (-425.546) [-427.324] * (-428.706) (-430.581) [-425.389] (-428.418) -- 0:00:04
928000 -- (-428.353) (-425.542) [-426.121] (-424.851) * (-426.841) (-429.766) [-426.134] (-427.923) -- 0:00:04
928500 -- [-426.104] (-425.996) (-426.675) (-424.652) * (-425.516) (-425.950) (-427.881) [-425.222] -- 0:00:04
929000 -- (-425.093) (-426.010) [-430.439] (-431.410) * [-425.242] (-424.969) (-428.964) (-426.643) -- 0:00:04
929500 -- (-425.230) (-429.313) [-427.186] (-430.402) * [-425.943] (-425.536) (-428.259) (-427.941) -- 0:00:04
930000 -- (-427.411) (-425.568) [-426.831] (-430.628) * (-424.803) (-425.781) [-427.592] (-428.712) -- 0:00:04
Average standard deviation of split frequencies: 0.007788
930500 -- (-425.728) (-426.319) (-428.758) [-427.061] * (-425.016) (-425.332) [-428.785] (-433.946) -- 0:00:04
931000 -- [-425.730] (-430.332) (-425.761) (-426.844) * (-429.615) (-426.759) (-425.692) [-425.535] -- 0:00:04
931500 -- (-428.932) (-428.594) (-425.325) [-427.146] * (-426.284) (-428.032) (-429.712) [-426.490] -- 0:00:04
932000 -- (-433.214) [-428.340] (-425.178) (-426.454) * (-424.773) (-429.279) [-427.913] (-426.652) -- 0:00:04
932500 -- (-429.031) [-429.628] (-425.546) (-428.034) * [-424.762] (-425.945) (-427.207) (-427.829) -- 0:00:04
933000 -- (-425.032) (-432.794) (-425.051) [-427.244] * [-424.649] (-425.310) (-428.087) (-427.150) -- 0:00:04
933500 -- (-428.711) (-426.452) [-426.262] (-427.308) * (-429.375) (-427.017) [-430.760] (-427.415) -- 0:00:04
934000 -- (-426.858) (-426.734) (-431.876) [-425.277] * [-428.939] (-427.168) (-425.341) (-428.496) -- 0:00:04
934500 -- [-426.682] (-427.337) (-426.049) (-426.844) * (-431.991) (-426.218) [-425.773] (-425.610) -- 0:00:04
935000 -- (-427.414) (-428.498) [-426.076] (-427.056) * [-429.837] (-428.748) (-428.618) (-425.315) -- 0:00:04
Average standard deviation of split frequencies: 0.007525
935500 -- (-426.063) (-430.585) [-427.035] (-430.414) * (-430.074) (-429.331) [-430.191] (-426.821) -- 0:00:03
936000 -- (-426.833) (-428.215) [-429.267] (-427.975) * (-429.657) (-430.250) (-427.198) [-425.606] -- 0:00:03
936500 -- (-428.779) (-426.485) [-426.308] (-427.480) * (-432.404) [-427.237] (-425.010) (-425.082) -- 0:00:03
937000 -- [-428.420] (-427.199) (-426.625) (-425.782) * (-424.754) (-428.346) (-425.791) [-427.144] -- 0:00:03
937500 -- (-427.304) (-428.521) [-426.992] (-426.026) * [-426.635] (-425.876) (-425.902) (-425.547) -- 0:00:03
938000 -- (-428.210) (-427.068) [-426.503] (-425.365) * [-428.256] (-426.880) (-428.342) (-429.436) -- 0:00:03
938500 -- [-425.483] (-425.312) (-425.744) (-425.075) * (-425.938) (-428.057) [-427.144] (-428.356) -- 0:00:03
939000 -- (-425.609) [-425.394] (-426.152) (-425.004) * (-428.044) (-426.415) [-424.841] (-436.211) -- 0:00:03
939500 -- (-426.370) (-425.187) (-430.713) [-424.971] * (-426.179) (-426.505) (-425.423) [-427.515] -- 0:00:03
940000 -- (-425.148) (-426.446) (-430.592) [-427.085] * (-426.638) (-428.000) [-425.626] (-428.223) -- 0:00:03
Average standard deviation of split frequencies: 0.007173
940500 -- (-426.178) [-428.116] (-432.527) (-432.030) * [-429.736] (-425.959) (-427.851) (-426.443) -- 0:00:03
941000 -- (-428.137) [-426.170] (-428.175) (-427.068) * (-429.017) (-427.569) [-425.691] (-432.478) -- 0:00:03
941500 -- (-425.932) [-427.487] (-428.674) (-426.230) * (-430.465) (-425.317) (-426.231) [-426.525] -- 0:00:03
942000 -- (-427.400) [-426.248] (-425.964) (-425.947) * (-426.235) [-425.394] (-424.881) (-424.989) -- 0:00:03
942500 -- (-425.293) [-425.610] (-426.053) (-426.662) * (-433.061) [-425.237] (-424.762) (-426.587) -- 0:00:03
943000 -- [-427.181] (-426.355) (-428.069) (-427.972) * (-430.383) (-425.753) (-424.727) [-425.358] -- 0:00:03
943500 -- [-426.152] (-427.044) (-425.562) (-426.657) * (-430.714) [-427.803] (-426.510) (-425.505) -- 0:00:03
944000 -- (-425.659) (-425.420) [-430.698] (-426.750) * (-428.541) (-429.669) (-428.247) [-427.531] -- 0:00:03
944500 -- (-425.879) (-426.208) [-427.102] (-425.543) * (-427.892) (-430.054) (-427.078) [-426.824] -- 0:00:03
945000 -- (-425.255) (-426.359) (-431.459) [-425.438] * (-427.873) (-430.377) [-427.524] (-431.756) -- 0:00:03
Average standard deviation of split frequencies: 0.007132
945500 -- (-425.274) [-429.103] (-427.188) (-428.125) * [-427.114] (-427.664) (-426.245) (-426.310) -- 0:00:03
946000 -- (-426.757) (-429.859) (-426.078) [-428.087] * (-426.299) [-427.719] (-424.638) (-426.243) -- 0:00:03
946500 -- (-427.407) (-425.548) (-427.606) [-426.328] * [-426.017] (-427.254) (-424.426) (-431.449) -- 0:00:03
947000 -- (-428.443) (-426.181) [-427.626] (-430.408) * (-425.641) (-428.332) (-429.219) [-427.707] -- 0:00:03
947500 -- [-428.371] (-426.753) (-428.783) (-424.874) * (-426.841) (-428.691) [-428.012] (-433.688) -- 0:00:03
948000 -- [-425.225] (-427.524) (-429.838) (-430.944) * (-426.861) (-426.667) (-428.159) [-427.435] -- 0:00:03
948500 -- [-424.435] (-427.973) (-428.452) (-432.596) * (-425.481) (-426.235) [-428.571] (-425.767) -- 0:00:03
949000 -- (-425.971) (-426.933) [-425.345] (-430.634) * (-426.570) (-425.551) (-429.336) [-425.951] -- 0:00:03
949500 -- (-426.345) (-426.899) [-429.511] (-428.261) * (-426.028) (-425.611) (-427.859) [-427.122] -- 0:00:03
950000 -- (-426.340) [-426.134] (-429.008) (-427.139) * (-428.733) (-427.895) (-427.172) [-424.999] -- 0:00:03
Average standard deviation of split frequencies: 0.007146
950500 -- (-428.833) (-428.364) (-427.258) [-425.497] * (-425.817) (-424.886) (-426.011) [-426.999] -- 0:00:03
951000 -- (-428.415) (-425.975) (-427.320) [-425.813] * [-426.304] (-424.703) (-425.842) (-427.640) -- 0:00:03
951500 -- [-425.975] (-428.316) (-427.375) (-427.057) * (-426.442) (-424.497) (-426.423) [-425.034] -- 0:00:03
952000 -- [-425.924] (-428.384) (-424.598) (-426.204) * [-428.201] (-426.419) (-429.827) (-426.710) -- 0:00:02
952500 -- [-428.277] (-429.625) (-428.908) (-428.084) * (-425.125) (-426.433) [-427.024] (-426.172) -- 0:00:02
953000 -- [-424.690] (-433.614) (-425.095) (-431.873) * [-425.105] (-427.231) (-425.487) (-425.740) -- 0:00:02
953500 -- [-425.669] (-426.194) (-427.377) (-427.222) * (-432.320) [-427.380] (-426.154) (-424.906) -- 0:00:02
954000 -- [-426.198] (-428.281) (-426.034) (-425.318) * (-427.733) (-428.497) [-427.238] (-425.423) -- 0:00:02
954500 -- (-425.211) [-426.813] (-427.280) (-426.750) * (-425.610) (-426.359) [-427.177] (-426.537) -- 0:00:02
955000 -- (-425.476) [-427.174] (-425.408) (-429.764) * (-427.943) [-424.977] (-428.118) (-427.174) -- 0:00:02
Average standard deviation of split frequencies: 0.006961
955500 -- (-426.179) [-425.724] (-427.293) (-428.586) * (-425.017) (-426.655) [-426.082] (-424.564) -- 0:00:02
956000 -- (-427.379) (-426.132) [-425.096] (-427.507) * (-425.132) (-427.221) (-427.488) [-424.530] -- 0:00:02
956500 -- (-426.883) (-426.716) [-425.250] (-427.056) * [-425.631] (-426.813) (-428.169) (-429.755) -- 0:00:02
957000 -- (-424.866) [-427.748] (-428.622) (-424.771) * (-424.686) (-427.273) (-428.485) [-428.058] -- 0:00:02
957500 -- [-427.347] (-425.649) (-429.668) (-428.724) * (-426.687) (-426.281) (-428.592) [-426.155] -- 0:00:02
958000 -- (-427.602) (-427.201) [-427.839] (-427.683) * (-425.265) (-426.725) (-428.889) [-426.255] -- 0:00:02
958500 -- (-428.692) (-426.127) (-428.725) [-426.543] * (-426.449) (-430.605) [-431.675] (-430.195) -- 0:00:02
959000 -- [-425.978] (-425.836) (-434.105) (-424.789) * [-425.761] (-426.702) (-428.558) (-428.503) -- 0:00:02
959500 -- (-427.866) (-425.484) [-425.932] (-424.789) * [-425.002] (-426.001) (-425.718) (-426.233) -- 0:00:02
960000 -- (-425.417) [-425.770] (-424.891) (-429.988) * [-425.947] (-426.116) (-429.378) (-426.344) -- 0:00:02
Average standard deviation of split frequencies: 0.007245
960500 -- (-424.847) (-429.983) [-426.046] (-426.896) * [-427.358] (-433.498) (-427.644) (-426.991) -- 0:00:02
961000 -- [-426.761] (-429.772) (-426.421) (-425.997) * [-425.794] (-429.171) (-426.859) (-430.294) -- 0:00:02
961500 -- (-432.894) [-427.876] (-427.930) (-427.192) * (-427.943) (-431.315) (-426.264) [-424.608] -- 0:00:02
962000 -- (-427.534) (-425.055) [-427.459] (-428.230) * (-426.044) (-428.087) (-427.036) [-425.662] -- 0:00:02
962500 -- [-426.261] (-424.542) (-427.011) (-427.880) * (-430.352) [-429.397] (-427.752) (-425.456) -- 0:00:02
963000 -- (-425.176) (-426.992) [-426.268] (-427.386) * (-425.323) [-428.724] (-433.474) (-425.215) -- 0:00:02
963500 -- (-426.876) (-427.823) (-427.611) [-425.040] * (-425.855) (-427.380) [-427.738] (-430.303) -- 0:00:02
964000 -- [-427.530] (-426.645) (-426.479) (-424.661) * (-426.837) [-425.286] (-425.251) (-426.079) -- 0:00:02
964500 -- [-427.510] (-426.795) (-429.627) (-425.047) * (-431.977) (-425.220) (-425.958) [-427.683] -- 0:00:02
965000 -- (-425.758) (-429.506) [-426.530] (-425.123) * [-427.449] (-425.049) (-426.744) (-426.101) -- 0:00:02
Average standard deviation of split frequencies: 0.007492
965500 -- (-426.433) (-429.589) (-425.710) [-428.098] * [-426.875] (-426.173) (-428.113) (-426.709) -- 0:00:02
966000 -- (-427.131) (-431.735) (-428.082) [-426.630] * (-429.649) (-429.337) [-427.908] (-427.329) -- 0:00:02
966500 -- [-426.213] (-430.827) (-426.447) (-426.870) * (-429.030) (-430.892) [-424.962] (-425.931) -- 0:00:02
967000 -- (-426.142) (-426.331) (-426.895) [-427.989] * (-429.165) (-429.642) [-425.714] (-428.991) -- 0:00:02
967500 -- (-428.182) [-424.876] (-428.604) (-427.883) * (-428.203) (-426.770) (-428.561) [-428.606] -- 0:00:02
968000 -- (-425.578) [-427.345] (-425.286) (-427.200) * [-425.288] (-425.597) (-431.338) (-425.738) -- 0:00:01
968500 -- (-425.511) (-427.804) (-427.863) [-427.106] * (-432.337) (-424.955) [-427.509] (-427.531) -- 0:00:01
969000 -- (-424.378) (-425.345) (-428.117) [-429.039] * (-427.406) (-427.857) (-424.938) [-425.583] -- 0:00:01
969500 -- [-425.744] (-425.598) (-427.124) (-425.826) * (-425.063) [-426.052] (-426.383) (-432.190) -- 0:00:01
970000 -- (-428.789) (-429.071) (-430.659) [-427.073] * (-429.305) [-425.484] (-427.988) (-429.177) -- 0:00:01
Average standard deviation of split frequencies: 0.007342
970500 -- (-425.279) [-429.182] (-431.894) (-427.793) * [-429.187] (-427.108) (-424.918) (-429.408) -- 0:00:01
971000 -- [-426.464] (-426.985) (-425.324) (-430.224) * (-426.786) (-428.285) [-428.549] (-428.688) -- 0:00:01
971500 -- (-425.926) (-426.747) [-424.937] (-433.773) * (-425.573) (-425.845) (-426.349) [-426.718] -- 0:00:01
972000 -- (-430.848) (-427.817) [-425.807] (-426.728) * [-425.877] (-428.492) (-426.929) (-424.941) -- 0:00:01
972500 -- [-427.067] (-425.852) (-428.356) (-430.385) * (-425.900) [-427.237] (-426.291) (-426.313) -- 0:00:01
973000 -- (-426.348) (-426.509) (-432.236) [-427.044] * (-428.381) [-429.380] (-424.803) (-424.890) -- 0:00:01
973500 -- (-426.050) (-426.582) [-429.872] (-428.524) * (-426.265) (-426.955) (-426.377) [-426.844] -- 0:00:01
974000 -- (-425.624) (-428.371) (-427.549) [-425.029] * (-429.241) (-429.806) [-425.006] (-428.226) -- 0:00:01
974500 -- (-426.173) [-427.429] (-427.585) (-426.236) * (-427.812) [-425.936] (-427.706) (-424.600) -- 0:00:01
975000 -- (-427.373) [-427.167] (-427.893) (-425.545) * [-426.733] (-429.989) (-425.804) (-425.203) -- 0:00:01
Average standard deviation of split frequencies: 0.007273
975500 -- (-426.326) (-428.017) [-428.552] (-426.106) * (-431.048) [-429.277] (-428.178) (-425.892) -- 0:00:01
976000 -- (-429.665) [-429.108] (-426.690) (-426.161) * (-428.340) [-426.031] (-428.614) (-429.678) -- 0:00:01
976500 -- (-424.645) (-428.767) (-430.990) [-426.536] * (-431.085) (-427.998) (-425.944) [-425.396] -- 0:00:01
977000 -- (-425.219) (-426.151) (-427.451) [-427.019] * (-425.600) [-425.925] (-425.571) (-426.372) -- 0:00:01
977500 -- (-425.722) [-426.008] (-426.113) (-426.462) * (-425.981) (-426.085) (-428.246) [-427.203] -- 0:00:01
978000 -- [-425.915] (-426.892) (-427.673) (-429.222) * [-427.435] (-427.548) (-424.869) (-427.263) -- 0:00:01
978500 -- [-426.423] (-426.946) (-424.935) (-429.588) * (-427.008) (-429.012) (-426.514) [-424.486] -- 0:00:01
979000 -- (-427.306) [-427.053] (-426.477) (-426.226) * (-426.581) (-429.565) (-427.498) [-426.171] -- 0:00:01
979500 -- (-428.797) (-428.058) (-427.984) [-425.583] * (-430.090) [-426.157] (-426.745) (-428.010) -- 0:00:01
980000 -- (-430.554) (-426.972) (-428.350) [-425.931] * (-428.236) (-426.854) (-425.694) [-428.116] -- 0:00:01
Average standard deviation of split frequencies: 0.007324
980500 -- (-428.394) (-425.029) (-427.211) [-426.035] * (-426.943) [-426.654] (-427.153) (-426.920) -- 0:00:01
981000 -- (-428.984) [-426.624] (-426.576) (-426.404) * (-428.469) (-426.646) (-431.452) [-425.317] -- 0:00:01
981500 -- [-427.338] (-427.271) (-425.564) (-424.654) * [-426.944] (-426.276) (-433.972) (-425.467) -- 0:00:01
982000 -- [-425.425] (-427.870) (-426.123) (-424.729) * (-425.708) (-428.410) (-426.181) [-426.313] -- 0:00:01
982500 -- (-425.207) (-426.778) [-426.812] (-425.399) * (-425.888) [-430.730] (-429.830) (-426.950) -- 0:00:01
983000 -- (-425.115) (-427.973) [-427.173] (-425.337) * (-427.921) (-428.264) (-426.402) [-425.845] -- 0:00:01
983500 -- (-426.787) (-432.506) (-426.601) [-429.781] * (-424.596) [-427.948] (-431.921) (-425.920) -- 0:00:01
984000 -- [-425.005] (-426.390) (-429.388) (-427.282) * (-427.387) (-428.467) (-425.080) [-428.309] -- 0:00:00
984500 -- [-426.377] (-428.190) (-426.673) (-431.521) * [-427.173] (-426.061) (-426.384) (-427.072) -- 0:00:00
985000 -- (-424.932) [-425.852] (-425.077) (-426.591) * (-427.732) (-425.421) [-425.911] (-427.985) -- 0:00:00
Average standard deviation of split frequencies: 0.007565
985500 -- (-424.751) (-425.583) [-428.272] (-427.343) * [-428.330] (-426.355) (-428.935) (-430.821) -- 0:00:00
986000 -- (-427.668) [-425.827] (-426.914) (-429.887) * (-431.623) (-424.566) [-428.551] (-430.310) -- 0:00:00
986500 -- (-426.047) (-425.806) (-425.917) [-425.589] * (-427.954) [-425.227] (-426.299) (-429.951) -- 0:00:00
987000 -- (-427.945) (-425.710) (-425.450) [-426.846] * [-425.919] (-426.728) (-426.015) (-425.927) -- 0:00:00
987500 -- [-425.996] (-427.011) (-426.413) (-431.647) * (-428.643) (-426.640) (-425.990) [-427.567] -- 0:00:00
988000 -- (-426.542) (-431.522) (-426.901) [-430.166] * (-428.306) (-426.110) (-428.823) [-425.352] -- 0:00:00
988500 -- (-425.591) [-426.268] (-427.739) (-429.056) * (-429.798) (-427.262) (-428.600) [-428.665] -- 0:00:00
989000 -- (-424.776) [-426.649] (-427.938) (-427.666) * (-428.346) (-427.954) [-427.170] (-434.964) -- 0:00:00
989500 -- (-426.756) (-426.355) (-427.621) [-426.894] * (-424.760) (-426.673) [-427.714] (-427.320) -- 0:00:00
990000 -- (-425.644) (-427.029) (-427.464) [-426.179] * [-425.666] (-427.330) (-427.208) (-427.382) -- 0:00:00
Average standard deviation of split frequencies: 0.008037
990500 -- (-425.324) (-426.005) [-426.382] (-428.385) * (-427.322) (-427.118) [-425.500] (-426.480) -- 0:00:00
991000 -- (-424.861) (-427.289) [-425.672] (-425.122) * (-426.591) (-426.327) [-426.659] (-428.492) -- 0:00:00
991500 -- [-424.826] (-427.246) (-427.251) (-427.581) * (-431.557) (-426.791) (-429.516) [-428.716] -- 0:00:00
992000 -- (-425.478) (-427.767) [-425.676] (-433.686) * (-429.961) [-426.577] (-426.540) (-426.925) -- 0:00:00
992500 -- (-424.946) [-426.216] (-429.956) (-427.281) * (-428.026) (-426.092) [-429.291] (-424.693) -- 0:00:00
993000 -- (-427.661) (-427.478) [-424.962] (-427.385) * (-425.105) (-425.340) (-426.200) [-428.617] -- 0:00:00
993500 -- (-426.907) (-426.497) (-430.893) [-428.370] * [-425.088] (-426.113) (-425.906) (-426.492) -- 0:00:00
994000 -- (-427.666) [-425.887] (-429.593) (-429.930) * (-424.997) (-427.365) [-426.149] (-426.211) -- 0:00:00
994500 -- [-425.958] (-426.878) (-432.530) (-426.163) * [-425.033] (-429.845) (-429.771) (-425.351) -- 0:00:00
995000 -- (-426.551) (-427.711) [-427.237] (-425.924) * (-425.673) (-428.245) [-425.251] (-425.957) -- 0:00:00
Average standard deviation of split frequencies: 0.007768
995500 -- [-425.431] (-425.613) (-425.712) (-428.205) * [-425.633] (-425.605) (-427.477) (-424.738) -- 0:00:00
996000 -- (-425.040) [-424.782] (-425.599) (-429.016) * (-426.763) (-426.288) [-425.730] (-425.881) -- 0:00:00
996500 -- (-425.190) (-427.102) [-425.151] (-427.053) * (-425.498) (-425.019) (-425.227) [-425.204] -- 0:00:00
997000 -- (-429.167) (-426.099) [-425.936] (-429.611) * (-426.292) (-425.348) [-429.028] (-426.180) -- 0:00:00
997500 -- [-428.405] (-426.385) (-425.576) (-425.327) * (-426.422) (-425.583) [-426.169] (-428.073) -- 0:00:00
998000 -- (-429.780) [-425.119] (-426.633) (-425.234) * (-430.145) [-426.475] (-428.186) (-424.603) -- 0:00:00
998500 -- (-427.197) (-427.289) (-429.496) [-425.762] * (-425.720) [-429.626] (-425.472) (-424.616) -- 0:00:00
999000 -- [-425.765] (-427.499) (-425.739) (-426.525) * [-425.643] (-428.768) (-426.315) (-428.181) -- 0:00:00
999500 -- (-425.880) (-425.616) [-426.331] (-425.546) * [-426.871] (-431.952) (-425.517) (-428.207) -- 0:00:00
1000000 -- (-427.348) [-425.416] (-428.242) (-428.358) * (-429.267) (-432.200) (-425.777) [-425.122] -- 0:00:00
Average standard deviation of split frequencies: 0.007676
Analysis completed in 1 mins 2 seconds
Analysis used 60.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -424.36
Likelihood of best state for "cold" chain of run 2 was -424.36
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.7 % ( 24 %) Dirichlet(Pi{all})
38.2 % ( 29 %) Slider(Pi{all})
78.6 % ( 53 %) Multiplier(Alpha{1,2})
78.0 % ( 58 %) Multiplier(Alpha{3})
25.4 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.2 % ( 80 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
40.2 % ( 29 %) Dirichlet(Pi{all})
39.0 % ( 29 %) Slider(Pi{all})
78.9 % ( 52 %) Multiplier(Alpha{1,2})
77.7 % ( 57 %) Multiplier(Alpha{3})
26.2 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.0 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166603 0.82 0.67
3 | 166854 166294 0.84
4 | 166606 166751 166892
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166408 0.82 0.67
3 | 166081 167192 0.84
4 | 167284 166241 166794
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -426.06
| 1 1 2 |
| 1 1|
| 1 2 1 1 22 1 * |
|1 112 11 11122 |
| 1 2 2 212 1 1 2 1 2 * |
| *2 1 2 2 1 11 2 2 1 2 12|
| 1 22 1 1 2 1 21 2* 2 2 2 * 12 |
| 211 12* * 21 *212 2 2 |
|2 221 1 122 12 2 2 211 1 |
| 2 2 1 1 |
| 1 2 21 |
| 1 2 |
| 1 |
| 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -427.94
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -426.07 -428.78
2 -426.08 -429.88
--------------------------------------
TOTAL -426.08 -429.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890360 0.088058 0.369499 1.487910 0.863325 1428.31 1464.65 1.000
r(A<->C){all} 0.177335 0.021563 0.000022 0.468229 0.139267 241.48 247.15 1.003
r(A<->G){all} 0.162645 0.018597 0.000023 0.446616 0.126906 225.44 229.18 1.013
r(A<->T){all} 0.159084 0.018157 0.000039 0.419760 0.123905 186.29 222.40 1.000
r(C<->G){all} 0.168732 0.019430 0.000017 0.445961 0.133844 167.76 245.67 1.000
r(C<->T){all} 0.176270 0.022272 0.000509 0.483223 0.136686 205.00 206.71 1.001
r(G<->T){all} 0.155935 0.018131 0.000001 0.424579 0.118945 226.10 233.09 1.000
pi(A){all} 0.255775 0.000608 0.208735 0.305712 0.255851 1309.16 1405.08 1.000
pi(C){all} 0.284099 0.000661 0.240210 0.340056 0.283462 1241.33 1340.68 1.000
pi(G){all} 0.274890 0.000612 0.226893 0.322496 0.274518 1369.16 1435.08 1.000
pi(T){all} 0.185235 0.000477 0.143932 0.229971 0.184731 1419.48 1460.24 1.000
alpha{1,2} 0.408928 0.216801 0.000140 1.340468 0.236217 1271.79 1312.80 1.000
alpha{3} 0.459584 0.246332 0.000116 1.486232 0.288680 1202.07 1223.50 1.000
pinvar{all} 0.994659 0.000047 0.981823 0.999999 0.996779 1043.15 1140.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .****.
9 -- ..*..*
10 -- .*.***
11 -- .***.*
12 -- ..****
13 -- .*...*
14 -- ...*.*
15 -- .**...
16 -- ..**..
17 -- .*.*..
18 -- .*..*.
19 -- ....**
20 -- ..*.*.
21 -- .**.**
22 -- ..***.
23 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.000471 0.155230 0.155896 2
8 459 0.152898 0.016488 0.141239 0.164557 2
9 453 0.150899 0.007066 0.145903 0.155896 2
10 444 0.147901 0.012248 0.139241 0.156562 2
11 441 0.146902 0.010835 0.139241 0.154564 2
12 431 0.143571 0.002355 0.141905 0.145237 2
13 428 0.142572 0.002827 0.140573 0.144570 2
14 426 0.141905 0.014133 0.131912 0.151899 2
15 423 0.140906 0.001413 0.139907 0.141905 2
16 420 0.139907 0.000942 0.139241 0.140573 2
17 418 0.139241 0.017901 0.126582 0.151899 2
18 417 0.138907 0.001413 0.137908 0.139907 2
19 411 0.136909 0.008009 0.131246 0.142572 2
20 398 0.132578 0.014133 0.122585 0.142572 2
21 397 0.132245 0.002355 0.130580 0.133911 2
22 290 0.096602 0.008480 0.090606 0.102598 2
23 288 0.095936 0.009422 0.089274 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101751 0.009905 0.000020 0.299494 0.071304 1.000 2
length{all}[2] 0.097475 0.009412 0.000007 0.300049 0.065756 1.000 2
length{all}[3] 0.096734 0.009453 0.000009 0.290177 0.065527 1.000 2
length{all}[4] 0.100165 0.010064 0.000029 0.294994 0.069418 1.000 2
length{all}[5] 0.099020 0.009838 0.000016 0.294767 0.069935 1.001 2
length{all}[6] 0.096962 0.009251 0.000002 0.287319 0.067028 1.000 2
length{all}[7] 0.109087 0.012352 0.000525 0.335575 0.075592 0.999 2
length{all}[8] 0.102081 0.011587 0.000223 0.339322 0.065534 0.999 2
length{all}[9] 0.098938 0.010778 0.000048 0.299773 0.064028 1.011 2
length{all}[10] 0.100089 0.011328 0.000344 0.300860 0.061310 0.999 2
length{all}[11] 0.089877 0.007956 0.000066 0.255877 0.064535 1.000 2
length{all}[12] 0.100950 0.009088 0.000101 0.289208 0.072258 1.004 2
length{all}[13] 0.099063 0.008431 0.000156 0.286324 0.075994 0.998 2
length{all}[14] 0.100793 0.008897 0.000319 0.296953 0.069673 0.998 2
length{all}[15] 0.108906 0.013634 0.000376 0.328312 0.067616 0.999 2
length{all}[16] 0.100921 0.009506 0.000063 0.279983 0.071762 0.998 2
length{all}[17] 0.095148 0.009241 0.000037 0.284033 0.064772 0.998 2
length{all}[18] 0.100570 0.007396 0.000270 0.265037 0.077055 1.004 2
length{all}[19] 0.102427 0.011145 0.000165 0.312722 0.064883 0.998 2
length{all}[20] 0.091386 0.008341 0.000140 0.262601 0.063903 0.999 2
length{all}[21] 0.102094 0.009999 0.000025 0.289059 0.072085 1.000 2
length{all}[22] 0.100296 0.009333 0.000032 0.283092 0.068840 0.997 2
length{all}[23] 0.098825 0.009200 0.000087 0.289626 0.070835 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007676
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 309
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 34 patterns at 103 / 103 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 34 patterns at 103 / 103 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
33184 bytes for conP
2992 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094514 0.012515 0.096609 0.096788 0.055638 0.013978 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -426.173369
Iterating by ming2
Initial: fx= 426.173369
x= 0.09451 0.01251 0.09661 0.09679 0.05564 0.01398 0.30000 1.30000
1 h-m-p 0.0000 0.0001 247.3818 ++ 418.657540 m 0.0001 13 | 1/8
2 h-m-p 0.0160 8.0000 18.5811 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 225.9433 ++ 417.924660 m 0.0000 46 | 2/8
4 h-m-p 0.0160 8.0000 15.2862 -------------.. | 2/8
5 h-m-p 0.0000 0.0004 201.5571 +++ 401.116429 m 0.0004 80 | 3/8
6 h-m-p 0.0160 8.0000 13.6666 -------------.. | 3/8
7 h-m-p 0.0000 0.0004 175.6646 +++ 389.110957 m 0.0004 114 | 4/8
8 h-m-p 0.0160 8.0000 14.6131 -------------.. | 4/8
9 h-m-p 0.0000 0.0000 144.5399 ++ 388.674401 m 0.0000 147 | 5/8
10 h-m-p 0.0160 8.0000 11.9218 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 102.2466 ++ 388.655743 m 0.0000 180 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 --C 388.655743 0 0.0004 193 | 6/8
13 h-m-p 0.2385 8.0000 0.0000 ------Y 388.655743 0 0.0000 212
Out..
lnL = -388.655743
213 lfun, 213 eigenQcodon, 1278 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087037 0.089846 0.068171 0.022642 0.066113 0.101039 0.300151 0.520820 0.109695
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.967023
np = 9
lnL0 = -428.729443
Iterating by ming2
Initial: fx= 428.729443
x= 0.08704 0.08985 0.06817 0.02264 0.06611 0.10104 0.30015 0.52082 0.10970
1 h-m-p 0.0000 0.0003 203.1812 +++ 417.242141 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0007 194.0573 ++ 400.909285 m 0.0007 27 | 2/9
3 h-m-p 0.0006 0.0029 61.5538 ++ 392.716500 m 0.0029 39 | 3/9
4 h-m-p 0.0000 0.0001 424.4296 ++ 391.877577 m 0.0001 51 | 4/9
5 h-m-p 0.0001 0.0005 462.3785 ++ 389.951135 m 0.0005 63 | 4/9
6 h-m-p 0.0000 0.0000 62952.4592 -------.. | 4/9
7 h-m-p 0.0000 0.0000 179.7491 ++ 388.869701 m 0.0000 92 | 5/9
8 h-m-p 0.0000 0.0000 113.2942 ++ 388.797932 m 0.0000 104 | 6/9
9 h-m-p 0.0000 0.0000 157644.2197 ++ 388.655791 m 0.0000 116 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 388.655791 m 8.0000 128 | 6/9
11 h-m-p 0.0000 0.0000 0.1067
h-m-p: 8.18276922e-16 4.09138461e-15 1.06716200e-01 388.655791
.. | 6/9
12 h-m-p 0.0160 8.0000 0.0004 +++++ 388.655789 m 8.0000 157 | 6/9
13 h-m-p 0.0539 8.0000 0.0631 ++++ 388.655746 m 8.0000 174 | 6/9
14 h-m-p 1.6000 8.0000 0.0269 ++ 388.655743 m 8.0000 189 | 6/9
15 h-m-p 0.3996 1.9978 0.3609 ++ 388.655737 m 1.9978 204 | 7/9
16 h-m-p 0.0040 0.0200 0.6117 ++ 388.655737 m 0.0200 219 | 7/9
17 h-m-p 0.0000 0.0000 3.3713
h-m-p: 0.00000000e+00 0.00000000e+00 3.37132810e+00 388.655737
.. | 7/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 388.655737 m 8.0000 245 | 8/9
19 h-m-p 0.0160 8.0000 0.0264 -------Y 388.655737 0 0.0000 266 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 388.655737 m 8.0000 306 | 8/9
22 h-m-p 0.0160 8.0000 0.7303 +++++ 388.655699 m 8.0000 322 | 8/9
23 h-m-p 1.6000 8.0000 0.5712 ++ 388.655693 m 8.0000 335 | 8/9
24 h-m-p 1.4016 8.0000 3.2601 ++ 388.655686 m 8.0000 348 | 8/9
25 h-m-p 1.6000 8.0000 2.1934 ++ 388.655685 m 8.0000 360 | 8/9
26 h-m-p 1.3122 8.0000 13.3723 ++ 388.655683 m 8.0000 372 | 8/9
27 h-m-p 1.6000 8.0000 42.6857 ++ 388.655683 m 8.0000 384 | 8/9
28 h-m-p 1.6000 8.0000 10.6728 ---------C 388.655683 0 0.0000 405 | 8/9
29 h-m-p 0.9231 8.0000 0.0000 --------------Y 388.655683 0 0.0000 431
Out..
lnL = -388.655683
432 lfun, 1296 eigenQcodon, 5184 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036575 0.093464 0.010056 0.107110 0.107672 0.017749 503.129332 1.657941 0.173975 0.376105 1.471686
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.039864
np = 11
lnL0 = -423.425586
Iterating by ming2
Initial: fx= 423.425586
x= 0.03657 0.09346 0.01006 0.10711 0.10767 0.01775 503.12933 1.65794 0.17397 0.37610 1.47169
1 h-m-p 0.0000 0.0001 218.7129 ++ 418.149644 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0004 116.0992 ++ 414.068477 m 0.0004 30 | 2/11
3 h-m-p 0.0001 0.0004 113.1059 ++ 408.138081 m 0.0004 44 | 3/11
4 h-m-p 0.0003 0.0021 128.2174 ++ 390.748824 m 0.0021 58 | 4/11
5 h-m-p 0.0000 0.0001 651.8564 ++ 388.695243 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0001 118.3901 ++ 388.667592 m 0.0001 86 | 6/11
7 h-m-p 0.0160 8.0000 2.3058 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 99.3343 ++ 388.655674 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 Y 388.655674 0 0.0297 139 | 7/11
10 h-m-p 0.0640 8.0000 0.0000 ---C 388.655674 0 0.0003 160
Out..
lnL = -388.655674
161 lfun, 644 eigenQcodon, 2898 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -388.663431 S = -388.654600 -0.003378
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:02
did 20 / 34 patterns 0:03
did 30 / 34 patterns 0:03
did 34 / 34 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011469 0.060966 0.109152 0.017760 0.079729 0.038141 503.129331 0.208369 1.061436
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.078238
np = 9
lnL0 = -417.670191
Iterating by ming2
Initial: fx= 417.670191
x= 0.01147 0.06097 0.10915 0.01776 0.07973 0.03814 503.12933 0.20837 1.06144
1 h-m-p 0.0000 0.0001 212.0472 ++ 411.860946 m 0.0001 14 | 1/9
2 h-m-p 0.0023 0.0753 10.7535 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 197.1495 ++ 409.150720 m 0.0001 48 | 2/9
4 h-m-p 0.0013 0.0360 9.5172 -----------.. | 2/9
5 h-m-p 0.0000 0.0002 176.8265 +++ 401.910798 m 0.0002 82 | 3/9
6 h-m-p 0.0038 0.0272 8.9528 ------------.. | 3/9
7 h-m-p 0.0000 0.0003 157.6222 +++ 395.461247 m 0.0003 117 | 4/9
8 h-m-p 0.0044 0.0288 7.3859 ------------.. | 4/9
9 h-m-p 0.0000 0.0002 132.6553 +++ 391.734045 m 0.0002 152 | 5/9
10 h-m-p 0.0036 0.0385 5.3027 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 95.2284 +++ 388.655667 m 0.0003 187 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 388.655667 m 8.0000 199 | 6/9
13 h-m-p 0.0044 2.2203 0.4767 ----------Y 388.655667 0 0.0000 224 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 C 388.655667 0 0.0040 239 | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 388.655667 m 8.0000 257 | 6/9
16 h-m-p 0.0160 8.0000 0.6156 +++++ 388.655662 m 8.0000 275 | 6/9
17 h-m-p 1.6000 8.0000 0.2530 ++ 388.655662 m 8.0000 290 | 6/9
18 h-m-p 0.7788 8.0000 2.5994 ++ 388.655661 m 8.0000 305 | 6/9
19 h-m-p 1.6000 8.0000 7.6516 ++ 388.655661 m 8.0000 317 | 6/9
20 h-m-p 0.0424 0.2121 43.8424 ++ 388.655661 m 0.2121 329 | 7/9
21 h-m-p 0.0115 0.1252 65.4448 ++ 388.655655 m 0.1252 341 | 7/9
22 h-m-p 1.6000 8.0000 2.7858 --------
QuantileBeta(0.15, 0.00501, 99.00000) = 4.733339e-162 2000 rounds
-Y 388.655655 0 0.0000 362 | 7/9
23 h-m-p 1.6000 8.0000 0.0000 +Y 388.655655 0 6.4000 375
Out..
lnL = -388.655655
376 lfun, 4136 eigenQcodon, 22560 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045512 0.097806 0.090566 0.048035 0.070494 0.098994 503.277920 0.900000 0.341737 1.663446 1.300048
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.062682
np = 11
lnL0 = -427.826032
Iterating by ming2
Initial: fx= 427.826032
x= 0.04551 0.09781 0.09057 0.04804 0.07049 0.09899 503.27792 0.90000 0.34174 1.66345 1.30005
1 h-m-p 0.0000 0.0006 190.3513 +++ 405.784475 m 0.0006 17 | 1/11
2 h-m-p 0.0000 0.0001 104.7254 ++ 404.539738 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0002 472.1320 ++ 395.808282 m 0.0002 45 | 3/11
4 h-m-p 0.0008 0.0041 55.0487 ++ 390.173516 m 0.0041 59 | 4/11
5 h-m-p 0.0003 0.0017 139.5671 ++ 389.327497 m 0.0017 73 | 5/11
6 h-m-p 0.0092 0.0459 10.9348 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 139.8294 ++ 388.765373 m 0.0000 112 | 6/11
8 h-m-p 0.0019 0.3258 1.5217 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 99.4516 ++ 388.655680 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 388.655680 m 8.0000 167 | 7/11
11 h-m-p 0.1701 8.0000 0.0001 ----C 388.655680 0 0.0002 189
Out..
lnL = -388.655680
190 lfun, 2280 eigenQcodon, 12540 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -388.661545 S = -388.654131 -0.003250
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:12
did 20 / 34 patterns 0:13
did 30 / 34 patterns 0:13
did 34 / 34 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
NC_011896_1_WP_010908353_1_1552_MLBR_RS07355 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NC_002677_1_NP_302032_1_904_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NZ_CP029543_1_WP_010908353_1_1581_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
NZ_AP014567_1_WP_010908353_1_1620_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT
**************************************************
NC_011896_1_WP_010908353_1_1552_MLBR_RS07355 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
NC_002677_1_NP_302032_1_904_rplU NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255 NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
NZ_CP029543_1_WP_010908353_1_1581_rplU NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
NZ_AP014567_1_WP_010908353_1_1620_rplU NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT
**************************************************
NC_011896_1_WP_010908353_1_1552_MLBR_RS07355 GIK
NC_002677_1_NP_302032_1_904_rplU GIK
NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715 GIK
NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255 GIK
NZ_CP029543_1_WP_010908353_1_1581_rplU GIK
NZ_AP014567_1_WP_010908353_1_1620_rplU GIK
***
>NC_011896_1_WP_010908353_1_1552_MLBR_RS07355 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG >NC_002677_1_NP_302032_1_904_rplU ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG >NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG >NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255 ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG >NZ_CP029543_1_WP_010908353_1_1581_rplU ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG >NZ_AP014567_1_WP_010908353_1_1620_rplU ATGGCGACCTATGCAATCGTCAAGACCGGTGGCAAGCAGTACAAGGTTGC TGTGGGAGACGTGGTCAAGATCGAGAAGCTCGACTTCGAGCCCGGCGCCA AGGTATCTTTGCCCGTCACCTTGGTCGTCGATGGCGCCACCGTCACCACC AATGCCAAAGCTTTGGCCAAAGTTGCGGTGACCGGTAAAGTGCTCGAGCA CACCAAGGGTCCCAAGATCCGTATCCACAAGTTCAAGAACAAGACTGGCT ACCATAAGCGCCAGGGACACCGTCAGCAGTTGACTGTCCTCAAGGTCACT GGCATCAAG
>NC_011896_1_WP_010908353_1_1552_MLBR_RS07355 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK >NC_002677_1_NP_302032_1_904_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK >NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK >NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255 MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK >NZ_CP029543_1_WP_010908353_1_1581_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK >NZ_AP014567_1_WP_010908353_1_1620_rplU MATYAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTT NAKALAKVAVTGKVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVT GIK
#NEXUS
[ID: 0897259577]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908353_1_1552_MLBR_RS07355
NC_002677_1_NP_302032_1_904_rplU
NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715
NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255
NZ_CP029543_1_WP_010908353_1_1581_rplU
NZ_AP014567_1_WP_010908353_1_1620_rplU
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908353_1_1552_MLBR_RS07355,
2 NC_002677_1_NP_302032_1_904_rplU,
3 NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715,
4 NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255,
5 NZ_CP029543_1_WP_010908353_1_1581_rplU,
6 NZ_AP014567_1_WP_010908353_1_1620_rplU
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07130396,2:0.06575579,3:0.06552703,4:0.06941784,5:0.06993497,6:0.06702812);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07130396,2:0.06575579,3:0.06552703,4:0.06941784,5:0.06993497,6:0.06702812);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -426.07 -428.78
2 -426.08 -429.88
--------------------------------------
TOTAL -426.08 -429.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplU/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890360 0.088058 0.369499 1.487910 0.863325 1428.31 1464.65 1.000
r(A<->C){all} 0.177335 0.021563 0.000022 0.468229 0.139267 241.48 247.15 1.003
r(A<->G){all} 0.162645 0.018597 0.000023 0.446616 0.126906 225.44 229.18 1.013
r(A<->T){all} 0.159084 0.018157 0.000039 0.419760 0.123905 186.29 222.40 1.000
r(C<->G){all} 0.168732 0.019430 0.000017 0.445961 0.133844 167.76 245.67 1.000
r(C<->T){all} 0.176270 0.022272 0.000509 0.483223 0.136686 205.00 206.71 1.001
r(G<->T){all} 0.155935 0.018131 0.000001 0.424579 0.118945 226.10 233.09 1.000
pi(A){all} 0.255775 0.000608 0.208735 0.305712 0.255851 1309.16 1405.08 1.000
pi(C){all} 0.284099 0.000661 0.240210 0.340056 0.283462 1241.33 1340.68 1.000
pi(G){all} 0.274890 0.000612 0.226893 0.322496 0.274518 1369.16 1435.08 1.000
pi(T){all} 0.185235 0.000477 0.143932 0.229971 0.184731 1419.48 1460.24 1.000
alpha{1,2} 0.408928 0.216801 0.000140 1.340468 0.236217 1271.79 1312.80 1.000
alpha{3} 0.459584 0.246332 0.000116 1.486232 0.288680 1202.07 1223.50 1.000
pinvar{all} 0.994659 0.000047 0.981823 0.999999 0.996779 1043.15 1140.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplU/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 103
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 3 3 3 3 3 3 | CAC 3 3 3 3 3 3 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 4 4 4 4 4 4 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 8 8 8 8 8 8 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 14 14 14 14 14 14 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 2 2 2 2 2 2 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908353_1_1552_MLBR_RS07355
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
#2: NC_002677_1_NP_302032_1_904_rplU
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
#3: NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
#4: NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
#5: NZ_CP029543_1_WP_010908353_1_1581_rplU
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
#6: NZ_AP014567_1_WP_010908353_1_1620_rplU
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 12
CTC 18 | CCC 18 | CAC 18 | CGC 6
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 0 | CCG 0 | CAG 24 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 0
ATC 30 | ACC 48 | AAC 6 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 84 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 18
GTC 48 | GCC 24 | GAC 12 | GGC 30
GTA 6 | GCA 6 | Glu E GAA 0 | GGA 12
GTG 24 | GCG 12 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09709 C:0.16505 A:0.34951 G:0.38835
position 2: T:0.29126 C:0.23301 A:0.34951 G:0.12621
position 3: T:0.16505 C:0.45631 A:0.06796 G:0.31068
Average T:0.18447 C:0.28479 A:0.25566 G:0.27508
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -388.655743 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300151 1.300048
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908353_1_1552_MLBR_RS07355: 0.000004, NC_002677_1_NP_302032_1_904_rplU: 0.000004, NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715: 0.000004, NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255: 0.000004, NZ_CP029543_1_WP_010908353_1_1581_rplU: 0.000004, NZ_AP014567_1_WP_010908353_1_1620_rplU: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30015
omega (dN/dS) = 1.30005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 261.8 47.2 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -388.655683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 503.129332 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908353_1_1552_MLBR_RS07355: 0.000004, NC_002677_1_NP_302032_1_904_rplU: 0.000004, NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715: 0.000004, NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255: 0.000004, NZ_CP029543_1_WP_010908353_1_1581_rplU: 0.000004, NZ_AP014567_1_WP_010908353_1_1620_rplU: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 503.12933
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 234.5 74.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -388.655674 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 503.129331 0.715141 0.153056 0.000001 1.474458
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908353_1_1552_MLBR_RS07355: 0.000004, NC_002677_1_NP_302032_1_904_rplU: 0.000004, NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715: 0.000004, NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255: 0.000004, NZ_CP029543_1_WP_010908353_1_1581_rplU: 0.000004, NZ_AP014567_1_WP_010908353_1_1620_rplU: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 503.12933
MLEs of dN/dS (w) for site classes (K=3)
p: 0.71514 0.15306 0.13180
w: 0.00000 1.00000 1.47446
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
7..2 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
7..3 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
7..4 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
7..5 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
7..6 0.000 234.5 74.5 0.3474 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908353_1_1552_MLBR_RS07355)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908353_1_1552_MLBR_RS07355)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -388.655655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 503.277920 0.005003 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908353_1_1552_MLBR_RS07355: 0.000004, NC_002677_1_NP_302032_1_904_rplU: 0.000004, NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715: 0.000004, NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255: 0.000004, NZ_CP029543_1_WP_010908353_1_1581_rplU: 0.000004, NZ_AP014567_1_WP_010908353_1_1620_rplU: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 503.27792
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 234.5 74.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -388.655680 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 503.277921 0.524983 0.005000 1.702343 1.510069
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908353_1_1552_MLBR_RS07355: 0.000004, NC_002677_1_NP_302032_1_904_rplU: 0.000004, NZ_LVXE01000004_1_WP_010908353_1_1714_A3216_RS02715: 0.000004, NZ_LYPH01000077_1_WP_010908353_1_2546_A8144_RS12255: 0.000004, NZ_CP029543_1_WP_010908353_1_1581_rplU: 0.000004, NZ_AP014567_1_WP_010908353_1_1620_rplU: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 503.27792
Parameters in M8 (beta&w>1):
p0 = 0.52498 p = 0.00500 q = 1.70234
(p1 = 0.47502) w = 1.51007
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05250 0.05250 0.05250 0.05250 0.05250 0.05250 0.05250 0.05250 0.05250 0.05250 0.47502
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.51007
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
7..2 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
7..3 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
7..4 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
7..5 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
7..6 0.000 234.5 74.5 0.7173 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908353_1_1552_MLBR_RS07355)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908353_1_1552_MLBR_RS07355)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:13
Model 1: NearlyNeutral -388.655683 Model 2: PositiveSelection -388.655674 Model 0: one-ratio -388.655743 Model 7: beta -388.655655 Model 8: beta&w>1 -388.65568 Model 0 vs 1 1.199999999244028E-4 Model 2 vs 1 1.8000000068241206E-5 Model 8 vs 7 4.999999998744897E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
